Citrus Sinensis ID: 029583
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| 388513049 | 301 | unknown [Lotus japonicus] | 0.706 | 0.448 | 0.611 | 5e-42 | |
| 359494012 | 302 | PREDICTED: uncharacterized protein LOC10 | 0.732 | 0.463 | 0.593 | 3e-41 | |
| 356571315 | 276 | PREDICTED: uncharacterized protein LOC10 | 0.654 | 0.452 | 0.648 | 5e-41 | |
| 224055541 | 299 | predicted protein [Populus trichocarpa] | 0.753 | 0.481 | 0.570 | 1e-39 | |
| 255567365 | 301 | heat shock protein binding protein, puta | 0.748 | 0.475 | 0.550 | 5e-39 | |
| 449450080 | 301 | PREDICTED: uncharacterized protein LOC10 | 0.806 | 0.511 | 0.527 | 3e-36 | |
| 359494021 | 284 | PREDICTED: uncharacterized protein LOC10 | 0.691 | 0.464 | 0.546 | 7e-33 | |
| 148909157 | 460 | unknown [Picea sitchensis] | 0.513 | 0.213 | 0.622 | 1e-29 | |
| 413944067 | 193 | hypothetical protein ZEAMMB73_534756 [Ze | 0.649 | 0.642 | 0.527 | 4e-27 | |
| 226506232 | 304 | 3Fe-4S ferredoxin [Zea mays] gi|19564148 | 0.649 | 0.407 | 0.527 | 3e-26 |
| >gi|388513049|gb|AFK44586.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Score = 176 bits (446), Expect = 5e-42, Method: Compositional matrix adjust.
Identities = 85/139 (61%), Positives = 103/139 (74%), Gaps = 4/139 (2%)
Query: 12 VSGYVNPNKSSLRARWGQRCSVIRCCNGRAGERASKKKNYYELLGVSVEANGQEIKEAYR 71
V G++N N R Q +V+RCCN R+ E+ + NYYELLGVSV+++ +IKEAYR
Sbjct: 20 VHGHMNFNSPMSR----QNVTVVRCCNRRSWEKPRAQNNYYELLGVSVDSDTHQIKEAYR 75
Query: 72 KLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRS 131
KLQKKYHPDI GQKGHE+TL+LN+AY+VLM D R+ YD SIGQMR FG N SA S
Sbjct: 76 KLQKKYHPDIVGQKGHEYTLMLNKAYEVLMTEDRRRKYDESIGQMRLRFGENNSAPLGYS 135
Query: 132 SWKGPPRPEALFVDENACI 150
+W GP RP+ALFVDENACI
Sbjct: 136 TWNGPLRPQALFVDENACI 154
|
Source: Lotus japonicus Species: Lotus japonicus Genus: Lotus Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359494012|ref|XP_003634709.1| PREDICTED: uncharacterized protein LOC100854700 [Vitis vinifera] gi|297735977|emb|CBI23951.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356571315|ref|XP_003553824.1| PREDICTED: uncharacterized protein LOC100776887 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224055541|ref|XP_002298530.1| predicted protein [Populus trichocarpa] gi|222845788|gb|EEE83335.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255567365|ref|XP_002524662.1| heat shock protein binding protein, putative [Ricinus communis] gi|223536023|gb|EEF37681.1| heat shock protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449450080|ref|XP_004142792.1| PREDICTED: uncharacterized protein LOC101222804 [Cucumis sativus] gi|449483772|ref|XP_004156687.1| PREDICTED: uncharacterized LOC101222804 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359494021|ref|XP_003634711.1| PREDICTED: uncharacterized protein LOC100855066 [Vitis vinifera] gi|297735976|emb|CBI23950.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|148909157|gb|ABR17679.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|413944067|gb|AFW76716.1| hypothetical protein ZEAMMB73_534756 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|226506232|ref|NP_001150750.1| 3Fe-4S ferredoxin [Zea mays] gi|195641484|gb|ACG40210.1| 3Fe-4S ferredoxin [Zea mays] gi|223949213|gb|ACN28690.1| unknown [Zea mays] gi|413944066|gb|AFW76715.1| 3Fe-4S ferredoxin [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| TAIR|locus:2166968 | 465 | AT5G23240 [Arabidopsis thalian | 0.586 | 0.240 | 0.356 | 2.5e-13 | |
| UNIPROTKB|F1NNE0 | 393 | DNAJA3 "Uncharacterized protei | 0.507 | 0.246 | 0.446 | 7.4e-12 | |
| UNIPROTKB|J9P8P4 | 453 | DNAJA3 "Uncharacterized protei | 0.481 | 0.203 | 0.45 | 1.3e-11 | |
| UNIPROTKB|Q96EY1 | 480 | DNAJA3 "DnaJ homolog subfamily | 0.481 | 0.191 | 0.45 | 1.4e-11 | |
| UNIPROTKB|A1A4J9 | 453 | DNAJA3 "DnaJ (Hsp40) homolog, | 0.481 | 0.203 | 0.44 | 2.7e-11 | |
| UNIPROTKB|Q83CJ2 | 313 | cbpA "Curved DNA-binding prote | 0.460 | 0.281 | 0.395 | 3.9e-11 | |
| TIGR_CMR|CBU_1123 | 313 | CBU_1123 "curved DNA-binding p | 0.460 | 0.281 | 0.395 | 3.9e-11 | |
| UNIPROTKB|I3LLG4 | 476 | DNAJA3 "Uncharacterized protei | 0.481 | 0.193 | 0.43 | 4.9e-11 | |
| UNIPROTKB|Q47XI7 | 378 | dnaJ "Chaperone protein DnaJ" | 0.413 | 0.208 | 0.439 | 5.1e-11 | |
| TIGR_CMR|CPS_3820 | 378 | CPS_3820 "chaperone protein Dn | 0.413 | 0.208 | 0.439 | 5.1e-11 |
| TAIR|locus:2166968 AT5G23240 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 182 (69.1 bits), Expect = 2.5e-13, P = 2.5e-13
Identities = 41/115 (35%), Positives = 61/115 (53%)
Query: 37 CNGRAGERASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEA 96
C + + + Y+LLG+ ++ +IK AYR LQK+ HPDIAG GH+ ++LNEA
Sbjct: 37 CRATSSSSSITDFDLYDLLGIDRSSDKSQIKSAYRALQKRCHPDIAGDPGHDMAIILNEA 96
Query: 97 YKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRSSWKGPPRPE-ALFVDENACI 150
Y++L R+ YD ++ G +S W GP + A FVDE C+
Sbjct: 97 YQLLSDPISRQAYDKEQAKLEELRGYTGKPIYS--VWCGPETEQRAAFVDEVKCV 149
|
|
| UNIPROTKB|F1NNE0 DNAJA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P8P4 DNAJA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96EY1 DNAJA3 "DnaJ homolog subfamily A member 3, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A1A4J9 DNAJA3 "DnaJ (Hsp40) homolog, subfamily A, member 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q83CJ2 cbpA "Curved DNA-binding protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1123 CBU_1123 "curved DNA-binding protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LLG4 DNAJA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q47XI7 dnaJ "Chaperone protein DnaJ" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3820 CPS_3820 "chaperone protein DnaJ" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00027371001 | SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (302 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00011155001 | • | 0.493 | |||||||||
| GSVIVG00002794001 | • | 0.493 | |||||||||
| GSVIVG00022013001 | • | 0.490 | |||||||||
| GSVIVG00017724001 | • | 0.489 | |||||||||
| GSVIVG00017185001 | • | 0.482 | |||||||||
| GSVIVG00037232001 | • | 0.481 | |||||||||
| GSVIVG00022731001 | • | 0.481 | |||||||||
| GSVIVG00001482001 | • | 0.480 | |||||||||
| GSVIVG00006687001 | • | 0.479 | |||||||||
| GSVIVG00013558001 | • | 0.475 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 2e-19 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 2e-18 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 5e-18 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 9e-17 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 7e-16 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 1e-15 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 1e-15 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 2e-15 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 3e-15 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 5e-15 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 2e-14 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 2e-14 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 3e-14 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 7e-14 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 9e-14 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 1e-13 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 4e-13 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 7e-13 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 8e-13 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 1e-12 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 3e-12 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 3e-12 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 2e-11 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 9e-11 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 9e-11 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 2e-10 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 2e-10 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 3e-10 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 4e-10 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 9e-10 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 1e-09 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 4e-09 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 4e-09 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 5e-09 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 7e-09 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 3e-08 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 4e-07 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-06 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 3e-05 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 0.001 | |
| PRK05014 | 171 | PRK05014, hscB, co-chaperone HscB; Provisional | 0.001 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 0.001 | |
| TIGR00714 | 155 | TIGR00714, hscB, Fe-S protein assembly co-chaperon | 0.001 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 77.6 bits (192), Expect = 2e-19
Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
Query: 50 NYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTL--LLNEAYKVLMRGDLRK 107
+YYE+LGV +A+ +EIK+AYRKL KYHPD +NEAY+VL + R
Sbjct: 1 DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60
Query: 108 DYD 110
YD
Sbjct: 61 IYD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|179914 PRK05014, hscB, co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.91 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.87 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.84 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.81 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.8 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.8 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.79 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.76 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.75 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.74 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.74 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.74 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.74 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.74 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.74 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.74 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.74 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.73 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.73 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.72 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.72 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.7 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.7 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.7 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.69 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.69 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.69 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.69 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.68 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.68 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.67 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.66 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.65 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.65 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.62 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.6 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.59 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.57 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.57 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.56 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.55 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.53 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.51 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.49 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.45 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.41 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.36 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.31 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.3 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.3 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.29 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.27 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.11 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 99.07 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.99 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.97 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.64 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.34 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.34 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 97.94 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.6 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.52 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 96.45 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 96.35 | |
| PF11833 | 194 | DUF3353: Protein of unknown function (DUF3353); In | 90.56 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 88.93 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 82.67 | |
| PF14687 | 112 | DUF4460: Domain of unknown function (DUF4460) | 80.88 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.91 E-value=3.9e-25 Score=192.54 Aligned_cols=70 Identities=47% Similarity=0.684 Sum_probs=64.9
Q ss_pred CccCchhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCC-C-chHHHHHHHHHHHHHhcCCCchhhhhhhhccc
Q 029583 47 KKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAG-Q-KGHEHTLLLNEAYKVLMRGDLRKDYDASIGQM 116 (191)
Q Consensus 47 ~~~d~Y~iLgv~~~a~~~~Ik~ayr~l~~~~HPDk~~-~-~~~~~~~~I~~Ay~vL~d~~~R~~YD~~~~~~ 116 (191)
..+|||+||||+++||.+|||+|||+|+++||||+|+ + .++++|++|++||+||+||++|+.||++....
T Consensus 2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~ 73 (371)
T COG0484 2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAG 73 (371)
T ss_pred CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccc
Confidence 4689999999999999999999999999999999999 3 68999999999999999999999999975443
|
|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14687 DUF4460: Domain of unknown function (DUF4460) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 191 | ||||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 9e-09 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 2e-08 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 1e-07 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 4e-07 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 6e-07 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 7e-07 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 7e-07 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 8e-07 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 9e-07 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 1e-06 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 3e-06 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 3e-06 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 5e-06 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 7e-06 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 4e-05 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 4e-05 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 8e-05 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 1e-04 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 1e-04 |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
|
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 3e-19 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 4e-19 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 6e-19 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 7e-18 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 8e-18 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-17 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 1e-17 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 1e-17 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 2e-17 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 2e-17 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 2e-17 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 2e-17 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 2e-17 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 3e-17 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 5e-17 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 2e-16 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 2e-16 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 3e-16 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 4e-16 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 5e-16 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 8e-16 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 1e-15 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-15 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 4e-15 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 1e-13 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 1e-13 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 2e-13 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 8e-13 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-11 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 4e-10 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 6e-10 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 5e-06 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 4e-04 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 |
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
Score = 79.1 bits (195), Expect = 3e-19
Identities = 21/98 (21%), Positives = 42/98 (42%), Gaps = 8/98 (8%)
Query: 44 RASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPD--------IAGQKGHEHTLLLNE 95
KK++Y +LG AN ++K+ Y+KL YHPD ++ + + +++
Sbjct: 5 EQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQ 64
Query: 96 AYKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRSSW 133
A+K+L + +++YD + A
Sbjct: 65 AWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEM 102
|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.85 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.85 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.84 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.84 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.84 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.84 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.84 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.83 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.83 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.83 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.83 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.82 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.82 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.82 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.81 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.8 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.79 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.79 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.77 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.76 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.74 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.72 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.72 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.7 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.7 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.7 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.7 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.69 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.69 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.67 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.65 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.62 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.61 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 99.06 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.04 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 89.77 |
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.85 E-value=9.6e-22 Score=159.48 Aligned_cols=98 Identities=22% Similarity=0.361 Sum_probs=81.6
Q ss_pred CCCCCccccccc---cccccceeccCCCCCCCCCccCchhhcCCCCC--CCHHHHHHHHHHHHHHhCCCCCCCc------
Q 029583 17 NPNKSSLRARWG---QRCSVIRCCNGRAGERASKKKNYYELLGVSVE--ANGQEIKEAYRKLQKKYHPDIAGQK------ 85 (191)
Q Consensus 17 ~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~d~Y~iLgv~~~--a~~~~Ik~ayr~l~~~~HPDk~~~~------ 85 (191)
++...|+.|... .....++|..|...+++....|||+||||+++ ++.++||++||++++++|||+++..
T Consensus 8 ~~~~~Cw~C~~~~~~~~~~~~fC~~c~~~q~~~~~~d~y~lLgv~~~~~a~~~eIk~aYr~L~~~~HPDk~~~~~~~e~~ 87 (207)
T 3bvo_A 8 SNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKD 87 (207)
T ss_dssp ---CBCSSSCCBCCSSCSCCCBCTTTCCBCCCCTTCCHHHHTTSCSCSCCCHHHHHHHHHHHHHHHCGGGGTTSCHHHHH
T ss_pred CCCCCCCCCCCCcccccccccccccccccCCCCCCCCHHHHcCCCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCCHHHHH
Confidence 345566665543 45678999999999998888999999999986 7999999999999999999999753
Q ss_pred -hHHHHHHHHHHHHHhcCCCchhhhhhhhc
Q 029583 86 -GHEHTLLLNEAYKVLMRGDLRKDYDASIG 114 (191)
Q Consensus 86 -~~~~~~~I~~Ay~vL~d~~~R~~YD~~~~ 114 (191)
+.+.|++|++||++|+||.+|+.||..+.
T Consensus 88 ~a~~~f~~In~AY~vLsdp~~R~~Yd~~l~ 117 (207)
T 3bvo_A 88 FSEKHSTLVNDAYKTLLAPLSRGLYLLKLH 117 (207)
T ss_dssp HHHHHHHHHHHHHHHHHSHHHHHHHHHHHT
T ss_pred HHHHHHHHHHHHHHHHCCHHHHHHHHHHhc
Confidence 24578999999999999999999997543
|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 191 | ||||
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 2e-13 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 3e-13 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 1e-12 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-11 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 2e-11 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 1e-10 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 1e-09 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 2e-09 |
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 61.2 bits (148), Expect = 2e-13
Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 8/76 (10%)
Query: 44 RASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYH--------PDIAGQKGHEHTLLLNE 95
+ KK++Y +LG AN ++K+ Y+KL YH P ++ + + +++
Sbjct: 11 EQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQ 70
Query: 96 AYKVLMRGDLRKDYDA 111
A+K+L + +K YD
Sbjct: 71 AWKILGNEETKKKYDL 86
|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.87 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.84 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.8 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.73 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.72 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.65 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.62 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.87 E-value=1.1e-22 Score=138.39 Aligned_cols=65 Identities=42% Similarity=0.696 Sum_probs=60.7
Q ss_pred ccCchhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCC--chHHHHHHHHHHHHHhcCCCchhhhhhh
Q 029583 48 KKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQ--KGHEHTLLLNEAYKVLMRGDLRKDYDAS 112 (191)
Q Consensus 48 ~~d~Y~iLgv~~~a~~~~Ik~ayr~l~~~~HPDk~~~--~~~~~~~~I~~Ay~vL~d~~~R~~YD~~ 112 (191)
.+|||+||||+++||.++||+|||++++++|||+++. ..++.|..|++||+||+||.+|..||++
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~ 68 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQY 68 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHH
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHh
Confidence 4799999999999999999999999999999999874 3567899999999999999999999985
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|