Citrus Sinensis ID: 029390

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MSLTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKVN
cccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccEEEcccccccccEEEcccccccccccccccccccccccccccccccEEEcccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHcccccccccEEEEEcccccccccHHEEcHHHccccccEEEEEEEEEcccEEEEEEEEcccHHHHHccccccccccccccccHHHHHHHHHccc
MSLTLIITFIALLGSLyvfcpssaelpwfehpakpdgslsflvvgdwgrrgaynqtkvAHQMGIVGEKLKIDFIIstgdnfyddgltgvddaaFFESFVNIYTAPSLAKQWYNVlgnhdyrgdveaqlspvlrdIDSRWLCLRSFIVNAEIAEfifvdttpfvnkyftdpedhvydwsgiqpRKSYLANLLKVN
MSLTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQtkvahqmgivGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKVN
MSLTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKVN
**LTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANL****
***TLIITFIALLGSLYVFCPSS************DGSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLK**
MSLTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKVN
*SLTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKVN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKVN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
Q8H129 366 Purple acid phosphatase 3 yes no 0.881 0.467 0.695 1e-69
Q8VYZ2 335 Purple acid phosphatase 8 no no 0.886 0.513 0.686 7e-69
Q8VYU7 339 Purple acid phosphatase 4 no no 0.979 0.560 0.610 1e-66
Q9SCX8 338 Purple acid phosphatase 1 no no 0.984 0.565 0.588 1e-64
Q8S341 328 Purple acid phosphatase 7 no no 0.984 0.582 0.580 3e-64
P13686 325 Tartrate-resistant acid p yes no 0.525 0.313 0.371 5e-12
Q05117 327 Tartrate-resistant acid p yes no 0.556 0.330 0.346 7e-12
O97860 325 Tartrate-resistant acid p yes no 0.546 0.326 0.388 9e-12
P29288 327 Tartrate-resistant acid p yes no 0.530 0.314 0.352 1e-11
P09889 340 Tartrate-resistant acid p yes no 0.520 0.297 0.362 1e-10
>sp|Q8H129|PPA3_ARATH Purple acid phosphatase 3 OS=Arabidopsis thaliana GN=PAP3 PE=2 SV=1 Back     alignment and function desciption
 Score =  262 bits (669), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 119/171 (69%), Positives = 143/171 (83%)

Query: 22  SSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNF 81
           S+AEL     P+K DG++SFLV+GDWGRRG+YNQ++VA QMG +GEKL IDF+ISTGDNF
Sbjct: 57  STAELRRLLQPSKTDGTVSFLVIGDWGRRGSYNQSQVALQMGEIGEKLDIDFVISTGDNF 116

Query: 82  YDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLC 141
           YD+GLT + D  F +SF NIYTAPSL K WY+VLGNHDYRGDV AQLSP+LR +D+RW+C
Sbjct: 117 YDNGLTSLHDPLFQDSFTNIYTAPSLQKPWYSVLGNHDYRGDVRAQLSPMLRALDNRWVC 176

Query: 142 LRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLK 192
           +RSFIVNAEI +  FVDTTPFV+KYF  P  HVYDWSG+ PR++YL NLLK
Sbjct: 177 MRSFIVNAEIVDLFFVDTTPFVDKYFIQPNKHVYDWSGVLPRQTYLNNLLK 227

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 2
>sp|Q8VYZ2|PPA8_ARATH Purple acid phosphatase 8 OS=Arabidopsis thaliana GN=PAP8 PE=2 SV=1 Back     alignment and function description
>sp|Q8VYU7|PPA4_ARATH Purple acid phosphatase 4 OS=Arabidopsis thaliana GN=PAP4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SCX8|PPA17_ARATH Purple acid phosphatase 17 OS=Arabidopsis thaliana GN=PAP17 PE=2 SV=1 Back     alignment and function description
>sp|Q8S341|PPA7_ARATH Purple acid phosphatase 7 OS=Arabidopsis thaliana GN=PAP7 PE=2 SV=1 Back     alignment and function description
>sp|P13686|PPA5_HUMAN Tartrate-resistant acid phosphatase type 5 OS=Homo sapiens GN=ACP5 PE=1 SV=3 Back     alignment and function description
>sp|Q05117|PPA5_MOUSE Tartrate-resistant acid phosphatase type 5 OS=Mus musculus GN=Acp5 PE=2 SV=2 Back     alignment and function description
>sp|O97860|PPA5_RABIT Tartrate-resistant acid phosphatase type 5 OS=Oryctolagus cuniculus GN=ACP5 PE=2 SV=1 Back     alignment and function description
>sp|P29288|PPA5_RAT Tartrate-resistant acid phosphatase type 5 OS=Rattus norvegicus GN=Acp5 PE=1 SV=1 Back     alignment and function description
>sp|P09889|PPA5_PIG Tartrate-resistant acid phosphatase type 5 OS=Sus scrofa GN=ACP5 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
224144254258 predicted protein [Populus trichocarpa] 0.969 0.728 0.776 3e-80
224101935 325 predicted protein [Populus trichocarpa] 0.969 0.578 0.776 6e-80
388493242 326 unknown [Medicago truncatula] 0.963 0.573 0.693 8e-75
388494508 324 unknown [Lotus japonicus] 0.917 0.549 0.730 1e-73
255573246 331 Tartrate-resistant acid phosphatase type 0.953 0.558 0.702 3e-73
255573248 328 Tartrate-resistant acid phosphatase type 0.984 0.582 0.704 4e-73
225424458 324 PREDICTED: purple acid phosphatase 3 iso 0.969 0.580 0.689 2e-72
358343459 337 Purple acid phosphatase [Medicago trunca 0.876 0.504 0.754 3e-71
356524720 328 PREDICTED: purple acid phosphatase 17-li 0.989 0.585 0.656 4e-71
356524722 331 PREDICTED: purple acid phosphatase 17-li 0.989 0.580 0.656 5e-71
>gi|224144254|ref|XP_002336123.1| predicted protein [Populus trichocarpa] gi|222873355|gb|EEF10486.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  303 bits (776), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 149/192 (77%), Positives = 164/192 (85%), Gaps = 4/192 (2%)

Query: 1   MSLTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAH 60
           M L+LI T   LLG  +    S+AEL  FEH AK DGSLS LVVGDWGRRGAYNQT+VA 
Sbjct: 5   MLLSLIPT--VLLG--FSVVLSAAELQRFEHAAKADGSLSLLVVGDWGRRGAYNQTEVAL 60

Query: 61  QMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDY 120
           QMGI+GEKL IDFIISTGDNFY+ GL GVDD AF+ESF  IYTAPSL KQWYNVLGNHDY
Sbjct: 61  QMGIMGEKLDIDFIISTGDNFYEGGLNGVDDPAFYESFTRIYTAPSLQKQWYNVLGNHDY 120

Query: 121 RGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGI 180
           RGDVEAQLSPVLR++DS+WLCLRSFIVN EIAEF FVDTTPFVNKYF +P+DHVYDWSGI
Sbjct: 121 RGDVEAQLSPVLREMDSKWLCLRSFIVNTEIAEFFFVDTTPFVNKYFLEPKDHVYDWSGI 180

Query: 181 QPRKSYLANLLK 192
            PRKSYL+N+L+
Sbjct: 181 LPRKSYLSNVLE 192

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224101935|ref|XP_002312482.1| predicted protein [Populus trichocarpa] gi|222852302|gb|EEE89849.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388493242|gb|AFK34687.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388494508|gb|AFK35320.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255573246|ref|XP_002527552.1| Tartrate-resistant acid phosphatase type 5 precursor, putative [Ricinus communis] gi|223533102|gb|EEF34861.1| Tartrate-resistant acid phosphatase type 5 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255573248|ref|XP_002527553.1| Tartrate-resistant acid phosphatase type 5 precursor, putative [Ricinus communis] gi|223533103|gb|EEF34862.1| Tartrate-resistant acid phosphatase type 5 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225424458|ref|XP_002285160.1| PREDICTED: purple acid phosphatase 3 isoform 1 [Vitis vinifera] gi|297737582|emb|CBI26783.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358343459|ref|XP_003635819.1| Purple acid phosphatase [Medicago truncatula] gi|355501754|gb|AES82957.1| Purple acid phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356524720|ref|XP_003530976.1| PREDICTED: purple acid phosphatase 17-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356524722|ref|XP_003530977.1| PREDICTED: purple acid phosphatase 17-like isoform 2 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
TAIR|locus:2059748 335 PAP8 "AT2G01890" [Arabidopsis 0.969 0.561 0.645 2e-65
TAIR|locus:2006742 366 PAP3 "AT1G14700" [Arabidopsis 0.881 0.467 0.695 6.7e-65
TAIR|locus:2033010 339 AT1G25230 "AT1G25230" [Arabido 0.948 0.542 0.631 3.3e-63
TAIR|locus:2088590 338 PAP17 "AT3G17790" [Arabidopsis 0.984 0.565 0.588 5.5e-61
TAIR|locus:2059743 328 PAP7 "AT2G01880" [Arabidopsis 0.984 0.582 0.580 2.4e-60
ZFIN|ZDB-GENE-040426-2864 339 acp5a "acid phosphatase 5a, ta 0.680 0.389 0.356 2.2e-17
ZFIN|ZDB-GENE-040718-151 327 acp5b "acid phosphatase 5b, ta 0.520 0.308 0.385 1.2e-16
UNIPROTKB|O97860 325 ACP5 "Tartrate-resistant acid 0.618 0.369 0.366 1.9e-14
UNIPROTKB|P13686 325 ACP5 "Tartrate-resistant acid 0.525 0.313 0.371 3.3e-13
RGD|2022 327 Acp5 "acid phosphatase 5, tart 0.556 0.330 0.354 3.4e-13
TAIR|locus:2059748 PAP8 "AT2G01890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 666 (239.5 bits), Expect = 2.0e-65, P = 2.0e-65
 Identities = 122/189 (64%), Positives = 149/189 (78%)

Query:     3 LTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAHQM 62
             + LI +   L+  L   C S+AELP F  P +PDGSLSFLVVGDWGRRG+YNQ++VA QM
Sbjct:    10 IKLIFSIFCLVIILSA-CNSTAELPRFVQPPEPDGSLSFLVVGDWGRRGSYNQSQVALQM 68

Query:    63 GIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRG 122
             G +G+ L IDF+ISTGDNFYDDG+    D+ F +SF NIYTA SL K WYNVLGNHDYRG
Sbjct:    69 GKIGKDLNIDFLISTGDNFYDDGIISPYDSQFQDSFTNIYTATSLQKPWYNVLGNHDYRG 128

Query:   123 DVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQP 182
             +V AQLSP+LRD+D RW+CLRS++VNAEI +  FVDTTPFV++YF +P+DHVYDW G+ P
Sbjct:   129 NVYAQLSPILRDLDCRWICLRSYVVNAEIVDIFFVDTTPFVDRYFDEPKDHVYDWRGVLP 188

Query:   183 RKSYLANLL 191
             R  YL +LL
Sbjct:   189 RNKYLNSLL 197
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0016787 "hydrolase activity" evidence=IEA
GO:0016311 "dephosphorylation" evidence=ISS
GO:0003993 "acid phosphatase activity" evidence=ISS
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2006742 PAP3 "AT1G14700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033010 AT1G25230 "AT1G25230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088590 PAP17 "AT3G17790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059743 PAP7 "AT2G01880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2864 acp5a "acid phosphatase 5a, tartrate resistant" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-151 acp5b "acid phosphatase 5b, tartrate resistant" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O97860 ACP5 "Tartrate-resistant acid phosphatase type 5" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|P13686 ACP5 "Tartrate-resistant acid phosphatase type 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2022 Acp5 "acid phosphatase 5, tartrate resistant" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.766
3rd Layer3.1.3.20.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
cd07378 277 cd07378, MPP_ACP5, Homo sapiens acid phosphatase 5 2e-48
PTZ00422 394 PTZ00422, PTZ00422, glideosome-associated protein 8e-10
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 1e-07
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 0.001
>gnl|CDD|163621 cd07378, MPP_ACP5, Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information 
 Score =  159 bits (403), Expect = 2e-48
 Identities = 59/144 (40%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 39  LSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESF 98
           L FL +GDWG  G   Q  VA  M  V  +L  DFI+S GDNFYDDG+  VDD  F  +F
Sbjct: 1   LRFLALGDWGGGGTAGQKAVAKAMAKVAAELGPDFILSLGDNFYDDGVGSVDDPRFETTF 60

Query: 99  VNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLR-------SFIVNAEI 151
            ++Y+APSL   WY VLGNHDY G+V AQ+    R    RW            F  +   
Sbjct: 61  EDVYSAPSLQVPWYLVLGNHDYSGNVSAQIDYTKRPNSPRWTMPAYYYRVSFPFPSSDTT 120

Query: 152 AEFIFVDTTPFVNKYFTDPEDHVY 175
            EFI +DT P           +  
Sbjct: 121 VEFIMIDTVPLCGNSDDIASPYGP 144

Acid phosphatase 5 (ACP5) removes the mannose 6-phosphate recognition marker from lysosomal proteins. The exact site of dephosphorylation is not clear. Evidence suggests dephosphorylation may take place in a prelysosomal compartment as well as in the lysosome. ACP5 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 277
>gnl|CDD|185607 PTZ00422, PTZ00422, glideosome-associated protein 50; Provisional Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
KOG2679 336 consensus Purple (tartrate-resistant) acid phospha 100.0
PTZ00422 394 glideosome-associated protein 50; Provisional 99.97
cd07378 277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 99.93
KOG1378 452 consensus Purple acid phosphatase [Carbohydrate tr 99.83
PLN02533 427 probable purple acid phosphatase 99.82
cd00839 294 MPP_PAPs purple acid phosphatases of the metalloph 99.81
cd07395 262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 99.73
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 99.72
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 99.68
PRK11148 275 cyclic 3',5'-adenosine monophosphate phosphodieste 99.67
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 99.62
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 99.56
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 99.27
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 99.26
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 99.26
KOG3662 410 consensus Cell division control protein/predicted 99.22
COG1409 301 Icc Predicted phosphohydrolases [General function 99.19
TIGR03767 496 P_acnes_RR metallophosphoesterase, PPA1498 family. 99.1
KOG1432 379 consensus Predicted DNA repair exonuclease SIA1 [G 99.04
PRK11340271 phosphodiesterase YaeI; Provisional 98.99
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 98.98
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 98.94
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 98.88
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 98.85
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 98.84
TIGR03768 492 RPA4764 metallophosphoesterase, RPA4764 family. Th 98.83
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 98.74
PF09423 453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 98.69
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 98.66
PHA02546 340 47 endonuclease subunit; Provisional 98.65
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 98.63
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 98.61
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 98.61
PRK10966 407 exonuclease subunit SbcD; Provisional 98.59
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 98.58
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 98.47
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 98.44
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 98.43
cd07397 238 MPP_DevT Myxococcus xanthus DevT and related prote 98.35
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 98.31
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 98.3
cd00838131 MPP_superfamily metallophosphatase superfamily, me 98.3
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 98.3
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 98.29
KOG3770 577 consensus Acid sphingomyelinase and PHM5 phosphate 98.27
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 98.26
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.23
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 98.22
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 98.19
COG1408284 Predicted phosphohydrolases [General function pred 98.15
PHA02239235 putative protein phosphatase 98.14
PRK09453182 phosphodiesterase; Provisional 98.11
COG3540 522 PhoD Phosphodiesterase/alkaline phosphatase D [Ino 98.1
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 98.08
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 98.06
PRK00166 275 apaH diadenosine tetraphosphatase; Reviewed 98.02
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 97.93
PRK04036504 DNA polymerase II small subunit; Validated 97.93
cd07389228 MPP_PhoD Bacillus subtilis PhoD and related protei 97.89
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 97.86
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 97.84
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 97.84
cd07422 257 MPP_ApaH Escherichia coli ApaH and related protein 97.79
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 97.78
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 97.75
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 97.72
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 97.68
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 97.67
PRK09968218 serine/threonine-specific protein phosphatase 2; P 97.66
COG1407235 Predicted ICC-like phosphoesterases [General funct 97.6
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 97.59
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 97.57
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 97.55
cd07421 304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 97.55
TIGR00668 279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 97.52
cd00844 262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 97.31
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 97.26
COG2129226 Predicted phosphoesterases, related to the Icc pro 97.08
COG2908237 Uncharacterized protein conserved in bacteria [Fun 97.06
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 97.01
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 97.0
COG0622172 Predicted phosphoesterase [General function predic 96.96
cd07420 321 MPP_RdgC Drosophila melanogaster RdgC and related 96.89
cd07406 257 MPP_CG11883_N Drosophila melanogaster CG11883 and 96.72
cd07408 257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 96.68
cd07418 377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 96.62
cd07382 255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 96.59
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 96.51
TIGR00282 266 metallophosphoesterase, MG_246/BB_0505 family. A m 96.48
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 96.43
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 96.38
cd07417 316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 96.3
cd07416 305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 96.29
cd07410 277 MPP_CpdB_N Escherichia coli CpdB and related prote 96.19
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 96.02
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 96.02
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 95.92
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 95.79
PTZ00480 320 serine/threonine-protein phosphatase; Provisional 95.72
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 95.71
PTZ00239 303 serine/threonine protein phosphatase 2A; Provision 95.63
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 95.39
cd07419 311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 95.38
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 95.37
COG1692 266 Calcineurin-like phosphoesterase [General function 95.3
cd07412 288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 95.26
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 95.02
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 94.62
COG1768230 Predicted phosphohydrolase [General function predi 94.48
cd07409 281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 94.24
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 94.1
cd07407 282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 93.96
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 93.9
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 93.73
cd08162 313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 93.32
cd07405 285 MPP_UshA_N Escherichia coli UshA and related prote 93.27
PF13277 253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 92.38
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 91.76
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 91.59
KOG0374 331 consensus Serine/threonine specific protein phosph 91.42
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 89.48
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 89.09
KOG3947 305 consensus Phosphoesterases [General function predi 84.87
PTZ00235291 DNA polymerase epsilon subunit B; Provisional 84.45
KOG0372 303 consensus Serine/threonine specific protein phosph 81.32
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-35  Score=239.29  Aligned_cols=191  Identities=62%  Similarity=1.056  Sum_probs=165.5

Q ss_pred             chhHHHHHHHHHHhhhhccccCCCCCCccCCCCCCCCeEEEEEeCCCCCCCCCHHHHHHHHHHHhhhcCccEEEEcCCcc
Q 029390            2 SLTLIITFIALLGSLYVFCPSSAELPWFEHPAKPDGSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNF   81 (194)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~igD~g~~~~~~~~~v~~~~~~~~~~~~pdfvl~~GD~~   81 (194)
                      .+++|+.+.-++..+. .+++++.|+|+..|++.+.+++|+++||||..+.++|..++..|.+++++...||||.+|||+
T Consensus         8 ~~~~~~~i~t~f~I~~-~~~s~~eLp~l~~p~~~dgslsflvvGDwGr~g~~nqs~va~qmg~ige~l~idfvlS~GDNf   86 (336)
T KOG2679|consen    8 PFSLLFGILTIFFILS-AISSTAELPRLYDPAKSDGSLSFLVVGDWGRRGSFNQSQVALQMGEIGEKLDIDFVLSTGDNF   86 (336)
T ss_pred             ceeehHHHHHHHHHhh-ccchhhhhhhhcCCCCCCCceEEEEEcccccCCchhHHHHHHHHHhHHHhccceEEEecCCcc
Confidence            3444444333333333 346789999999999999999999999999878889999999999999999999999999999


Q ss_pred             ccCCCCCCCcHHHHHHhHhhhCCCCCCCceEEeccCcccCCCcccccccccccCCCcceeeeeEEEeCCeEEEEEEcCcc
Q 029390           82 YDDGLTGVDDAAFFESFVNIYTAPSLAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTP  161 (194)
Q Consensus        82 Y~~G~~~~~d~~~~~~~~~~~~~~~l~iP~~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~p~~ysf~~g~v~fI~lDT~~  161 (194)
                      |++|+.+.+|++|++.|+.+|+..+|+.|||.++||||++++..+|+++-++...+||.||+.|..+..-+.+.++|+.+
T Consensus        87 Yd~G~~~~~Dp~Fq~sF~nIYT~pSLQkpWy~vlGNHDyrGnV~AQls~~l~~~d~RW~c~rsf~~~ae~ve~f~v~~~~  166 (336)
T KOG2679|consen   87 YDTGLTSENDPRFQDSFENIYTAPSLQKPWYSVLGNHDYRGNVEAQLSPVLRKIDKRWICPRSFYVDAEIVEMFFVDTTP  166 (336)
T ss_pred             cccCCCCCCChhHHhhhhhcccCcccccchhhhccCccccCchhhhhhHHHHhhccceecccHHhhcceeeeeecccccc
Confidence            99999999999999999999998899999999999999999999999988889999999999887887889999999999


Q ss_pred             cccccccCCCCCcccccccCcc------h-HHHHHHhhc
Q 029390          162 FVNKYFTDPEDHVYDWSGIQPR------K-SYLANLLKV  193 (194)
Q Consensus       162 ~~~~y~~~~~~~~~~~~~l~~~------Q-~WL~~dL~~  193 (194)
                      +..+|+..+.+.-++|.+..++      + .||+..|++
T Consensus       167 f~~d~~~~~~~~~ydw~~v~PR~~~~~~~l~~le~~L~~  205 (336)
T KOG2679|consen  167 FMDDTFTLCTDDVYDWRGVLPRVKYLRALLSWLEVALKA  205 (336)
T ss_pred             chhhheecccccccccccCChHHHHHHHHHHHHHHHHHH
Confidence            9989998888788888876664      4 677777653

>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3770 consensus Acid sphingomyelinase and PHM5 phosphate metabolism protein [Lipid transport and metabolism] Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>KOG3947 consensus Phosphoesterases [General function prediction only] Back     alignment and domain information
>PTZ00235 DNA polymerase epsilon subunit B; Provisional Back     alignment and domain information
>KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1war_A 310 Recombinant Human Purple Acid Phosphatase Expressed 7e-13
2bq8_X 304 Crystal Structure Of Human Purple Acid Phosphatase 7e-13
1qhw_A 327 Purple Acid Phosphatase From Rat Bone Length = 327 1e-12
1qfc_A 306 Structure Of Rat Purple Acid Phosphatase Length = 3 4e-12
1ute_A 313 Pig Purple Acid Phosphatase Complexed With Phosphat 1e-11
3tgh_A 342 Gap50 The Anchor In The Inner Membrane Complex Of P 1e-04
>pdb|1WAR|A Chain A, Recombinant Human Purple Acid Phosphatase Expressed In Pichia Pastoris Length = 310 Back     alignment and structure 
Iteration: 1

 Score = 70.1 bits (170), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 62/112 (55%), Gaps = 16/112 (14%)
Query: 38  SLSFLVVGDWG---------RRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTG 88
           +L F+ VGDWG          R   N  ++A  + I+G     DFI+S GDNFY  G+  
Sbjct: 10  ALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILG----ADFILSLGDNFYFTGVQD 65
Query: 89  VDDAAFFESFVNIYTAPSLAK-QWYNVLGNHDYRGDVEAQLSPVLRDIDSRW 139
           ++D  F E+F ++++  SL K  WY + GNHD+ G+V AQ++     I  RW
Sbjct: 66  INDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIA--YSKISKRW 115
>pdb|2BQ8|X Chain X, Crystal Structure Of Human Purple Acid Phosphatase With An Inhibitory Conformation Of The Repression Loop Length = 304 Back     alignment and structure
>pdb|1QHW|A Chain A, Purple Acid Phosphatase From Rat Bone Length = 327 Back     alignment and structure
>pdb|1QFC|A Chain A, Structure Of Rat Purple Acid Phosphatase Length = 306 Back     alignment and structure
>pdb|1UTE|A Chain A, Pig Purple Acid Phosphatase Complexed With Phosphate Length = 313 Back     alignment and structure
>pdb|3TGH|A Chain A, Gap50 The Anchor In The Inner Membrane Complex Of Plasmodium Length = 342 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1ute_A 313 Protein (II purple acid phosphatase); tartrate res 7e-38
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 2e-22
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 1e-06
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 4e-04
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 7e-04
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 7e-04
3d03_A 274 Phosphohydrolase; glycerophosphodiesterase, metall 9e-04
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Length = 313 Back     alignment and structure
 Score =  131 bits (331), Expect = 7e-38
 Identities = 45/169 (26%), Positives = 70/169 (41%), Gaps = 11/169 (6%)

Query: 35  PDGSLSFLVVGDWGRRGAY-----NQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGV 89
           P   L F+ VGDWG           +   A  +    + L  DFI+S GDNFY  G+   
Sbjct: 3   PTPILRFVAVGDWGGVPNAPFHTAREMANAKAIATTVKTLGADFILSLGDNFYFTGVHDA 62

Query: 90  DDAAFFESFVNIYTAPSLAK-QWYNVLGNHDYRGDVEAQLSPVLRD----IDSRWLCLRS 144
            D  F E+F ++++ PSL    W+ + GNHD+ G+V AQ++           S +  LR 
Sbjct: 63  KDKRFQETFEDVFSDPSLRNVPWHVLAGNHDHLGNVSAQIAYSKISKRWNFPSPYYRLRF 122

Query: 145 FIVNAEI-AEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLK 192
            I  + +      +DT                    +   ++ LA + K
Sbjct: 123 KIPRSNVSVAIFMLDTVTLCGNSDDFVSQQPERPRNLALARTQLAWIKK 171
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Length = 342 Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Length = 426 Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Length = 424 Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Length = 322 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Length = 443 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Length = 274 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 99.95
1ute_A 313 Protein (II purple acid phosphatase); tartrate res 99.85
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 99.78
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 99.74
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 99.62
3d03_A 274 Phosphohydrolase; glycerophosphodiesterase, metall 99.59
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 99.57
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 99.55
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 99.53
2q8u_A 336 Exonuclease, putative; structural genomics, joint 98.9
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 98.8
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 98.62
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 98.61
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 98.61
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 98.54
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 98.53
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 98.51
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 98.5
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 98.41
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 98.37
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 98.36
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 98.29
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 98.27
3qfm_A 270 SAPH, putative uncharacterized protein; sandwich f 98.21
1nnw_A 252 Hypothetical protein; structural genomics, PSI, pr 98.19
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 98.14
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 98.13
3ck2_A176 Conserved uncharacterized protein (predicted phosp 98.04
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 97.98
3rqz_A 246 Metallophosphoesterase; PSI-biology, midwest cente 97.91
2qjc_A 262 Diadenosine tetraphosphatase, putative; putative d 97.84
2dfj_A 280 Diadenosinetetraphosphatase; helices and strands m 97.81
3h63_A 315 Serine/threonine-protein phosphatase 5; metalloenz 97.39
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.38
2ie4_C 309 PP2A-alpha;, serine/threonine-protein phosphatase 97.36
3icf_A 335 PPT, serine/threonine-protein phosphatase T; IRO m 97.36
2z72_A 342 Protein-tyrosine-phosphatase; cold-active enzyme, 97.32
1fjm_A 330 Protein serine/threonine phosphatase-1 (alpha ISO 97.26
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 97.08
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 97.05
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 96.87
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 96.82
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 96.81
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 96.25
3qfk_A 527 Uncharacterized protein; structural genomics, cent 96.12
1t71_A 281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 96.06
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 96.02
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 95.88
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 95.73
3jyf_A 339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 94.44
2z06_A 252 Putative uncharacterized protein TTHA0625; metal b 94.03
3gve_A 341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 94.03
1t70_A 255 Phosphatase; crystal, X-RAY crystallography, struc 93.5
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 93.27
3e0j_A476 DNA polymerase subunit delta-2; DNA polymerase del 93.15
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 92.15
3flo_A 460 DNA polymerase alpha subunit B; protein-protein co 83.82
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
Probab=99.95  E-value=4.9e-28  Score=206.16  Aligned_cols=150  Identities=26%  Similarity=0.445  Sum_probs=117.4

