Citrus Sinensis ID: 029385


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCNFHQQQIQQEPQINPQSCLSDSIHAKEDFLHFAS
ccccccccccccEEcEEEEEcccHHHHHHHHHHHccccccccccccccccEEEEEccEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEccccccccEEEEEEEcccccEEEEEcccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccc
ccccccccccHHcHcHHEEEHHcHHHHHHHHHHHccccccccccccccccEEEEEcccEEEEEEcccccccccccccccccccEEEEEEccHHHHHHHHHHccccEEEEEcccccccEEEEEEEcccccEEEEEccccccEEEccccccccccccccccHHHccccccccccccccccccccEEccHHHHHccc
mkesvenplclkslnHISLVCRSVEASLDFYQNVLgffpirrpgsfdfdgawlFNYGMgihllkseepdnlpkagkninpkdnhisfqcENMAIVERRLKEMKIDYVKSRveegginvdqlffhdpdgsmieicncdvlpvvplagdavrirsctstvncnfhqqqiqqepqinpqsclsdsihakedflhfas
MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEEPDNLPKAGKninpkdnhisfQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCNFHQQQIQQEPQINPQSCLSDSIHAKEDFLHFAS
MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCNFHqqqiqqepqinpqSCLSDSIHAKEDFLHFAS
********LCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLK*******************HISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCNFHQQ*****************************
***********KSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEEPDN**KA**NINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAV***********************************A*E*FLHFA*
********LCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCNFHQQQIQQEPQINPQSCLSDSIHAKEDFLHFAS
*******PLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCN**********************H*K*DFLHFAS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCNFHQQQIQQEPQINPQSCLSDSIHAKEDFLHFAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
Q28CR0160 Glyoxalase domain-contain yes no 0.592 0.718 0.253 1e-05
O31817144 Metallothiol transferase yes no 0.577 0.777 0.284 2e-05
Q65KJ5154 Metallothiol transferase yes no 0.618 0.779 0.269 0.0001
Q502D1163 Glyoxalase domain-contain yes no 0.592 0.705 0.246 0.0002
Q8CXK5139 Metallothiol transferase yes no 0.577 0.805 0.253 0.0004
A4IS40140 Metallothiol transferase no no 0.577 0.8 0.269 0.0008
>sp|Q28CR0|GLOD5_XENTR Glyoxalase domain-containing protein 5 OS=Xenopus tropicalis GN=glod5 PE=2 SV=1 Back     alignment and function desciption
 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 23/138 (16%)

Query: 8   PLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEE 67
           P C++ L+H+ L  RS++ +++FY  VLG       G     G    ++GM        +
Sbjct: 28  PFCIQRLDHLVLTVRSLDRTINFYTKVLGMEATTFKG-----GRKALSFGM--------Q 74

Query: 68  PDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKS---RVEEGGIN------- 117
             NL +AGK   PK +  S    ++ ++        + ++K+    VEEG ++       
Sbjct: 75  KINLHEAGKEFEPKASVPSPGSADLCLITETPLSTVVQHLKACGVPVEEGPVSRTGAVGE 134

Query: 118 VDQLFFHDPDGSMIEICN 135
           +  ++  DPD ++IE+ N
Sbjct: 135 IISVYMRDPDQNLIEVSN 152





Xenopus tropicalis (taxid: 8364)
>sp|O31817|FOSB_BACSU Metallothiol transferase FosB OS=Bacillus subtilis (strain 168) GN=fosB PE=1 SV=1 Back     alignment and function description
>sp|Q65KJ5|FOSB_BACLD Metallothiol transferase FosB OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=fosB PE=3 SV=1 Back     alignment and function description
>sp|Q502D1|GLOD5_DANRE Glyoxalase domain-containing protein 5 OS=Danio rerio GN=glod5 PE=2 SV=1 Back     alignment and function description
>sp|Q8CXK5|FOSB_OCEIH Metallothiol transferase FosB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=fosB PE=3 SV=2 Back     alignment and function description
>sp|A4IS40|FOSB_GEOTN Metallothiol transferase FosB OS=Geobacillus thermodenitrificans (strain NG80-2) GN=fosB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
225445448195 PREDICTED: metallothiol transferase fosB 0.824 0.820 0.770 1e-66
255566967193 lactoylglutathione lyase, putative [Rici 0.824 0.829 0.746 2e-65
255636198172 unknown [Glycine max] 0.845 0.953 0.726 2e-64
194466169181 lactoylglutathione lyase [Arachis hypoga 0.922 0.988 0.666 5e-64
255553127172 lactoylglutathione lyase, putative [Rici 0.865 0.976 0.706 8e-64
351723359172 uncharacterized protein LOC100306100 [Gl 0.783 0.883 0.741 4e-63
449436156169 PREDICTED: uncharacterized protein LOC10 0.783 0.899 0.748 2e-62
388506784172 unknown [Lotus japonicus] gi|388522799|g 0.783 0.883 0.735 7e-62
317106739172 JHL06P13.16 [Jatropha curcas] 0.783 0.883 0.729 2e-61
351721390173 uncharacterized protein LOC100305695 [Gl 0.840 0.942 0.690 4e-61
>gi|225445448|ref|XP_002285087.1| PREDICTED: metallothiol transferase fosB [Vitis vinifera] gi|147821406|emb|CAN63501.1| hypothetical protein VITISV_011676 [Vitis vinifera] gi|297738928|emb|CBI28173.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 138/161 (85%), Gaps = 1/161 (0%)

Query: 1   MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGI 60
           M+   ENPL LKS+NHISLVCRSVE SLDFYQ VLGFF IRRPGSFDFDGAWL+NYGMGI
Sbjct: 1   MEGRAENPLRLKSVNHISLVCRSVEKSLDFYQKVLGFFSIRRPGSFDFDGAWLYNYGMGI 60

Query: 61  HLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQ 120
           HLL+SE+PDN+PK  + INPKDNHISFQCE+MA VE++LKEMKI+YV+SRVEEGGI VDQ
Sbjct: 61  HLLQSEDPDNMPKISQQINPKDNHISFQCESMATVEKKLKEMKIEYVQSRVEEGGICVDQ 120

Query: 121 LFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCN 161
           LFFHDPDGSMIEICNCD LPV+PL G       C S +NCN
Sbjct: 121 LFFHDPDGSMIEICNCDNLPVIPLGGGGGDTTLC-SRINCN 160




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255566967|ref|XP_002524466.1| lactoylglutathione lyase, putative [Ricinus communis] gi|223536254|gb|EEF37906.1| lactoylglutathione lyase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255636198|gb|ACU18440.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|194466169|gb|ACF74315.1| lactoylglutathione lyase [Arachis hypogaea] Back     alignment and taxonomy information
>gi|255553127|ref|XP_002517606.1| lactoylglutathione lyase, putative [Ricinus communis] gi|223543238|gb|EEF44770.1| lactoylglutathione lyase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351723359|ref|NP_001237532.1| uncharacterized protein LOC100306100 [Glycine max] gi|255627549|gb|ACU14119.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449436156|ref|XP_004135860.1| PREDICTED: uncharacterized protein LOC101209593 [Cucumis sativus] gi|449491017|ref|XP_004158775.1| PREDICTED: uncharacterized LOC101209593 [Cucumis sativus] Back     alignment and taxonomy information
>gi|388506784|gb|AFK41458.1| unknown [Lotus japonicus] gi|388522799|gb|AFK49461.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|317106739|dbj|BAJ53235.1| JHL06P13.16 [Jatropha curcas] Back     alignment and taxonomy information
>gi|351721390|ref|NP_001235416.1| uncharacterized protein LOC100305695 [Glycine max] gi|255626337|gb|ACU13513.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
TAIR|locus:2016254167 GLYI7 "AT1G80160" [Arabidopsis 0.783 0.910 0.709 7.5e-57
TAIR|locus:2037728174 GLYI4 "AT1G15380" [Arabidopsis 0.783 0.873 0.677 1.6e-54
TAIR|locus:2057522184 GLYI8 "AT2G28420" [Arabidopsis 0.726 0.766 0.559 2.5e-42
TAIR|locus:2164600197 AT5G57040 "AT5G57040" [Arabido 0.577 0.568 0.303 2.9e-09
TAIR|locus:2045482135 AT2G32090 "AT2G32090" [Arabido 0.634 0.911 0.296 4.7e-09
TIGR_CMR|CPS_2825128 CPS_2825 "glyoxylase family pr 0.623 0.945 0.296 6.8e-08
TIGR_CMR|BA_0607128 BA_0607 "glyoxylase family pro 0.608 0.921 0.242 1.9e-05
UNIPROTKB|Q4KB97136 PFL_3381 "Uncharacterized prot 0.551 0.786 0.280 3.3e-05
UNIPROTKB|Q8EFL3153 SO_1958 "Glyoxylase-like domai 0.603 0.764 0.28 0.0002
TIGR_CMR|SO_1958153 SO_1958 "conserved hypothetica 0.603 0.764 0.28 0.0002
TAIR|locus:2016254 GLYI7 "AT1G80160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 585 (211.0 bits), Expect = 7.5e-57, P = 7.5e-57
 Identities = 110/155 (70%), Positives = 129/155 (83%)

Query:     1 MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGI 60
             MK+   NPL +KSLNHISL+CRSVE S+ FYQNVLGF PIRRP SFDFDGAWLF +G+GI
Sbjct:     1 MKDETGNPLHIKSLNHISLLCRSVEESISFYQNVLGFLPIRRPDSFDFDGAWLFGHGIGI 60

Query:    61 HLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQ 120
             HLL+S EP+ L K  + INPKDNHISFQCE+M  VE++LKEM+I+YV++ VEEGGI VDQ
Sbjct:    61 HLLQSPEPEKLLKKTE-INPKDNHISFQCESMEAVEKKLKEMEIEYVRAVVEEGGIQVDQ 119

Query:   121 LFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCT 155
             LFFHDPD  MIEICNCD LPV+PLAG+  R  SC+
Sbjct:   120 LFFHDPDAFMIEICNCDSLPVIPLAGEMAR--SCS 152




GO:0004462 "lactoylglutathione lyase activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=ISS
GO:0009414 "response to water deprivation" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0046482 "para-aminobenzoic acid metabolic process" evidence=RCA
TAIR|locus:2037728 GLYI4 "AT1G15380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057522 GLYI8 "AT2G28420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164600 AT5G57040 "AT5G57040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045482 AT2G32090 "AT2G32090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2825 CPS_2825 "glyoxylase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0607 BA_0607 "glyoxylase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KB97 PFL_3381 "Uncharacterized protein" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EFL3 SO_1958 "Glyoxylase-like domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1958 SO_1958 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
cd07245114 cd07245, Glo_EDI_BRP_like_9, This conserved domain 2e-38
cd06587110 cd06587, Glo_EDI_BRP_like, This domain superfamily 2e-17
COG0346138 COG0346, GloA, Lactoylglutathione lyase and relate 1e-14
pfam12681109 pfam12681, Glyoxalase_2, Glyoxalase-like domain 6e-13
pfam00903120 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist 1e-12
cd08346126 cd08346, PcpA_N_like, N-terminal domain of Sphingo 4e-11
cd07253125 cd07253, Glo_EDI_BRP_like_2, This conserved domain 5e-09
cd08363131 cd08363, FosB, FosB, a fosfomycin resistance prote 2e-08
cd07242128 cd07242, Glo_EDI_BRP_like_6, This conserved domain 2e-08
cd08348134 cd08348, BphC2-C3-RGP6_C_like, The single-domain 2 3e-08
PRK04101139 PRK04101, PRK04101, fosfomycin resistance protein 3e-07
cd07244121 cd07244, FosA, FosA, a Fosfomycin resistance prote 3e-07
cd08352125 cd08352, Glo_EDI_BRP_like_1, This conserved domain 7e-07
cd08354122 cd08354, Glo_EDI_BRP_like_13, This conserved domai 9e-07
cd08345113 cd08345, Fosfomycin_RP, Fosfomycin resistant prote 1e-06
cd07249128 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) 1e-06
cd07233121 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the 3e-06
cd08349112 cd08349, BLMA_like, Bleomycin binding protein (BLM 1e-05
pfam13669110 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resi 2e-05
cd09013121 cd09013, BphC-JF8_N_like, N-terminal, non-catalyti 1e-04
cd07255125 cd07255, Glo_EDI_BRP_like_12, This conserved domai 3e-04
cd09011120 cd09011, Glo_EDI_BRP_like_23, This conserved domai 0.001
cd07262123 cd07262, Glo_EDI_BRP_like_19, This conserved domai 0.001
PLN03042185 PLN03042, PLN03042, Lactoylglutathione lyase; Prov 0.001
>gnl|CDD|176669 cd07245, Glo_EDI_BRP_like_9, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
 Score =  127 bits (322), Expect = 2e-38
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 8/121 (6%)

Query: 14  LNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMG-IHLLKSEEPDNLP 72
           L+H++L    +EAS  FY +VLG     RP  F F GAWL+      +HL++ + PD LP
Sbjct: 1   LDHVALRVPDLEASRAFYTDVLGLEEGPRP-PFLFPGAWLYAGDGPQLHLIEEDPPDALP 59

Query: 73  KAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIE 132
                   +D+HI+F+ +++     RLK   + Y +S V   G  V QLF  DPDG+ IE
Sbjct: 60  ----EGPGRDDHIAFRVDDLDAFRARLKAAGVPYTESDVPGDG--VRQLFVRDPDGNRIE 113

Query: 133 I 133
           +
Sbjct: 114 L 114


This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases. Length = 114

>gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain Back     alignment and domain information
>gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|211356 cd08346, PcpA_N_like, N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>gnl|CDD|176676 cd07253, Glo_EDI_BRP_like_2, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176711 cd08363, FosB, FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>gnl|CDD|176666 cd07242, Glo_EDI_BRP_like_6, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176696 cd08348, BphC2-C3-RGP6_C_like, The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>gnl|CDD|179740 PRK04101, PRK04101, fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>gnl|CDD|176668 cd07244, FosA, FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>gnl|CDD|211358 cd08352, Glo_EDI_BRP_like_1, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176702 cd08354, Glo_EDI_BRP_like_13, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176693 cd08345, Fosfomycin_RP, Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>gnl|CDD|211357 cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>gnl|CDD|222305 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|176715 cd09013, BphC-JF8_N_like, N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>gnl|CDD|211352 cd07255, Glo_EDI_BRP_like_12, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176713 cd09011, Glo_EDI_BRP_like_23, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176683 cd07262, Glo_EDI_BRP_like_19, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
PRK11478129 putative lyase; Provisional 99.86
COG2514265 Predicted ring-cleavage extradiol dioxygenase [Gen 99.85
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 99.83
cd07243143 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg 99.82
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 99.81
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 99.81
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 99.8
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 99.8
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 99.8
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 99.8
PLN03042185 Lactoylglutathione lyase; Provisional 99.8
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 99.79
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 99.79
PRK04101139 fosfomycin resistance protein FosB; Provisional 99.79
PLN02367233 lactoylglutathione lyase 99.79
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 99.79
cd09013121 BphC-JF8_N_like N-terminal, non-catalytic, domain 99.79
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 99.79
cd09011120 Glo_EDI_BRP_like_23 This conserved domain belongs 99.78
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 99.78
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 99.77
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 99.77
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 99.77
cd08362120 BphC5-RrK37_N_like N-terminal, non-catalytic, doma 99.77
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 99.77
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 99.76
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 99.76
cd07247114 SgaA_N_like N-terminal domain of Streptomyces gris 99.76
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 99.76
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 99.76
cd07266121 HPCD_N_class_II N-terminal domain of 3,4-dihydroxy 99.75
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 99.75
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 99.75
PLN02300286 lactoylglutathione lyase 99.75
cd09014166 BphC-JF8_C_like C-terminal, catalytic, domain of B 99.75
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 99.74
cd08351123 ChaP_like ChaP, an enzyme involved in the biosynth 99.74
cd08345113 Fosfomycin_RP Fosfomycin resistant protein; inhibi 99.74
PRK06724128 hypothetical protein; Provisional 99.74
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 99.73
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 99.73
cd07239144 BphC5-RK37_C_like C-terminal, catalytic, domain of 99.73
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 99.73
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 99.73
cd07244121 FosA FosA, a Fosfomycin resistance protein, cataly 99.72
cd07264125 Glo_EDI_BRP_like_15 This conserved domain belongs 99.72
cd07256161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 99.72
PRK10291129 glyoxalase I; Provisional 99.72
cd08357125 Glo_EDI_BRP_like_18 This conserved domain belongs 99.72
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 99.72
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 99.72
cd07258141 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma 99.72
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 99.7
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 99.7
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 99.7
cd08354122 Glo_EDI_BRP_like_13 This conserved domain belongs 99.69
cd08355122 Glo_EDI_BRP_like_14 This conserved domain belongs 99.69
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 99.69
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 99.68
TIGR03211303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.68
cd07261114 Glo_EDI_BRP_like_11 This conserved domain belongs 99.68
cd07254120 Glo_EDI_BRP_like_20 This conserved domain belongs 99.68
cd08343131 ED_TypeI_classII_C C-terminal domain of type I, cl 99.68
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 99.68
cd08349112 BLMA_like Bleomycin binding protein (BLMA) and sim 99.68
cd07246122 Glo_EDI_BRP_like_8 This conserved domain belongs t 99.67
cd08350120 BLMT_like BLMT, a bleomycin resistance protein enc 99.66
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 99.65
cd08356113 Glo_EDI_BRP_like_17 This conserved domain belongs 99.65
TIGR03211 303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.65
TIGR02295294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.64
cd07251121 Glo_EDI_BRP_like_10 This conserved domain belongs 99.63
TIGR03213 286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.63
TIGR03213286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.62
TIGR02295 294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.62
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 99.62
PLN02300286 lactoylglutathione lyase 99.49
KOG2944170 consensus Glyoxalase [Carbohydrate transport and m 99.49
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 99.43
COG3324127 Predicted enzyme related to lactoylglutathione lya 99.38
COG3565138 Predicted dioxygenase of extradiol dioxygenase fam 99.33
COG3607133 Predicted lactoylglutathione lyase [General functi 99.26
COG0346138 GloA Lactoylglutathione lyase and related lyases [ 99.18
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 99.17
TIGR01263353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.12
TIGR01263 353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.05
cd06588128 PhnB_like Escherichia coli PhnB and similar protei 99.01
PRK01037357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknow 98.88
PLN02875398 4-hydroxyphenylpyruvate dioxygenase 98.74
KOG2943299 consensus Predicted glyoxalase [Carbohydrate trans 98.72
COG2514265 Predicted ring-cleavage extradiol dioxygenase [Gen 98.65
COG2764136 PhnB Uncharacterized protein conserved in bacteria 98.64
KOG2943299 consensus Predicted glyoxalase [Carbohydrate trans 98.58
PF14506125 CppA_N: CppA N-terminal; PDB: 3E0R_D. 98.45
PF14696139 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H 98.44
KOG0638 381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 98.36
PF13468175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 98.29
PLN02875 398 4-hydroxyphenylpyruvate dioxygenase 98.17
PRK10148147 hypothetical protein; Provisional 98.08
COG3185363 4-hydroxyphenylpyruvate dioxygenase and related he 97.96
COG3185 363 4-hydroxyphenylpyruvate dioxygenase and related he 97.35
KOG0638381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 96.97
PF15067236 FAM124: FAM124 family 96.45
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 95.63
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 95.62
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 95.1
PF06983116 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans 94.95
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 94.73
PF14507101 CppA_C: CppA C-terminal; PDB: 3E0R_D. 94.58
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 94.24
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 93.05
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 92.61
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 92.09
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 91.64
PF13468175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 91.6
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 91.16
PRK11478129 putative lyase; Provisional 90.34
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 90.02
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 89.96
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 89.84
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 88.14
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 88.12
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 88.0
PF1367083 PepSY_2: Peptidase propeptide and YPEB domain This 87.69
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 87.21
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 86.68
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 86.24
PLN03042185 Lactoylglutathione lyase; Provisional 85.59
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 84.95
PRK11700187 hypothetical protein; Provisional 84.74
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 84.37
cd07268149 Glo_EDI_BRP_like_4 This conserved domain belongs t 84.35
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 84.28
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 83.53
PLN02367233 lactoylglutathione lyase 83.21
PF06185185 YecM: YecM protein; InterPro: IPR010393 This famil 82.24
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 81.67
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 81.1
PRK04101139 fosfomycin resistance protein FosB; Provisional 80.49
>PRK11478 putative lyase; Provisional Back     alignment and domain information
Probab=99.86  E-value=3e-20  Score=135.33  Aligned_cols=125  Identities=23%  Similarity=0.335  Sum_probs=88.9

Q ss_pred             CcccceeeeEEEEcCCHHHHHHHHHHccCCeEeeeCCCC---CcceEEEEeCCcEEEEeecCCCCCCCCCCCCCCCCccE
Q 029385            8 PLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSF---DFDGAWLFNYGMGIHLLKSEEPDNLPKAGKNINPKDNH   84 (194)
Q Consensus         8 ~~~i~~i~hv~l~v~Dle~s~~FY~~vLG~~~~~~~~~~---~~~~~~~~~~g~~~~l~~~~~~~~~~~~~~~~~~g~~h   84 (194)
                      ++.+++++||+|.|+|++++.+||+++|||++..+....   .+...+....+..++++....+...+..  ....+..|
T Consensus         1 ~~~i~~i~hv~l~v~D~~~a~~FY~~~LG~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~--~~~~g~~h   78 (129)
T PRK11478          1 MLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEVYREARDSWKGDLALNGQYVIELFSFPFPPERPSR--PEACGLRH   78 (129)
T ss_pred             CCCcceecEEEEEcCCHHHHHHHHHHHhCCEecccccccccccceeeEecCCCcEEEEEEecCCCCCCCC--CCCCceeE
Confidence            367899999999999999999999999999986542110   1111122233456777665433222111  23356789


Q ss_pred             EEEeeCCHHHHHHHHHhCCCeEEccceecCccceEEEEEeCCCCCEEEEEe
Q 029385           85 ISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICN  135 (194)
Q Consensus        85 iaf~v~dl~~~~~~l~~~Gi~~~~~~~~~~g~~~~~~~~~DPDG~~iEi~~  135 (194)
                      ++|.|+|+++++++|++.|+++...... ...+.+.+||+||||+.|||++
T Consensus        79 i~f~v~d~~~~~~~l~~~G~~~~~~~~~-~~~g~~~~~~~DPdG~~iEl~~  128 (129)
T PRK11478         79 LAFSVDDIDAAVAHLESHNVKCEAIRVD-PYTQKRFTFFNDPDGLPLELYE  128 (129)
T ss_pred             EEEEeCCHHHHHHHHHHcCCeeeccccC-CCCCCEEEEEECCCCCEEEEEe
Confidence            9999999999999999999998643322 2223488999999999999986



>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins Back     alignment and domain information
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>PRK06724 hypothetical protein; Provisional Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] Back     alignment and domain information
>COG3607 Predicted lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D Back     alignment and domain information
>PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>PRK10148 hypothetical protein; Provisional Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF15067 FAM124: FAM124 family Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF13670 PepSY_2: Peptidase propeptide and YPEB domain This Prosite motif covers only the active site Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>PRK11700 hypothetical protein; Provisional Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>PF06185 YecM: YecM protein; InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1npb_A141 Fosfomycin-resistance protein; manganese binding, 1e-32
3ghj_A141 Putative integron gene cassette protein; integron 2e-31
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 2e-31
2p25_A126 Glyoxalase family protein; structural genomics, MC 3e-30
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 4e-28
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 1e-27
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 2e-27
1nki_A135 Probable fosfomycin resistance protein; potassium 2e-27
3huh_A152 Virulence protein STM3117; structural genomics, ny 3e-27
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 2e-26
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-25
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 3e-24
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 2e-22
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 8e-22
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 1e-21
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 2e-21
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 2e-19
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 4e-18
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 2e-17
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 5e-17
3oaj_A 335 Putative ring-cleaving dioxygenase MHQO; structura 9e-15
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 6e-09
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 2e-14
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 3e-14
3e5d_A127 Putative glyoxalase I; structural genomics, joint 1e-13
1zsw_A 338 Metallo protein, glyoxalase family protein; hypoth 1e-13
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 6e-09
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 2e-13
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 2e-13
2i7r_A118 Conserved domain protein; structural genomics cons 4e-13
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 2e-12
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 2e-12
1ss4_A153 Glyoxalase family protein; structural genomics, PS 2e-12
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 2e-12
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 1e-11
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 2e-11
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 6e-11
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 9e-11
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-10
3r6a_A144 Uncharacterized protein; PSI biology, structural g 1e-10
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 2e-10
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 7e-10
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 1e-09
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 4e-09
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 4e-09
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 7e-09
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 1e-08
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 3e-08
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 1e-07
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 2e-07
3lm4_A 339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 2e-07
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 2e-06
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 4e-07
3hpy_A 309 Catechol 2,3-dioxygenase; repeated motifs, aromati 1e-06
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 6e-07
2zyq_A 300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 2e-04
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 7e-07
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 2e-06
3b59_A 310 Glyoxalase/bleomycin resistance protein/dioxygena; 3e-06
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-05
3eck_A 365 Protein (homoprotocatechuate 2,3-dioxygenase); oxi 4e-06
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 5e-06
1mpy_A 307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 9e-05
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 5e-06
1f1u_A 323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 6e-06
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 1e-04
2wl9_A 305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 7e-06
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 1e-05
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 7e-06
1lgt_A 297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 1e-05
1kw3_B 292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 9e-06
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 4e-05
2ehz_A 302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 4e-05
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 5e-04
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 2e-04
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 Back     alignment and structure
 Score =  113 bits (284), Expect = 1e-32
 Identities = 29/123 (23%), Positives = 54/123 (43%), Gaps = 10/123 (8%)

Query: 11  LKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEEPDN 70
           L+SLNH++L    ++ S+ F+  +LG     R  +    GA+L    + + L   E    
Sbjct: 2   LQSLNHLTLAVSDLQKSVTFWHELLGLTLHARWNT----GAYLTCGDLWVCLSYDEARQY 57

Query: 71  LPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSM 130
           +P   +  +      +   E+   + +RL++  +   K    EG       +F DPDG  
Sbjct: 58  VP--PQESDYTHYAFTVAEEDFEPLSQRLEQAGVTIWKQNKSEG----ASFYFLDPDGHK 111

Query: 131 IEI 133
           +E+
Sbjct: 112 LEL 114


>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Length = 252 Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} Length = 134 Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Length = 124 Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Length = 309 Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Length = 309 Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Length = 122 Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Length = 310 Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Length = 310 Back     alignment and structure
>3eck_A Protein (homoprotocatechuate 2,3-dioxygenase); oxidoreductase, extradiol, FEII, crystal packing; HET: XXG; 1.60A {Brevibacterium fuscum} SCOP: d.32.1.3 d.32.1.3 PDB: 3ecj_A* 3ojn_A* 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* Length = 365 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Length = 126 Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Length = 305 Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Length = 305 Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Length = 297 Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Length = 297 Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Length = 292 Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Length = 292 Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Length = 302 Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Length = 302 Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 99.89
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 99.89
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 99.88
3huh_A152 Virulence protein STM3117; structural genomics, ny 99.86
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 99.85
2p25_A126 Glyoxalase family protein; structural genomics, MC 99.85
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 99.85
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 99.85
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 99.84
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 99.84
3ghj_A141 Putative integron gene cassette protein; integron 99.84
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 99.84
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 99.83
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 99.83
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 99.83
3e5d_A127 Putative glyoxalase I; structural genomics, joint 99.83
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 99.83
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 99.82
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 99.82
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 99.82
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 99.82
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 99.81
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 99.81
1npb_A141 Fosfomycin-resistance protein; manganese binding, 99.81
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 99.81
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 99.81
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 99.81
1ss4_A153 Glyoxalase family protein; structural genomics, PS 99.81
1nki_A135 Probable fosfomycin resistance protein; potassium 99.8
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 99.8
2i7r_A118 Conserved domain protein; structural genomics cons 99.8
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 99.79
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 99.79
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 99.79
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 99.79
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 99.79
3r6a_A144 Uncharacterized protein; PSI biology, structural g 99.79
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 99.79
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 99.78
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 99.78
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 99.78
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 99.78
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 99.77
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 99.77
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 99.77
3oaj_A 335 Putative ring-cleaving dioxygenase MHQO; structura 99.77
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 99.76
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 99.76
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 99.75
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 99.74
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 99.74
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 99.74
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 99.73
4ghg_A 365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.73
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 99.72
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 99.72
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 99.71
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 99.71
2wl9_A 305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.69
3hpy_A 309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.68
1zsw_A 338 Metallo protein, glyoxalase family protein; hypoth 99.68
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.68
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.67
2zyq_A 300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.67
1lgt_A 297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.66
2ehz_A 302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.66
3lm4_A 339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.66
1f1u_A 323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.66
1kw3_B 292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.65
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.65
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 99.64
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.64
3b59_A 310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.64
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.64
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.62
1mpy_A 307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.62
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 99.61
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.61
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.6
3zi1_A330 Glyoxalase domain-containing protein 4; isomerase; 99.59
3zi1_A 330 Glyoxalase domain-containing protein 4; isomerase; 99.59
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.58
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.56
1t47_A 381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.56
2r5v_A357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.52
1xy7_A166 Unknown protein; structural genomics, protein stru 99.51
2r5v_A 357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.46
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.45
4ghg_A365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.44
1sqd_A 424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.4
1u6l_A149 Hypothetical protein; structural genomics, PSI, pr 99.33
1u7i_A136 Hypothetical protein; structural genomics, PA1358, 99.31
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.3
1t47_A381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.29
3e0r_A244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 99.29
1cjx_A 357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.28
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.26
1cjx_A357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.21
1tsj_A139 Conserved hypothetical protein; structural genomic 99.2
3l20_A172 Putative uncharacterized protein; hypothetical pro 99.15
1sp8_A418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.09
1sqd_A424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.08
3oms_A138 PHNB protein; structural genomics, PSI-2, protein 99.0
3isq_A393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 98.96
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding 98.19
1u69_A163 Hypothetical protein; structural genomics, MSCG, p 97.71
3p8a_A274 Uncharacterized protein; mainly antiparallel beta 97.04
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 96.55
3e0r_A244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 96.5
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 95.58
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 95.35
3e5d_A127 Putative glyoxalase I; structural genomics, joint 94.79
2p25_A126 Glyoxalase family protein; structural genomics, MC 94.58
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 94.54
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 94.52
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 94.3
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 94.03
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 92.79
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 92.77
1ss4_A153 Glyoxalase family protein; structural genomics, PS 92.26
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 91.97
3ghj_A141 Putative integron gene cassette protein; integron 91.51
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 91.41
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 91.27
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 90.65
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 90.34
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 89.9
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 89.42
3p8a_A274 Uncharacterized protein; mainly antiparallel beta 89.04
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 88.65
3opy_A 989 6-phosphofructo-1-kinase alpha-subunit; ATP bindin 88.58
3huh_A152 Virulence protein STM3117; structural genomics, ny 87.1
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 86.17
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 85.89
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 85.25
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 85.24
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 84.82
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 84.62
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 84.61
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 84.61
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 84.16
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 83.46
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 80.8
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 80.64
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 80.62
1k4n_A192 Protein EC4020, protein YECM; structural genomics, 80.53
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 80.22
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
Probab=99.89  E-value=8.9e-22  Score=141.67  Aligned_cols=127  Identities=20%  Similarity=0.372  Sum_probs=98.8

Q ss_pred             CCCCcccceeeeEEEEcCCHHHHHHHHHHccCCeEeeeCCCCCcceEEEEeCCcEEEEeecCCCCCCCCCCCCCCCCccE
Q 029385            5 VENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGIHLLKSEEPDNLPKAGKNINPKDNH   84 (194)
Q Consensus         5 ~~~~~~i~~i~hv~l~v~Dle~s~~FY~~vLG~~~~~~~~~~~~~~~~~~~~g~~~~l~~~~~~~~~~~~~~~~~~g~~h   84 (194)
                      +..+|.+++|+|+.|.|+|++++++||+++|||++..+..    ...++...+..+.+........ +... ....+..|
T Consensus         2 ~~~~m~~~~i~hi~l~v~D~~~a~~FY~~~lG~~~~~~~~----~~~~~~~~~~~~~l~~~~~~~~-~~~~-~~~~~~~~   75 (133)
T 3ey7_A            2 MEFLMKISHLDHLVLTVADIPTTTNFYEKVLGMKAVSFGA----GRIALEFGHQKINLHQLGNEFE-PKAQ-NVRVGSAD   75 (133)
T ss_dssp             CSCCCCCCEEEEEEEEESCHHHHHHHHHHHHCCEEEEETT----TEEEEEETTEEEEEEETTSCCS-SCCT-TCCTTCCE
T ss_pred             CceEeEecccCEEEEEECCHHHHHHHHHHccCceEEEecC----CeEEEEcCCEEEEEEcCCCCcc-ccCC-CCCCCccE
Confidence            3456889999999999999999999999999999998863    4455555666777776543321 1111 44567899


Q ss_pred             EEEeeCC-HHHHHHHHHhCCCeEEccceecCc--cceEEEEEeCCCCCEEEEEecC
Q 029385           85 ISFQCEN-MAIVERRLKEMKIDYVKSRVEEGG--INVDQLFFHDPDGSMIEICNCD  137 (194)
Q Consensus        85 iaf~v~d-l~~~~~~l~~~Gi~~~~~~~~~~g--~~~~~~~~~DPDG~~iEi~~~~  137 (194)
                      ++|.|+| +++++++|+++|+++..++....+  .+.+.+||+|||||.|||++..
T Consensus        76 ~~~~v~dd~~~~~~~l~~~G~~~~~~~~~~~~~~g~~~~~~~~DPdG~~iel~~~~  131 (133)
T 3ey7_A           76 LCFITDTVLSDAMKHVEDQGVTIMEGPVKRTGAQGAITSFYFRDPDGNLIEVSTYS  131 (133)
T ss_dssp             EEEECSSCHHHHHHHHHHTTCCCCEEEEEEEETTEEEEEEEEECTTCCEEEEEESC
T ss_pred             EEEEeCcHHHHHHHHHHHCCCccccCCccccCCCCCeEEEEEECCCCCEEEEEecC
Confidence            9999997 999999999999998876543322  2348999999999999999864



>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 Back     alignment and structure
>3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>1k4n_A Protein EC4020, protein YECM; structural genomics, A NEW fold of protein, PSI, protein structure initiative; 1.60A {Escherichia coli} SCOP: d.32.1.5 Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
d1r9ca_130 d.32.1.2 (A:) Fosfomycin resistance protein FosX { 1e-16
d1qipa_176 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 2e-16
d1zswa1144 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B 8e-16
d1f9za_135 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 7e-15
d1nkia_134 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 3e-14
d1mpya2162 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met 2e-13
d1f1ua2176 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxy 3e-13
d1twua_137 d.32.1.8 (A:) Hypothetical protein YycE {Bacillus 7e-13
d1npba_140 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 1e-12
d1mpya1145 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metap 4e-12
d1jc4a_145 d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion 4e-12
d1ss4a_149 d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillu 1e-11
d2c21a1139 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion 2e-11
d1zswa2170 d.32.1.10 (A:145-314) Hypothetical protein BC1024 2e-11
d2i7ra1115 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str 1e-10
d1lgta1131 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygena 5e-10
d1f1ua1146 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxyge 2e-09
d1kw3b1132 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygena 5e-09
d1klla_128 d.32.1.2 (A:) Mitomycin resistance protein D, MRD 6e-09
d2pjsa1111 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 8e-09
d1xrka_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 1e-08
d1t47a1163 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg 4e-08
d1xqaa_113 d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillu 6e-08
d1kw3b2156 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxyge 9e-08
d1jifa_122 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 3e-07
d1cjxa1150 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxyge 9e-06
d1sp8a2224 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxy 2e-05
d1ecsa_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {K 2e-05
d1sqda1167 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg 3e-04
d1sqia1149 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxyge 4e-04
d1cjxa2203 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxy 4e-04
d1sqda2230 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxy 5e-04
d1sp8a1172 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg 6e-04
d1t47a2199 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxy 7e-04
d1sqia2210 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxy 0.004
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Antibiotic resistance proteins
domain: Fosfomycin resistance protein FosX
species: Mesorhizobium loti [TaxId: 381]
 Score = 70.3 bits (171), Expect = 1e-16
 Identities = 15/126 (11%), Positives = 40/126 (31%), Gaps = 11/126 (8%)

Query: 11  LKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDG---AWLFNYGMGIHLLKSEE 67
           ++ L+H++ + R +E      + V     +    +  F      +     + + +     
Sbjct: 2   IEGLSHMTFIVRDLERMTRILEGVFDAREVYASDTEQFSLSREKFFLIGDIWVAI----- 56

Query: 68  PDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPD 127
                +     +           +      R+ ++ +D    R    G     ++F+D D
Sbjct: 57  --MQGEKLAERSYNHIAFKIDDADFDRYAERVGKLGLDMRPPRPRVEG-EGRSIYFYDDD 113

Query: 128 GSMIEI 133
             M E+
Sbjct: 114 NHMFEL 119


>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 176 Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 145 Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Length = 149 Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 170 Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Length = 131 Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 146 Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 132 Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Length = 128 Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Length = 113 Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 156 Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Length = 122 Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 150 Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 224 Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Length = 120 Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 203 Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 230 Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 199 Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.89
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.86
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 99.86
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 99.85
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 99.84
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 99.84
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 99.83
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 99.83
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 99.82
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 99.82
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.82
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.82
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.81
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.81
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 99.79
d2pjsa1111 Uncharacterized protein Atu1953 {Agrobacterium tum 99.79
d1twua_137 Hypothetical protein YycE {Bacillus subtilis [TaxI 99.79
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.78
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 99.75
d2c21a1139 Glyoxalase I (lactoylglutathione lyase) {Leishmani 99.74
d1jifa_122 Bleomycin resistance protein, BRP {Streptomyces ve 99.73
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.73
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.72
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.72
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 99.71
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.69
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.68
d1xrka_120 Bleomycin resistance protein, BRP {Streptoalloteic 99.64
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.64
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.52
d1xy7a_135 Hypothetical protein At5g48480 {Thale cress (Arabi 99.49
d1sp8a2224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.1
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.07
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.07
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.06
d1u6la_137 Hypothetical protein PA1353 {Pseudomonas aeruginos 98.96
d1sqda2230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 98.91
d1u7ia_134 Hypothetical protein PA1358 {Pseudomonas aeruginos 98.43
d1tsja_129 Hypothetical protein MW1090 {Staphylococcus aureus 98.11
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 95.31
d1u69a_156 Hypothetical protein PA2721 {Pseudomonas aeruginos 95.25
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 94.35
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 93.52
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 90.83
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 89.65
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 89.2
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 88.95
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 88.76
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 88.11
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 87.28
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 86.56
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 85.7
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 84.73
d1k4na_190 Hypothetical protein YecM (EC4020) {Escherichia co 83.16
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 80.97
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 80.74
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: BC1024-like
domain: Hypothetical protein BC1024
species: Bacillus cereus [TaxId: 1396]
Probab=99.89  E-value=1e-22  Score=148.44  Aligned_cols=133  Identities=18%  Similarity=0.183  Sum_probs=93.6

Q ss_pred             CcccceeeeEEEEcCCHHHHHHHHHHccCCeEeeeCCCCCcceEEE--EeCC---cEEEEeecCCCCCCCCCCCCCCCCc
Q 029385            8 PLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWL--FNYG---MGIHLLKSEEPDNLPKAGKNINPKD   82 (194)
Q Consensus         8 ~~~i~~i~hv~l~v~Dle~s~~FY~~vLG~~~~~~~~~~~~~~~~~--~~~g---~~~~l~~~~~~~~~~~~~~~~~~g~   82 (194)
                      |..|++|+||+|.|+|++++.+||+++|||++..+....+....+.  +..+   ....+.....+...+..  ....+.
T Consensus         1 m~~i~gl~Hv~l~v~Dl~~s~~FY~~vLG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~--~~~~~~   78 (144)
T d1zswa1           1 MYEIKGHHHISMVTKNANENNHFYKNVLGLRRVKMTVNQDDPSMYHLFYGDKTGSPGTELSFFEIPLVGRTY--RGTNAI   78 (144)
T ss_dssp             SSCCCSEEEEEEEESCHHHHHHHHHTTTCCEEEEEEEETTEEEEEEEEEESTTCCTTSEEEEEECTTCCBCB--CCBSEE
T ss_pred             CCcccceeeEEEEeCCHHHHHHHHHHHhCCeeEeeeccccCCceeEEEecccccceeeEEeecccccccCCc--cCCCce
Confidence            4579999999999999999999999999999988764333333322  2221   11222222222221111  333468


Q ss_pred             cEEEEeeCC---HHHHHHHHHhCCCeEEccceecCccceEEEEEeCCCCCEEEEEecCCCCcCcCC
Q 029385           83 NHISFQCEN---MAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLA  145 (194)
Q Consensus        83 ~hiaf~v~d---l~~~~~~l~~~Gi~~~~~~~~~~g~~~~~~~~~DPDG~~iEi~~~~~~p~~p~~  145 (194)
                      .|+||.|+|   ++++.++|++.|+.+.... ...  +.+++||+|||||.|||+++...+..||.
T Consensus        79 ~Hiaf~v~~~~~l~~~~~~l~~~gv~~~~~~-~~~--~~~~~yf~DPdG~~iEl~~~~~~~~~~w~  141 (144)
T d1zswa1          79 TRIGLLVPSEDSLHYWKERFEKFDVKHSEMT-TYA--NRPALQFEDAEGLRLVLLVSNGEKVEHWE  141 (144)
T ss_dssp             EEEEEEESCHHHHHHHHHHHHHTTCEECCSE-EET--TEEEEEEECTTCCEEEEEECTTCCCTTCC
T ss_pred             eEEEEecCCchhHHHHhhhhhccceeeeCcc-ccC--CeEEEEEECCCCCEEEEEEeCCCCCCCCC
Confidence            999999997   7888999999999875433 333  34899999999999999998776666664



>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure