Citrus Sinensis ID: 029599
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| 221327589 | 250 | ascorbate peroxidase 2 [Citrus maxima] | 1.0 | 0.764 | 1.0 | 1e-107 | |
| 300837175 | 250 | ascorbate peroxidase [Citrus limon] | 1.0 | 0.764 | 0.994 | 1e-106 | |
| 37783265 | 250 | ascorbate peroxidase [Ipomoea batatas] | 1.0 | 0.764 | 0.879 | 8e-95 | |
| 559005 | 250 | ascorbate peroxidase [Nicotiana tabacum] | 1.0 | 0.764 | 0.863 | 2e-93 | |
| 62910196 | 250 | cytosolic ascorbate peroxidase [Capsicum | 1.0 | 0.764 | 0.858 | 1e-92 | |
| 1389654 | 250 | cytosolic ascorbate peroxidase [Nicotian | 1.0 | 0.764 | 0.853 | 2e-92 | |
| 339777221 | 240 | ascorbate peroxidase [Dimocarpus longan] | 1.0 | 0.795 | 0.858 | 4e-92 | |
| 341865450 | 192 | ascorbate peroxidase [Nicotiana benthami | 1.0 | 0.994 | 0.853 | 6e-92 | |
| 90658814 | 250 | ascorbate peroxidase [Camellia sinensis] | 1.0 | 0.764 | 0.853 | 2e-91 | |
| 289467897 | 250 | L-ascorbate peroxidase [Bruguiera gymnor | 1.0 | 0.764 | 0.853 | 2e-91 |
| >gi|221327589|gb|ACM17464.1| ascorbate peroxidase 2 [Citrus maxima] | Back alignment and taxonomy information |
|---|
Score = 392 bits (1006), Expect = e-107, Method: Compositional matrix adjust.
Identities = 191/191 (100%), Positives = 191/191 (100%)
Query: 1 MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGR 60
MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGR
Sbjct: 60 MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGR 119
Query: 61 DDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPW 120
DDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPW
Sbjct: 120 DDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPW 179
Query: 121 TRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAH 180
TRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAH
Sbjct: 180 TRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAH 239
Query: 181 LKLSELGFAEA 191
LKLSELGFAEA
Sbjct: 240 LKLSELGFAEA 250
|
Source: Citrus maxima Species: Citrus maxima Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|300837175|gb|ADK38619.1| ascorbate peroxidase [Citrus limon] | Back alignment and taxonomy information |
|---|
| >gi|37783265|gb|AAP42501.1| ascorbate peroxidase [Ipomoea batatas] | Back alignment and taxonomy information |
|---|
| >gi|559005|gb|AAA86689.1| ascorbate peroxidase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|62910196|gb|AAY21068.1| cytosolic ascorbate peroxidase [Capsicum annuum] | Back alignment and taxonomy information |
|---|
| >gi|1389654|dbj|BAA12918.1| cytosolic ascorbate peroxidase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|339777221|gb|AEK05507.1| ascorbate peroxidase [Dimocarpus longan] | Back alignment and taxonomy information |
|---|
| >gi|341865450|dbj|BAK53858.1| ascorbate peroxidase [Nicotiana benthamiana] | Back alignment and taxonomy information |
|---|
| >gi|90658814|gb|ABD97259.1| ascorbate peroxidase [Camellia sinensis] | Back alignment and taxonomy information |
|---|
| >gi|289467897|gb|ADC95633.1| L-ascorbate peroxidase [Bruguiera gymnorhiza] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| TAIR|locus:2026616 | 250 | APX1 "ascorbate peroxidase 1" | 1.0 | 0.764 | 0.743 | 1.5e-74 | |
| TAIR|locus:2074914 | 251 | APX2 "ascorbate peroxidase 2" | 0.989 | 0.752 | 0.726 | 2.9e-71 | |
| TAIR|locus:2131586 | 287 | APX3 "ascorbate peroxidase 3" | 0.979 | 0.651 | 0.643 | 1.4e-57 | |
| TAIR|locus:2125409 | 279 | APX5 "ascorbate peroxidase 5" | 0.973 | 0.666 | 0.585 | 1.9e-51 | |
| ASPGD|ASPL0000029968 | 312 | AN5440 [Emericella nidulans (t | 0.717 | 0.439 | 0.545 | 4.6e-42 | |
| UNIPROTKB|A4R606 | 300 | MGG_10368 "Putative heme-bindi | 0.712 | 0.453 | 0.535 | 4e-37 | |
| UNIPROTKB|A4QVH4 | 362 | CCP1 "Cytochrome c peroxidase, | 0.968 | 0.511 | 0.427 | 7.2e-36 | |
| ASPGD|ASPL0000044163 | 361 | ccp1 [Emericella nidulans (tax | 0.722 | 0.382 | 0.507 | 3.6e-34 | |
| TAIR|locus:2204735 | 426 | TAPX "thylakoidal ascorbate pe | 0.633 | 0.284 | 0.535 | 9.1e-29 | |
| CGD|CAL0000335 | 291 | orf19.584 [Candida albicans (t | 0.706 | 0.463 | 0.460 | 2.2e-27 |
| TAIR|locus:2026616 APX1 "ascorbate peroxidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 752 (269.8 bits), Expect = 1.5e-74, P = 1.5e-74
Identities = 142/191 (74%), Positives = 157/191 (82%)
Query: 1 MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGR 60
MR AEQAH AN+G+ IA+RLL+P +EQFPTIS+AD +QLAGVV VEVTGGPDIPFHPGR
Sbjct: 60 MRFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGR 119
Query: 61 DDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPW 120
+DK +PP EGRLPDA +G DHLR VF QMGLSDKDIVALSG HTLGRCHK+RSGFEG W
Sbjct: 120 EDKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAW 179
Query: 121 TRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXH 180
T NPLIFDNSYF ELL+GEK+GLLQL SDKALLDDPVFRPLVEK H
Sbjct: 180 TSNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPLVEKYAADEDAFFADYAEAH 239
Query: 181 LKLSELGFAEA 191
+KLSELGFA+A
Sbjct: 240 MKLSELGFADA 250
|
|
| TAIR|locus:2074914 APX2 "ascorbate peroxidase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2131586 APX3 "ascorbate peroxidase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2125409 APX5 "ascorbate peroxidase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000029968 AN5440 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4R606 MGG_10368 "Putative heme-binding peroxidase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4QVH4 CCP1 "Cytochrome c peroxidase, mitochondrial" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000044163 ccp1 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204735 TAPX "thylakoidal ascorbate peroxidase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000335 orf19.584 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| cd00691 | 253 | cd00691, ascorbate_peroxidase, Ascorbate peroxidas | 1e-121 | |
| PLN02364 | 250 | PLN02364, PLN02364, L-ascorbate peroxidase 1 | 1e-112 | |
| PLN02608 | 289 | PLN02608, PLN02608, L-ascorbate peroxidase | 1e-109 | |
| PLN02879 | 251 | PLN02879, PLN02879, L-ascorbate peroxidase | 1e-107 | |
| cd00314 | 255 | cd00314, plant_peroxidase_like, Heme-dependent per | 1e-45 | |
| pfam00141 | 180 | pfam00141, peroxidase, Peroxidase | 3e-41 | |
| COG0376 | 730 | COG0376, KatG, Catalase (peroxidase I) [Inorganic | 8e-28 | |
| cd00693 | 298 | cd00693, secretory_peroxidase, