Citrus Sinensis ID: 029285
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 196 | ||||||
| 388493084 | 200 | unknown [Lotus japonicus] | 0.923 | 0.905 | 0.724 | 2e-73 | |
| 359807103 | 206 | uncharacterized protein LOC100805881 [Gl | 0.948 | 0.902 | 0.705 | 7e-72 | |
| 449489903 | 206 | PREDICTED: uncharacterized LOC101203815 | 0.908 | 0.864 | 0.726 | 3e-71 | |
| 356547897 | 209 | PREDICTED: uncharacterized protein LOC10 | 0.943 | 0.885 | 0.705 | 6e-71 | |
| 297738629 | 199 | unnamed protein product [Vitis vinifera] | 0.933 | 0.919 | 0.711 | 8e-71 | |
| 15242020 | 197 | Lactoylglutathione lyase / glyoxalase I | 0.857 | 0.852 | 0.754 | 9e-71 | |
| 225444850 | 205 | PREDICTED: uncharacterized protein ywkD- | 0.933 | 0.892 | 0.711 | 9e-71 | |
| 147789730 | 205 | hypothetical protein VITISV_016330 [Viti | 0.933 | 0.892 | 0.711 | 9e-71 | |
| 297796591 | 196 | lactoylglutathione lyase family protein | 0.836 | 0.836 | 0.773 | 8e-70 | |
| 449452528 | 175 | PREDICTED: uncharacterized protein LOC10 | 0.841 | 0.942 | 0.760 | 3e-69 |
| >gi|388493084|gb|AFK34608.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Score = 280 bits (716), Expect = 2e-73, Method: Compositional matrix adjust.
Identities = 134/185 (72%), Positives = 155/185 (83%), Gaps = 4/185 (2%)
Query: 11 NYVNRLSVNFTLTYTSSQFYQTTTVRKCRCNGQFLTTKAKMSVEGGILKKEPIRDSDKID 70
NYV+ + L S+FY + V+ RC ++ KA+++VEG +L KE ++ D
Sbjct: 19 NYVSFSPLTMNL---RSKFYHAS-VKNGRCYVPSMSIKAQVAVEGDVLDKESEPINEGSD 74
Query: 71 YGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELP 130
YGVVS+HHVGILCENLER L+FYQN+LGLEINEARPHDKLPYRGAWLWVG+EMIHLMELP
Sbjct: 75 YGVVSIHHVGILCENLERPLDFYQNVLGLEINEARPHDKLPYRGAWLWVGSEMIHLMELP 134
Query: 131 NPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANALE 190
NPDPL+GRP+HGGRDRHTCIAIRDVSKLK ILDKAGISYTLS+SGRPAIFTRDPDANALE
Sbjct: 135 NPDPLTGRPQHGGRDRHTCIAIRDVSKLKAILDKAGISYTLSRSGRPAIFTRDPDANALE 194
Query: 191 FTQVD 195
FTQ+D
Sbjct: 195 FTQID 199
|
Source: Lotus japonicus Species: Lotus japonicus Genus: Lotus Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359807103|ref|NP_001241602.1| uncharacterized protein LOC100805881 [Glycine max] gi|255638057|gb|ACU19343.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449489903|ref|XP_004158454.1| PREDICTED: uncharacterized LOC101203815 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356547897|ref|XP_003542341.1| PREDICTED: uncharacterized protein LOC100788142 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297738629|emb|CBI27874.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15242020|ref|NP_200514.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis thaliana] gi|8777444|dbj|BAA97034.1| unnamed protein product [Arabidopsis thaliana] gi|21594695|gb|AAM66034.1| unknown [Arabidopsis thaliana] gi|88193792|gb|ABD42985.1| At5g57040 [Arabidopsis thaliana] gi|110742698|dbj|BAE99260.1| hypothetical protein [Arabidopsis thaliana] gi|332009455|gb|AED96838.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225444850|ref|XP_002281014.1| PREDICTED: uncharacterized protein ywkD-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147789730|emb|CAN63060.1| hypothetical protein VITISV_016330 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297796591|ref|XP_002866180.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. lyrata] gi|297312015|gb|EFH42439.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449452528|ref|XP_004144011.1| PREDICTED: uncharacterized protein LOC101203815 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 196 | ||||||
| TAIR|locus:2164600 | 197 | AT5G57040 "AT5G57040" [Arabido | 0.806 | 0.802 | 0.786 | 9.4e-66 | |
| TAIR|locus:2016254 | 167 | GLYI7 "AT1G80160" [Arabidopsis | 0.617 | 0.724 | 0.304 | 1.9e-12 | |
| TAIR|locus:2037728 | 174 | GLYI4 "AT1G15380" [Arabidopsis | 0.617 | 0.695 | 0.304 | 1e-11 | |
| TIGR_CMR|BA_0607 | 128 | BA_0607 "glyoxylase family pro | 0.596 | 0.914 | 0.344 | 1.3e-11 | |
| TAIR|locus:2057522 | 184 | GLYI8 "AT2G28420" [Arabidopsis | 0.591 | 0.630 | 0.296 | 7.6e-09 | |
| UNIPROTKB|Q9KL58 | 127 | VC_A0890 "Glyoxylase I family | 0.586 | 0.905 | 0.296 | 1.1e-07 | |
| TIGR_CMR|VC_A0890 | 127 | VC_A0890 "glyoxylase I family | 0.586 | 0.905 | 0.296 | 1.1e-07 | |
| TIGR_CMR|CPS_2825 | 128 | CPS_2825 "glyoxylase family pr | 0.596 | 0.914 | 0.284 | 3.8e-07 | |
| UNIPROTKB|E2REA1 | 189 | MCEE "Uncharacterized protein" | 0.561 | 0.582 | 0.285 | 4.4e-06 | |
| UNIPROTKB|Q96PE7 | 176 | MCEE "Methylmalonyl-CoA epimer | 0.561 | 0.625 | 0.293 | 1e-05 |
| TAIR|locus:2164600 AT5G57040 "AT5G57040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 669 (240.6 bits), Expect = 9.4e-66, P = 9.4e-66
Identities = 129/164 (78%), Positives = 145/164 (88%)
Query: 35 VRKCRCNGQFLTTKAKM---SVEG-GILKKEPIRDSDKIDYGVVSVHHVGILCENLERSL 90
VRK R N +F + KAK S+EG +++++ + ++K DYGVV VHHVG+LCENLERSL
Sbjct: 36 VRKERINVRFYSLKAKAQGSSIEGISVVQEKEL--NNKTDYGVVGVHHVGLLCENLERSL 93
Query: 91 EFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDPLSGRPEHGGRDRHTCI 150
EFYQNILGLEINEARPHDKLPYRGAWLWVG+EMIHLMELPNPDPL+GRPEHGGRDRH CI
Sbjct: 94 EFYQNILGLEINEARPHDKLPYRGAWLWVGSEMIHLMELPNPDPLTGRPEHGGRDRHACI 153
Query: 151 AIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANALEFTQV 194
AIRDVS LK ILDKAGI+YT+SKSGRPAIFTRDPDANALEFTQV
Sbjct: 154 AIRDVSNLKEILDKAGIAYTMSKSGRPAIFTRDPDANALEFTQV 197
|
|
| TAIR|locus:2016254 GLYI7 "AT1G80160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037728 GLYI4 "AT1G15380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_0607 BA_0607 "glyoxylase family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057522 GLYI8 "AT2G28420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KL58 VC_A0890 "Glyoxylase I family protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_A0890 VC_A0890 "glyoxylase I family protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2825 CPS_2825 "glyoxylase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2REA1 MCEE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96PE7 MCEE "Methylmalonyl-CoA epimerase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00016519001 | SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (199 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 196 | |||
| cd07245 | 114 | cd07245, Glo_EDI_BRP_like_9, This conserved domain | 2e-36 | |
| pfam00903 | 120 | pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist | 2e-13 | |
| cd06587 | 110 | cd06587, Glo_EDI_BRP_like, This domain superfamily | 1e-12 | |
| cd08354 | 122 | cd08354, Glo_EDI_BRP_like_13, This conserved domai | 3e-12 | |
| COG0346 | 138 | COG0346, GloA, Lactoylglutathione lyase and relate | 3e-12 | |
| cd08352 | 125 | cd08352, Glo_EDI_BRP_like_1, This conserved domain | 1e-11 | |
| pfam12681 | 109 | pfam12681, Glyoxalase_2, Glyoxalase-like domain | 1e-08 | |
| PRK11478 | 129 | PRK11478, PRK11478, putative lyase; Provisional | 3e-08 | |
| cd08346 | 126 | cd08346, PcpA_N_like, N-terminal domain of Sphingo | 7e-08 | |
| cd07253 | 125 | cd07253, Glo_EDI_BRP_like_2, This conserved domain | 1e-06 | |
| pfam13669 | 110 | pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resi | 6e-06 | |
| TIGR03081 | 128 | TIGR03081, metmalonyl_epim, methylmalonyl-CoA epim | 7e-06 | |
| cd07233 | 121 | cd07233, Glyoxalase_I, Glyoxalase I catalyzes the | 8e-06 | |
| cd07255 | 125 | cd07255, Glo_EDI_BRP_like_12, This conserved domai | 1e-04 | |
| cd07249 | 128 | cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | 4e-04 | |
| cd08357 | 125 | cd08357, Glo_EDI_BRP_like_18, This conserved domai | 0.001 | |
| cd07242 | 128 | cd07242, Glo_EDI_BRP_like_6, This conserved domain | 0.002 | |
| cd07244 | 121 | cd07244, FosA, FosA, a Fosfomycin resistance prote | 0.003 |
| >gnl|CDD|176669 cd07245, Glo_EDI_BRP_like_9, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
Score = 122 bits (309), Expect = 2e-36
Identities = 44/120 (36%), Positives = 59/120 (49%), Gaps = 10/120 (8%)
Query: 76 VHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVG-AEMIHLMELPNPDP 134
+ HV + +LE S FY ++LGLE P + GAWL+ G +HL+E PD
Sbjct: 1 LDHVALRVPDLEASRAFYTDVLGLEEGPRPPF---LFPGAWLYAGDGPQLHLIEEDPPDA 57
Query: 135 LSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKS---GRPAIFTRDPDANALEF 191
L PE GRD H + D+ + L AG+ YT S G +F RDPD N +E
Sbjct: 58 L---PEGPGRDDHIAFRVDDLDAFRARLKAAGVPYTESDVPGDGVRQLFVRDPDGNRIEL 114
|
This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases. Length = 114 |
| >gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176702 cd08354, Glo_EDI_BRP_like_13, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|211358 cd08352, Glo_EDI_BRP_like_1, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|183156 PRK11478, PRK11478, putative lyase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211356 cd08346, PcpA_N_like, N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176676 cd07253, Glo_EDI_BRP_like_2, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|222305 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213772 TIGR03081, metmalonyl_epim, methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >gnl|CDD|211352 cd07255, Glo_EDI_BRP_like_12, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >gnl|CDD|176705 cd08357, Glo_EDI_BRP_like_18, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176666 cd07242, Glo_EDI_BRP_like_6, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176668 cd07244, FosA, FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| PLN02367 | 233 | lactoylglutathione lyase | 99.86 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 99.86 | |
| PRK11478 | 129 | putative lyase; Provisional | 99.85 | |
| PLN03042 | 185 | Lactoylglutathione lyase; Provisional | 99.84 | |
| cd07241 | 125 | Glo_EDI_BRP_like_3 This conserved domain belongs t | 99.83 | |
| TIGR03645 | 162 | glyox_marine lactoylglutathione lyase family prote | 99.83 | |
| cd08352 | 125 | Glo_EDI_BRP_like_1 This conserved domain belongs t | 99.83 | |
| cd08342 | 136 | HPPD_N_like N-terminal domain of 4-hydroxyphenylpy | 99.82 | |
| cd07243 | 143 | 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg | 99.81 | |
| cd07233 | 121 | Glyoxalase_I Glyoxalase I catalyzes the isomerizat | 99.81 | |
| cd07253 | 125 | Glo_EDI_BRP_like_2 This conserved domain belongs t | 99.81 | |
| TIGR03081 | 128 | metmalonyl_epim methylmalonyl-CoA epimerase. Membe | 99.81 | |
| cd07245 | 114 | Glo_EDI_BRP_like_9 This conserved domain belongs t | 99.81 | |
| TIGR00068 | 150 | glyox_I lactoylglutathione lyase. Glyoxylase I is | 99.81 | |
| cd08364 | 131 | FosX FosX, a fosfomycin resistance protein, cataly | 99.8 | |
| PRK04101 | 139 | fosfomycin resistance protein FosB; Provisional | 99.79 | |
| PRK10291 | 129 | glyoxalase I; Provisional | 99.79 | |
| PLN02300 | 286 | lactoylglutathione lyase | 99.79 | |
| cd08347 | 157 | PcpA_C_like C-terminal domain of Sphingobium chlor | 99.78 | |
| cd08363 | 131 | FosB FosB, a fosfomycin resistance protein, cataly | 99.78 | |
| cd08355 | 122 | Glo_EDI_BRP_like_14 This conserved domain belongs | 99.77 | |
| cd09014 | 166 | BphC-JF8_C_like C-terminal, catalytic, domain of B | 99.77 | |
| cd07242 | 128 | Glo_EDI_BRP_like_6 This conserved domain belongs t | 99.77 | |
| cd07257 | 153 | THT_oxygenase_C The C-terminal domain of 2,4,5-Tri | 99.77 | |
| cd07263 | 119 | Glo_EDI_BRP_like_16 This conserved domain belongs | 99.77 | |
| cd07247 | 114 | SgaA_N_like N-terminal domain of Streptomyces gris | 99.77 | |
| cd07265 | 122 | 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg | 99.77 | |
| cd07255 | 125 | Glo_EDI_BRP_like_12 This conserved domain belongs | 99.77 | |
| cd07252 | 120 | BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro | 99.77 | |
| cd08346 | 126 | PcpA_N_like N-terminal domain of Sphingobium chlor | 99.76 | |
| cd09011 | 120 | Glo_EDI_BRP_like_23 This conserved domain belongs | 99.76 | |
| cd08361 | 124 | PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma | 99.76 | |
| PF00903 | 128 | Glyoxalase: Glyoxalase/Bleomycin resistance protei | 99.76 | |
| cd09013 | 121 | BphC-JF8_N_like N-terminal, non-catalytic, domain | 99.76 | |
| cd07267 | 113 | THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr | 99.76 | |
| cd07264 | 125 | Glo_EDI_BRP_like_15 This conserved domain belongs | 99.76 | |
| cd07249 | 128 | MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als | 99.75 | |
| cd08360 | 134 | MhqB_like_C C-terminal domain of Burkholderia sp. | 99.75 | |
| cd07246 | 122 | Glo_EDI_BRP_like_8 This conserved domain belongs t | 99.75 | |
| cd08351 | 123 | ChaP_like ChaP, an enzyme involved in the biosynth | 99.75 | |
| cd08348 | 134 | BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro | 99.75 | |
| cd07244 | 121 | FosA FosA, a Fosfomycin resistance protein, cataly | 99.75 | |
| cd08358 | 127 | Glo_EDI_BRP_like_21 This conserved domain belongs | 99.74 | |
| cd07256 | 161 | HPCD_C_class_II C-terminal domain of 3,4-dihydroxy | 99.74 | |
| cd07237 | 154 | BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro | 99.74 | |
| cd08362 | 120 | BphC5-RrK37_N_like N-terminal, non-catalytic, doma | 99.74 | |
| cd07240 | 117 | ED_TypeI_classII_N N-terminal domain of type I, cl | 99.74 | |
| cd08345 | 113 | Fosfomycin_RP Fosfomycin resistant protein; inhibi | 99.73 | |
| cd08359 | 119 | Glo_EDI_BRP_like_22 This conserved domain belongs | 99.73 | |
| cd07239 | 144 | BphC5-RK37_C_like C-terminal, catalytic, domain of | 99.72 | |
| cd07235 | 122 | MRD Mitomycin C resistance protein (MRD). Mitomyci | 99.71 | |
| cd08354 | 122 | Glo_EDI_BRP_like_13 This conserved domain belongs | 99.71 | |
| cd08343 | 131 | ED_TypeI_classII_C C-terminal domain of type I, cl | 99.71 | |
| cd08349 | 112 | BLMA_like Bleomycin binding protein (BLMA) and sim | 99.71 | |
| cd09012 | 124 | Glo_EDI_BRP_like_24 This conserved domain belongs | 99.7 | |
| cd08350 | 120 | BLMT_like BLMT, a bleomycin resistance protein enc | 99.7 | |
| cd06587 | 112 | Glo_EDI_BRP_like This domain superfamily is found | 99.7 | |
| PRK06724 | 128 | hypothetical protein; Provisional | 99.7 | |
| cd08357 | 125 | Glo_EDI_BRP_like_18 This conserved domain belongs | 99.69 | |
| cd07266 | 121 | HPCD_N_class_II N-terminal domain of 3,4-dihydroxy | 99.69 | |
| cd08356 | 113 | Glo_EDI_BRP_like_17 This conserved domain belongs | 99.68 | |
| cd07254 | 120 | Glo_EDI_BRP_like_20 This conserved domain belongs | 99.68 | |
| cd07258 | 141 | PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma | 99.68 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.68 | |
| cd07262 | 123 | Glo_EDI_BRP_like_19 This conserved domain belongs | 99.67 | |
| PF12681 | 108 | Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B | 99.66 | |
| cd07238 | 112 | Glo_EDI_BRP_like_5 This conserved domain belongs t | 99.66 | |
| cd07261 | 114 | Glo_EDI_BRP_like_11 This conserved domain belongs | 99.66 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 99.65 | |
| cd08344 | 112 | MhqB_like_N N-terminal domain of MhqB, a type I ex | 99.65 | |
| cd07251 | 121 | Glo_EDI_BRP_like_10 This conserved domain belongs | 99.65 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.64 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.63 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.6 | |
| KOG2944 | 170 | consensus Glyoxalase [Carbohydrate transport and m | 99.59 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 99.59 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 99.58 | |
| PLN02300 | 286 | lactoylglutathione lyase | 99.58 | |
| COG3565 | 138 | Predicted dioxygenase of extradiol dioxygenase fam | 99.46 | |
| COG3324 | 127 | Predicted enzyme related to lactoylglutathione lya | 99.42 | |
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 99.41 | |
| COG3607 | 133 | Predicted lactoylglutathione lyase [General functi | 99.41 | |
| cd07250 | 191 | HPPD_C_like C-terminal domain of 4-hydroxyphenylpy | 99.33 | |
| cd06588 | 128 | PhnB_like Escherichia coli PhnB and similar protei | 99.27 | |
| KOG2943 | 299 | consensus Predicted glyoxalase [Carbohydrate trans | 99.25 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 99.21 | |
| COG0346 | 138 | GloA Lactoylglutathione lyase and related lyases [ | 99.19 | |
| COG2764 | 136 | PhnB Uncharacterized protein conserved in bacteria | 99.16 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 99.12 | |
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 98.92 | |
| PRK01037 | 357 | trmD tRNA (guanine-N(1)-)-methyltransferase/unknow | 98.8 | |
| PF13468 | 175 | Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. | 98.71 | |
| KOG2943 | 299 | consensus Predicted glyoxalase [Carbohydrate trans | 98.67 | |
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 98.58 | |
| PF14506 | 125 | CppA_N: CppA N-terminal; PDB: 3E0R_D. | 98.55 | |
| PRK10148 | 147 | hypothetical protein; Provisional | 98.51 | |
| PF14696 | 139 | Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H | 98.36 | |
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 98.22 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 98.02 | |
| KOG0638 | 381 | consensus 4-hydroxyphenylpyruvate dioxygenase [Ami | 98.02 | |
| PF06983 | 116 | 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans | 97.43 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 97.31 | |
| PF15067 | 236 | FAM124: FAM124 family | 97.1 | |
| KOG0638 | 381 | consensus 4-hydroxyphenylpyruvate dioxygenase [Ami | 96.31 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 95.88 | |
| PF14507 | 101 | CppA_C: CppA C-terminal; PDB: 3E0R_D. | 95.22 | |
| KOG2944 | 170 | consensus Glyoxalase [Carbohydrate transport and m | 94.17 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 93.7 | |
| PLN02367 | 233 | lactoylglutathione lyase | 92.28 | |
| cd07249 | 128 | MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als | 92.14 | |
| cd08342 | 136 | HPPD_N_like N-terminal domain of 4-hydroxyphenylpy | 91.18 | |
| PRK11478 | 129 | putative lyase; Provisional | 90.79 | |
| cd08347 | 157 | PcpA_C_like C-terminal domain of Sphingobium chlor | 90.49 | |
| cd08352 | 125 | Glo_EDI_BRP_like_1 This conserved domain belongs t | 89.95 | |
| PF13670 | 83 | PepSY_2: Peptidase propeptide and YPEB domain This | 89.8 | |
| PLN03042 | 185 | Lactoylglutathione lyase; Provisional | 88.72 | |
| cd07242 | 128 | Glo_EDI_BRP_like_6 This conserved domain belongs t | 88.66 | |
| cd07268 | 149 | Glo_EDI_BRP_like_4 This conserved domain belongs t | 88.65 | |
| PF06185 | 185 | YecM: YecM protein; InterPro: IPR010393 This famil | 88.5 | |
| TIGR03645 | 162 | glyox_marine lactoylglutathione lyase family prote | 87.72 | |
| cd06587 | 112 | Glo_EDI_BRP_like This domain superfamily is found | 87.3 | |
| PRK10291 | 129 | glyoxalase I; Provisional | 87.3 | |
| TIGR03081 | 128 | metmalonyl_epim methylmalonyl-CoA epimerase. Membe | 86.9 | |
| cd08346 | 126 | PcpA_N_like N-terminal domain of Sphingobium chlor | 86.65 | |
| cd07245 | 114 | Glo_EDI_BRP_like_9 This conserved domain belongs t | 86.04 | |
| PRK11700 | 187 | hypothetical protein; Provisional | 86.01 | |
| cd07233 | 121 | Glyoxalase_I Glyoxalase I catalyzes the isomerizat | 85.47 | |
| cd07235 | 122 | MRD Mitomycin C resistance protein (MRD). Mitomyci | 85.43 | |
| cd08348 | 134 | BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro | 84.95 | |
| cd07241 | 125 | Glo_EDI_BRP_like_3 This conserved domain belongs t | 84.55 | |
| PF12681 | 108 | Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B | 82.98 | |
| cd07263 | 119 | Glo_EDI_BRP_like_16 This conserved domain belongs | 82.74 | |
| cd07255 | 125 | Glo_EDI_BRP_like_12 This conserved domain belongs | 82.5 | |
| cd07252 | 120 | BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro | 80.96 |
| >PLN02367 lactoylglutathione lyase | Back alignment and domain information |
|---|
Probab=99.86 E-value=4.5e-20 Score=147.30 Aligned_cols=122 Identities=16% Similarity=0.227 Sum_probs=95.4
Q ss_pred ceeeEEEEEcCCHHHHHHHHHhccCCEEeeecCCCCCCceeEEEEeC-------------------CeEEEEEecCCCCC
Q 029285 74 VSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVG-------------------AEMIHLMELPNPDP 134 (196)
Q Consensus 74 ~~l~hv~l~v~Dl~~a~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g-------------------~~~l~l~~~~~~~~ 134 (196)
-.+.|++|+|+|++++++||+++|||++..+.+.++..+..+|+..+ +..++|........
T Consensus 74 ~~~~HtmlRVkDle~Sl~FYt~vLGm~ll~r~d~pe~~f~lyFL~~~~~~~~p~d~~~r~~~~~~~~~~LELt~n~g~e~ 153 (233)
T PLN02367 74 YIMQQTMYRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTASAPTDPTERTVWTFGQKATIELTHNWGTES 153 (233)
T ss_pred cEEEEEEEEeCCHHHHHHHHHHhcCCEEeEEEecCCCcEEEEEeecCCccccccccccceeeccCCCCEEEEecCCCCCc
Confidence 47899999999999999999999999999887777766777777531 24788876544321
Q ss_pred --CCCCC--C--CCCCceEEEEEECCHHHHHHHHHHCCCeEEeeCC-C--ceEEEEEcCCCCeEEEEeec
Q 029285 135 --LSGRP--E--HGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKS-G--RPAIFTRDPDANALEFTQVD 195 (196)
Q Consensus 135 --~~~~p--~--~~~~~~hi~f~v~dl~~~~~~l~~~G~~~~~~~~-g--~~~~~~~DPdG~~iEl~e~~ 195 (196)
..... . ...+.+||||.|+|+++++++|+++|+++...+. + .+.+|++|||||.|||+|..
T Consensus 154 ~~~~~~y~~gn~~p~G~~HIaf~VdDVdaa~erL~a~Gv~~v~~P~~g~~~riaFIkDPDGn~IEL~e~~ 223 (233)
T PLN02367 154 DPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFEELGVEFVKKPNDGKMKGIAFIKDPDGYWIEIFDLK 223 (233)
T ss_pred cccchhcccCCCCCCCceEEEEEcCCHHHHHHHHHHCCCEEEeCCccCCceEEEEEECCCCCEEEEEecc
Confidence 11111 1 1257899999999999999999999999976542 2 46789999999999999865
|
|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PRK11478 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PLN03042 Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03645 glyox_marine lactoylglutathione lyase family protein | Back alignment and domain information |
|---|
| >cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR00068 glyox_I lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 | Back alignment and domain information |
|---|
| >PRK04101 fosfomycin resistance protein FosB; Provisional | Back alignment and domain information |
|---|
| >PRK10291 glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin | Back alignment and domain information |
|---|
| >cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway | Back alignment and domain information |
|---|
| >cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains | Back alignment and domain information |
|---|
| >cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein | Back alignment and domain information |
|---|
| >cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase | Back alignment and domain information |
|---|
| >cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >cd08360 MhqB_like_C C-terminal domain of Burkholderia sp | Back alignment and domain information |
|---|
| >cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins | Back alignment and domain information |
|---|
| >cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive | Back alignment and domain information |
|---|
| >cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins | Back alignment and domain information |
|---|
| >cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain | Back alignment and domain information |
|---|
| >cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin | Back alignment and domain information |
|---|
| >cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins | Back alignment and domain information |
|---|
| >cd07235 MRD Mitomycin C resistance protein (MRD) | Back alignment and domain information |
|---|
| >cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain | Back alignment and domain information |
|---|
| >cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm | Back alignment and domain information |
|---|
| >cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins | Back alignment and domain information |
|---|
| >cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >PRK06724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A | Back alignment and domain information |
|---|
| >cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins | Back alignment and domain information |
|---|
| >cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] | Back alignment and domain information |
|---|
| >COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3607 Predicted lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E | Back alignment and domain information |
|---|
| >KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B | Back alignment and domain information |
|---|
| >KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >PRK10148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF15067 FAM124: FAM124 family | Back alignment and domain information |
|---|
| >KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PLN02367 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >PRK11478 putative lyase; Provisional | Back alignment and domain information |
|---|
| >cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF13670 PepSY_2: Peptidase propeptide and YPEB domain This Prosite motif covers only the active site | Back alignment and domain information |
|---|
| >PLN03042 Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF06185 YecM: YecM protein; InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03645 glyox_marine lactoylglutathione lyase family protein | Back alignment and domain information |
|---|
| >cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >PRK10291 glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PRK11700 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >cd07235 MRD Mitomycin C resistance protein (MRD) | Back alignment and domain information |
|---|
| >cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A | Back alignment and domain information |
|---|
| >cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 196 | ||||
| 3rmu_A | 134 | Crystal Structure Of Human Methylmalonyl-Coa Epimer | 2e-06 |
| >pdb|3RMU|A Chain A, Crystal Structure Of Human Methylmalonyl-Coa Epimerase, Mcee Length = 134 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 196 | |||
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 5e-32 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 1e-28 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 5e-28 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 2e-25 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 2e-23 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 6e-23 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 3e-22 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 1e-20 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 7e-20 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 2e-19 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 6e-18 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 1e-17 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 3e-17 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 4e-17 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 2e-16 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 3e-16 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 8e-16 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 1e-14 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 2e-14 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 5e-14 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 5e-14 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 2e-12 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 6e-06 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 2e-12 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 4e-12 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 1e-05 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 4e-11 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 5e-11 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 5e-11 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 6e-11 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 2e-10 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 3e-10 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 6e-10 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 2e-09 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 5e-09 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 1e-08 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 1e-08 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 2e-08 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 4e-08 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 3e-06 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 4e-08 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 7e-08 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 7e-08 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 8e-08 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 1e-07 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 2e-07 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 8e-06 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 2e-07 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 4e-07 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 6e-07 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 9e-07 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 1e-06 | |
| 3eck_A | 365 | Protein (homoprotocatechuate 2,3-dioxygenase); oxi | 2e-06 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 2e-06 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 2e-06 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 2e-04 | |
| 1xrk_A | 124 | Bleomycin resistance protein; arm exchange, ligand | 8e-06 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 1e-05 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 3e-05 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 6e-05 | |
| 1qto_A | 122 | Bleomycin-binding protein; arm-exchange, antibioti | 6e-05 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 7e-05 | |
| 1ecs_A | 126 | Bleomycin resistance protein; arm-exchange, antibi | 7e-05 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 8e-05 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 8e-05 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 1e-04 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 2e-04 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 2e-04 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 7e-04 |
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 | Back alignment and structure |
|---|
Score = 111 bits (279), Expect = 5e-32
Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 5/123 (4%)
Query: 75 SVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDP 134
+HHV I N + + FY LG E+ + L +G++ + +
Sbjct: 5 EIHHVAINASNYQATKNFYVEKLGFEVLRENHRPEKNDIKLDLKLGSQELEIFISDQFPA 64
Query: 135 LSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSK----SGRPAIFTRDPDANALE 190
PE G RH + + ++ L++ GI + +G+ F DPD LE
Sbjct: 65 RPSYPEALGL-RHLAFKVEHIEEVIAFLNEQGIETEPLRVDDFTGKKMTFFFDPDGLPLE 123
Query: 191 FTQ 193
+
Sbjct: 124 LHE 126
|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Length = 252 | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 | Back alignment and structure |
|---|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} Length = 134 | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 | Back alignment and structure |
|---|
| >3eck_A Protein (homoprotocatechuate 2,3-dioxygenase); oxidoreductase, extradiol, FEII, crystal packing; HET: XXG; 1.60A {Brevibacterium fuscum} SCOP: d.32.1.3 d.32.1.3 PDB: 3ecj_A* 3ojn_A* 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* Length = 365 | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Length = 309 | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Length = 309 | Back alignment and structure |
|---|
| >1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Length = 124 | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Length = 310 | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Length = 305 | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 | Back alignment and structure |
|---|
| >1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Length = 122 | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 | Back alignment and structure |
|---|
| >1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Length = 126 | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Length = 302 | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Length = 292 | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Length = 297 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 99.91 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 99.88 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 99.88 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 99.88 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 99.87 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 99.86 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 99.86 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 99.86 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 99.86 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.86 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 99.86 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 99.85 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.85 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 99.85 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 99.85 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 99.85 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 99.84 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 99.84 | |
| 3vw9_A | 187 | Lactoylglutathione lyase; glyoxalase, lyase-lyase | 99.83 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 99.83 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 99.83 | |
| 4hc5_A | 133 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.82 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 99.82 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 99.82 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 99.82 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 99.82 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 99.82 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 99.82 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 99.81 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 99.8 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 99.8 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 99.8 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 99.79 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 99.79 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.79 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 99.79 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 99.79 | |
| 4gym_A | 149 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.79 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 99.78 | |
| 1xrk_A | 124 | Bleomycin resistance protein; arm exchange, ligand | 99.78 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 99.78 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 99.77 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 99.77 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 99.77 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.77 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 99.77 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 99.76 | |
| 1ecs_A | 126 | Bleomycin resistance protein; arm-exchange, antibi | 99.75 | |
| 1qto_A | 122 | Bleomycin-binding protein; arm-exchange, antibioti | 99.74 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 99.74 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.74 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 99.73 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 99.71 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 99.69 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 99.69 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 99.68 | |
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 99.68 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 99.67 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 99.67 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 99.67 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 99.67 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.66 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.66 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.66 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.65 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.65 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.64 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 99.64 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.64 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.64 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.63 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.63 | |
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 99.63 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.62 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 99.62 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.62 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 99.61 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.6 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.6 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.59 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.59 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.59 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.59 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.58 | |
| 1xy7_A | 166 | Unknown protein; structural genomics, protein stru | 99.56 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.54 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.52 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 99.51 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.49 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.49 | |
| 1u6l_A | 149 | Hypothetical protein; structural genomics, PSI, pr | 99.44 | |
| 1u7i_A | 136 | Hypothetical protein; structural genomics, PA1358, | 99.41 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.39 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.38 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.35 | |
| 1tsj_A | 139 | Conserved hypothetical protein; structural genomic | 99.34 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.34 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 99.33 | |
| 3l20_A | 172 | Putative uncharacterized protein; hypothetical pro | 99.29 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.25 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.23 | |
| 3oms_A | 138 | PHNB protein; structural genomics, PSI-2, protein | 99.17 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 99.12 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 99.09 | |
| 1u69_A | 163 | Hypothetical protein; structural genomics, MSCG, p | 98.4 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 98.09 | |
| 3opy_B | 941 | 6-phosphofructo-1-kinase beta-subunit; ATP binding | 97.98 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 96.98 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 96.34 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 93.61 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 92.25 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 91.97 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 91.43 | |
| 3opy_A | 989 | 6-phosphofructo-1-kinase alpha-subunit; ATP bindin | 91.07 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 91.05 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 90.99 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 90.71 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 90.51 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 90.38 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 89.99 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 89.7 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 89.17 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 88.42 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 87.87 | |
| 3vw9_A | 187 | Lactoylglutathione lyase; glyoxalase, lyase-lyase | 87.86 | |
| 4hc5_A | 133 | Glyoxalase/bleomycin resistance protein/dioxygena; | 87.4 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 86.12 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 85.97 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 85.7 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 85.6 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 85.46 | |
| 1k4n_A | 192 | Protein EC4020, protein YECM; structural genomics, | 84.84 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 84.44 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 84.21 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 84.19 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 83.87 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 82.17 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 82.11 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 81.38 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 81.18 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 80.65 |
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
Probab=99.91 E-value=3e-23 Score=149.34 Aligned_cols=123 Identities=25% Similarity=0.329 Sum_probs=98.6
Q ss_pred ceeceeeEEEEEcCCHHHHHHHHHhccCCEEeeecCCCCCCceeEEEEeCCeEEEEEe-------cCCCCCCCCCCCCCC
Q 029285 71 YGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLME-------LPNPDPLSGRPEHGG 143 (196)
Q Consensus 71 ~~i~~l~hv~l~v~Dl~~a~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g~~~l~l~~-------~~~~~~~~~~p~~~~ 143 (196)
|++++++||+|.|+|++++++||+++|||++..+.+........+++..++..++|+. .+........+..+.
T Consensus 1 M~i~~i~hv~l~v~D~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~~~~~~ 80 (134)
T 3l7t_A 1 MKLKAVHHVALIVSDYDKSYEFYVNQLGFEVIRENHRPKRHDYKLDLKCGDIELEIFGNKLTDSNYCAPPERISWPREAC 80 (134)
T ss_dssp -CCCEEEEEEEECSCHHHHHHHHHHTSCCEEEEEEEETTTTEEEEEEEETTEEEEEEECCTTSTTCCCCCCCCCSSSCCS
T ss_pred CceeeEeEEEEEeCCHHHHHHHHHHhcCCEEEEEeecCCCcceEEEEecCCeEEEEEecccccccccCCccccCCCCCCC
Confidence 4578999999999999999999999999999876554444445678888999999998 333222222333556
Q ss_pred CceEEEEEECCHHHHHHHHHHCCCeEEee----CCCceEEEEEcCCCCeEEEEe
Q 029285 144 RDRHTCIAIRDVSKLKMILDKAGISYTLS----KSGRPAIFTRDPDANALEFTQ 193 (196)
Q Consensus 144 ~~~hi~f~v~dl~~~~~~l~~~G~~~~~~----~~g~~~~~~~DPdG~~iEl~e 193 (196)
+..|++|.|+|+++++++|+++|+++... ..|.+.++++|||||.|||+|
T Consensus 81 g~~~~~~~v~d~~~~~~~l~~~G~~~~~~~~~~~~g~~~~~~~DPdG~~iel~e 134 (134)
T 3l7t_A 81 GLRHLAFYVEDVEASRQELIALGIRVEEVRYDDYTGKKMAFFFDPDGLPLELHE 134 (134)
T ss_dssp EEEEEEEECSCHHHHHHHHHHHTCCCCCCEECTTSCCEEEEEECTTCCEEEEEC
T ss_pred CeEEEEEEECCHHHHHHHHHhCCCcccceeccCCCceEEEEEECCCCCEEEEeC
Confidence 78899999999999999999999988543 346789999999999999986
|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
| >3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} | Back alignment and structure |
|---|
| >4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} | Back alignment and structure |
|---|
| >1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A | Back alignment and structure |
|---|
| >1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* | Back alignment and structure |
|---|
| >3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* | Back alignment and structure |
|---|
| >4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} | Back alignment and structure |
|---|
| >1k4n_A Protein EC4020, protein YECM; structural genomics, A NEW fold of protein, PSI, protein structure initiative; 1.60A {Escherichia coli} SCOP: d.32.1.5 | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 196 | ||||
| d1zswa1 | 144 | d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B | 2e-15 | |
| d2c21a1 | 139 | d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion | 2e-14 | |
| d1f9za_ | 135 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 9e-13 | |
| d1r9ca_ | 130 | d.32.1.2 (A:) Fosfomycin resistance protein FosX { | 1e-12 | |
| d1nkia_ | 134 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 1e-11 | |
| d1qipa_ | 176 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 3e-11 | |
| d1npba_ | 140 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 7e-11 | |
| d1zswa2 | 170 | d.32.1.10 (A:145-314) Hypothetical protein BC1024 | 2e-10 | |
| d1mpya2 | 162 | d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met | 2e-10 | |
| d1f1ua2 | 176 | d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxy | 4e-10 | |
| d1xrka_ | 120 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {S | 1e-09 | |
| d1xqaa_ | 113 | d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillu | 1e-08 | |
| d1jc4a_ | 145 | d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion | 2e-08 | |
| d2i7ra1 | 115 | d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str | 2e-08 | |
| d1mpya1 | 145 | d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metap | 4e-08 | |
| d1ss4a_ | 149 | d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillu | 4e-08 | |
| d1twua_ | 137 | d.32.1.8 (A:) Hypothetical protein YycE {Bacillus | 7e-08 | |
| d1klla_ | 128 | d.32.1.2 (A:) Mitomycin resistance protein D, MRD | 1e-07 | |
| d1lgta1 | 131 | d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygena | 1e-07 | |
| d1sqia1 | 149 | d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxyge | 2e-07 | |
| d1f1ua1 | 146 | d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxyge | 4e-07 | |
| d1sp8a2 | 224 | d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxy | 9e-07 | |
| d1t47a1 | 163 | d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg | 2e-06 | |
| d1kw3b2 | 156 | d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxyge | 3e-06 | |
| d1kw3b1 | 132 | d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygena | 6e-06 | |
| d2pjsa1 | 111 | d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 | 2e-05 | |
| d1sp8a1 | 172 | d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg | 2e-05 | |
| d1jifa_ | 122 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {S | 3e-05 | |
| d1ecsa_ | 120 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {K | 6e-05 | |
| d1sqda1 | 167 | d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg | 4e-04 | |
| d1sqda2 | 230 | d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxy | 0.002 |
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: BC1024-like domain: Hypothetical protein BC1024 species: Bacillus cereus [TaxId: 1396]
Score = 67.7 bits (164), Expect = 2e-15
Identities = 23/133 (17%), Positives = 46/133 (34%), Gaps = 7/133 (5%)
Query: 71 YGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWV---GAEMIHLM 127
Y + HH+ ++ +N + FY+N+LGL + + P + G+ L
Sbjct: 2 YEIKGHHHISMVTKNANENNHFYKNVLGLRRVKMTVNQDDPSMYHLFYGDKTGSPGTELS 61
Query: 128 ELPNPDPLSGRPEHGGRDR--HTCIAIRDVSKLKMILDKAGISYT--LSKSGRPAIFTRD 183
P R + + K +K + ++ + + RPA+ D
Sbjct: 62 FFEIPLVGRTYRGTNAITRIGLLVPSEDSLHYWKERFEKFDVKHSEMTTYANRPALQFED 121
Query: 184 PDANALEFTQVDG 196
+ L +G
Sbjct: 122 AEGLRLVLLVSNG 134
|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 | Back information, alignment and structure |
|---|
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 170 | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 176 | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Length = 113 | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 | Back information, alignment and structure |
|---|
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 145 | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Length = 149 | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Length = 128 | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Length = 131 | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 146 | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 224 | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 156 | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 132 | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 | Back information, alignment and structure |
|---|
| >d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Length = 122 | Back information, alignment and structure |
|---|
| >d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Length = 120 | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 230 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| d1ss4a_ | 149 | Hypothetical protein BC1747 {Bacillus cereus (stra | 99.85 | |
| d1r9ca_ | 130 | Fosfomycin resistance protein FosX {Mesorhizobium | 99.85 | |
| d2i7ra1 | 115 | Hypotheical protein SP0731 {Streptococcus pneumoni | 99.85 | |
| d1f9za_ | 135 | Glyoxalase I (lactoylglutathione lyase) {Escherich | 99.84 | |
| d1zswa1 | 144 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.84 | |
| d1npba_ | 140 | Fosfomycin resistance protein A (FosA) {Serratia m | 99.84 | |
| d1nkia_ | 134 | Fosfomycin resistance protein A (FosA) {Pseudomona | 99.83 | |
| d1mpya2 | 162 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.83 | |
| d1jc4a_ | 145 | Methylmalonyl-CoA epimerase {Propionibacterium she | 99.83 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 99.82 | |
| d2c21a1 | 139 | Glyoxalase I (lactoylglutathione lyase) {Leishmani | 99.82 | |
| d1qipa_ | 176 | Glyoxalase I (lactoylglutathione lyase) {Human (Ho | 99.82 | |
| d1lgta1 | 131 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.82 | |
| d1zswa2 | 170 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.81 | |
| d1kw3b1 | 132 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.79 | |
| d1twua_ | 137 | Hypothetical protein YycE {Bacillus subtilis [TaxI | 99.79 | |
| d1klla_ | 128 | Mitomycin resistance protein D, MRD {Streptomyces | 99.78 | |
| d1f1ua1 | 146 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.77 | |
| d2pjsa1 | 111 | Uncharacterized protein Atu1953 {Agrobacterium tum | 99.76 | |
| d1t47a1 | 163 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 99.76 | |
| d1f1ua2 | 176 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.74 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 99.74 | |
| d1mpya1 | 145 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.73 | |
| d1ecsa_ | 120 | Bleomycin resistance protein, BRP {Klebsiella pneu | 99.72 | |
| d1sqia1 | 149 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 99.71 | |
| d1kw3b2 | 156 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.71 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 99.7 | |
| d1jifa_ | 122 | Bleomycin resistance protein, BRP {Streptomyces ve | 99.7 | |
| d1xy7a_ | 135 | Hypothetical protein At5g48480 {Thale cress (Arabi | 99.63 | |
| d1xrka_ | 120 | Bleomycin resistance protein, BRP {Streptoalloteic | 99.63 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.52 | |
| d1sp8a2 | 224 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 99.28 | |
| d1u6la_ | 137 | Hypothetical protein PA1353 {Pseudomonas aeruginos | 99.19 | |
| d1cjxa2 | 203 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.15 | |
| d1t47a2 | 199 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 99.11 | |
| d1sqia2 | 210 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 99.07 | |
| d1sqda2 | 230 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 98.98 | |
| d1u7ia_ | 134 | Hypothetical protein PA1358 {Pseudomonas aeruginos | 98.93 | |
| d1tsja_ | 129 | Hypothetical protein MW1090 {Staphylococcus aureus | 98.46 | |
| d1u69a_ | 156 | Hypothetical protein PA2721 {Pseudomonas aeruginos | 97.42 | |
| d1ss4a_ | 149 | Hypothetical protein BC1747 {Bacillus cereus (stra | 94.41 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 94.33 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 94.08 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 93.34 | |
| d1jc4a_ | 145 | Methylmalonyl-CoA epimerase {Propionibacterium she | 91.13 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 89.76 | |
| d1k4na_ | 190 | Hypothetical protein YecM (EC4020) {Escherichia co | 89.01 | |
| d1qipa_ | 176 | Glyoxalase I (lactoylglutathione lyase) {Human (Ho | 84.62 | |
| d1klla_ | 128 | Mitomycin resistance protein D, MRD {Streptomyces | 83.83 | |
| d1lgta1 | 131 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 83.14 | |
| d1sqia1 | 149 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 83.03 | |
| d1t47a1 | 163 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 82.57 | |
| d1zswa2 | 170 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 81.55 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 81.27 | |
| d1zswa1 | 144 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 81.22 |
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: Hypothetical protein BC1747 domain: Hypothetical protein BC1747 species: Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]
Probab=99.85 E-value=1.1e-20 Score=137.97 Aligned_cols=123 Identities=14% Similarity=0.227 Sum_probs=92.3
Q ss_pred eeceeeEEEEEcCCHHHHHHHHHhccCCEEeeecCCC-----------CCCceeEEEEeC--CeEEEEEecCCCCCC---
Q 029285 72 GVVSVHHVGILCENLERSLEFYQNILGLEINEARPHD-----------KLPYRGAWLWVG--AEMIHLMELPNPDPL--- 135 (196)
Q Consensus 72 ~i~~l~hv~l~v~Dl~~a~~FY~~vLG~~~~~~~~~~-----------~~~~~~~~l~~g--~~~l~l~~~~~~~~~--- 135 (196)
++++++||+|.|+|+++|++||++ |||++..+.+.. ......+++... ...++|++.......
T Consensus 6 ~~~ri~Hv~i~v~Dle~s~~FY~~-LG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~ 84 (149)
T d1ss4a_ 6 KLLRMDNVSIVVESLDNAISFFEE-IGLNLEGRANVEGEWAGRVTGLGSQCVEIAMMVTPDGHSRIELSRFLTPPTIADH 84 (149)
T ss_dssp CEEEEEEEEEECSCHHHHHHHHHH-HTCEEEEEEEECSHHHHHHHSCCSCEEEEEEEECTTSSCEEEEEEEEESCCCCBC
T ss_pred CCCEEeEEEEEeCCHHHHHHHHHH-cCCcEeeeeccceeeeeeeeccCCCceeEEEEeecccceEEEEEeeccccCcccc
Confidence 478999999999999999999999 999988754321 222345566654 347777654332221
Q ss_pred CCCCCCCCCceEEEEEECCHHHHHHHHHHCCCeEEeeC----CCceEEEEEcCCCCeEEEEeec
Q 029285 136 SGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSK----SGRPAIFTRDPDANALEFTQVD 195 (196)
Q Consensus 136 ~~~p~~~~~~~hi~f~v~dl~~~~~~l~~~G~~~~~~~----~g~~~~~~~DPdG~~iEl~e~~ 195 (196)
...+....+..|++|.|+|+++++++|+++|+++..++ .+.+.+|++||||+.|||+|.-
T Consensus 85 ~~~~~~~~g~~hi~~~v~d~~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~~DPdG~~iEl~e~~ 148 (149)
T d1ss4a_ 85 RTAPVNALGYLRVMFTVEDIDEMVSRLTKHGAELVGEVVQYENSYRLCYIRGVEGILIGLAEEL 148 (149)
T ss_dssp TTCCSSSBEEEEEEEEESCHHHHHHHHHHTTCEESSCCEEETTTEEEEEEECGGGCEEEEEEEC
T ss_pred cccCCCCcceeEEEEeechhHHHHHHHHHCCCeEccCCeECCCCeEEEEEECCCCCEEEEEEcc
Confidence 12233455788999999999999999999999885443 5568899999999999999863
|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} | Back information, alignment and structure |
|---|
| >d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} | Back information, alignment and structure |
|---|
| >d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|