Q ss_pred             CCeEEEEEeCCCCCCCCCHHHHHHHHHHHhhhcCccEEEEcCCccccCCCCCCCcHHHHHHhHhhhCCC--CCCCceEEe
Q 029390           37 GSLSFLVVGDWGRRGAYNQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAP--SLAKQWYNV  114 (194)
Q Consensus        37 ~~~~f~~igD~g~~~~~~~~~v~~~~~~~~~~~~pdfvl~~GD~~Y~~G~~~~~d~~~~~~~~~~~~~~--~l~iP~~~v  114 (194)
                      .++||+++||||. +...|..+++.|.+++++.+|||||++||++|+ |..+.++++|.+.|++++...  .+++|||+|
T Consensus         2 ~~l~f~~igD~g~-g~~~q~~va~~m~~~~~~~~pd~vl~~GD~~y~-G~~~~~d~~~~~~f~~~~~~~~~~~~~P~~~v   79 (342)
T 3tgh_A            2 CQLRFASLGDWGK-DTKGQILNAKYFKQFIKNERVTFIVSPGSNFID-GVKGLNDPAWKNLYEDVYSEEKGDMYMPFFTV   79 (342)
T ss_dssp             CCEEEEECCSCBS-CCHHHHHHHHHHHHHHHHTTCCEEEECSCSBTT-CCCSTTCTHHHHHTTTTSCCGGGTTCSEEEEC
T ss_pred             ceEEEEEEecCCC-CCchHHHHHHHHHHHHhhcCCCEEEECCCcccC-CCCcCccHHHHHHHHHHhhhhhhhhCCCEEEe
Confidence            5799999999996 556788999999999988999999999999998 887777889999999988643  578999999


Q ss_pred             ccCcccCCCccccccccc-----------------ccCCCcceeee-eEEEe----C---------C----eEEEEEEcC
Q 029390          115 LGNHDYRGDVEAQLSPVL-----------------RDIDSRWLCLR-SFIVN----A---------E----IAEFIFVDT  159 (194)
Q Consensus       115 ~GNHD~~~~~~~~~~~~~-----------------~~~~~~~~~p~-~ysf~----~---------g----~v~fI~lDT  159 (194)
                      +||||+.++..+|+++..                 +...+||.||. ||++.    .         |    .++||+|||
T Consensus        80 lGNHD~~~~~~aq~~~~~~~~~~~~~~~~~~~~~~~~~~~rw~~P~~yY~~~~~f~~~~~~~~~~~g~~~~~v~fi~LDT  159 (342)
T 3tgh_A           80 LGTRDWTGNYNAQLLKGQGIYIEKNGETSIEKDADATNYPKWIMPNYWYHYFTHFTVSSGPSIVKTGHKDLAAAFIFIDT  159 (342)
T ss_dssp             CCHHHHTSCHHHHHHHHHC---------------CCCSSCEEECSSSSEEEEEEEEEC---------CEEEEEEEEECCT
T ss_pred             CCCCccCCCchHhhhhhhcccccccccccccccccccCCCCccCCcceEEEEEEeeccccccccccCCCCceEEEEEEeC
Confidence            999999999888877532                 34679999995 67642    1         2    499999999


Q ss_pred             cccccccccCCCCCcccccccCcch-HHHHHHhhc
Q 029390          160 TPFVNKYFTDPEDHVYDWSGIQPRK-SYLANLLKV  193 (194)
Q Consensus       160 ~~~~~~y~~~~~~~~~~~~~l~~~Q-~WL~~dL~~  193 (194)
                      +.+...+   |..  .......++| +||+++|++
T Consensus       160 ~~l~~~~---~~~--~~~~~~~~~Ql~WLe~~L~~  189 (342)
T 3tgh_A          160 WVLSSNF---PYK--KIHEKAWNDLKSQLSVAKKI  189 (342)
T ss_dssp             TTTSTTC---SCH--HHHHHHHHHHHHHHHHHHHH
T ss_pred             cccccCC---ccc--ccchHHHHHHHHHHHHhhcc
Confidence            8765321   100  0012345689 999999953
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
d1utea_ 302 d.159.1.1 (A:) Mammalian purple acid phosphatase { 2e-24
d2qfra2 312 d.159.1.1 (A:121-432) Plant purple acid phosphatas 7e-14
d2nxfa1 320 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homo 2e-04
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Mammalian purple acid phosphatase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score = 95.2 bits (235), Expect = 2e-24
 Identities = 44/169 (26%), Positives = 68/169 (40%), Gaps = 11/169 (6%)

Query: 35  PDGSLSFLVVGDWGRRGAY-----NQTKVAHQMGIVGEKLKIDFIISTGDNFYDDGLTGV 89
           P   L F+ VGDWG           +   A  +    + L  DFI+S GDNFY  G+   
Sbjct: 1   PTPILRFVAVGDWGGVPNAPFHTAREMANAKAIATTVKTLGADFILSLGDNFYFTGVHDA 60

Query: 90  DDAAFFESFVNIYTAPSLAK-QWYNVLGNHDYRGDVEAQLSPVLRD----IDSRWLCLR- 143
            D  F E+F ++++ PSL    W+ + GNHD+ G+V AQ++           S +  LR 
Sbjct: 61  KDKRFQETFEDVFSDPSLRNVPWHVLAGNHDHLGNVSAQIAYSKISKRWNFPSPYYRLRF 120

Query: 144 SFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLK 192
               +        +DT                    +   ++ LA + K
Sbjct: 121 KIPRSNVSVAIFMLDTVTLCGNSDDFVSQQPERPRNLALARTQLAWIKK 169
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 312 Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Length = 320 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d2qfra2 312 Plant purple acid phosphatase, catalytic domain {K 99.86
d1utea_ 302 Mammalian purple acid phosphatase {Pig (Sus scrofa 99.85
d2hy1a1 256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 99.65
d3d03a1 271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 99.6
d2nxfa1 320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 99.38
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.12
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 98.98
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.86
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 98.21
d1nnwa_ 251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 98.19
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 98.15
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 98.04
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 97.94
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 97.83
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 97.63
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 97.55
d1s95a_ 324 Serine/threonine protein phosphatase 5, PP5 {Human 95.88
d3c9fa2 322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 95.31
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 95.14
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 95.1
d1t71a_ 281 Hypothetical protein MPN349 {Mycoplasma pneumoniae 94.96
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 94.35
d2z1aa2 302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 94.28
d1usha2 337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 94.0
d2z06a1 252 Hypothetical protein TTHA0625 {Thermus thermophilu 86.41
d1t70a_ 255 Putative phosphatase DR1281 {Deinococcus radiodura 85.45
d1gg4a1135 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 84.8
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.86  E-value=2e-22  Score=167.46  Aligned_cols=138  Identities=16%  Similarity=0.212  Sum_probs=88.5

Q ss_pred             CCCCeEEEEEeCCCCCCCCCHHHHHHHHHH-HhhhcCccEEEEcCCccccCCCCCCCcHHHHHHhHhhhCCCCCCCceEE
Q 029390           35 PDGSLSFLVVGDWGRRGAYNQTKVAHQMGI-VGEKLKIDFIISTGDNFYDDGLTGVDDAAFFESFVNIYTAPSLAKQWYN  113 (194)
Q Consensus        35 ~~~~~~f~~igD~g~~~~~~~~~v~~~~~~-~~~~~~pdfvl~~GD~~Y~~G~~~~~d~~~~~~~~~~~~~~~l~iP~~~  113 (194)
                      ++.++||+++||+|..    .. ..+.+.. .....+|||||++||++|.+|....+..+|.+ |.+.+......+|+++
T Consensus         4 ~~~p~~F~v~GD~g~~----~~-~~~~~~~~~~~~~~pdfvl~~GDl~Y~~~~~~~~~~~wd~-~~~~~~~~~~~~P~~~   77 (312)
T d2qfra2           4 LDVPYTFGLIGDLGQS----FD-SNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDT-WGRFTERSVAYQPWIW   77 (312)
T ss_dssp             SSCCEEEEEECSCCSB----HH-HHHHHHHHHHCSSCCSEEEECSCCCCGGGSGGGCTHHHHH-HHHHHHHHHTTSCEEE
T ss_pred             CCCCEEEEEEeeCCCC----Cc-hHHHHHHHHHcCCCCCEEEECCCCCcCCCCcccchHHHHH-HHHHHHHHhhcceEEE
Confidence            5678999999999852    11 1222222 23457899999999999988765545556653 3333221224689999


Q ss_pred             eccCcccCCCcccccccccccCCCcceee---------eeEEEeCCeEEEEEEcCcccccccccCCCCCcccccccCcch
Q 029390          114 VLGNHDYRGDVEAQLSPVLRDIDSRWLCL---------RSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRK  184 (194)
Q Consensus       114 v~GNHD~~~~~~~~~~~~~~~~~~~~~~p---------~~ysf~~g~v~fI~lDT~~~~~~y~~~~~~~~~~~~~l~~~Q  184 (194)
                      ++||||+...........+.....+|.+|         .+|+|++|++|||+|||+..              + ....+|
T Consensus        78 ~~GNHD~~~~~~~~~~~~~~~~~~~f~~P~~~~~~~~~~~Ysf~~g~v~fi~Lds~~~--------------~-~~~~~Q  142 (312)
T d2qfra2          78 TAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSA--------------Y-GRGTPQ  142 (312)
T ss_dssp             CCCGGGTCCBGGGTBCSTTHHHHHHCCCCGGGGTCSSTTSEEEEETTEEEEECCTTSC--------------C-STTSHH
T ss_pred             ecccccccccccccccccccchhhhccCCccccCCCCCceEEEEECCEEEEEeecccc--------------c-cchHHH
Confidence            99999986432211110011111233333         48999999999999999631              1 123578


Q ss_pred             -HHHHHHhhc
Q 029390          185 -SYLANLLKV  193 (194)
Q Consensus       185 -~WL~~dL~~  193 (194)
                       +||+++|++
T Consensus       143 ~~WL~~~L~~  152 (312)
T d2qfra2         143 YTWLKKELRK  152 (312)
T ss_dssp             HHHHHHHHHT
T ss_pred             HHHHHHHHHH
Confidence             999999985
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gg4a1 c.59.1.1 (A:313-447) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure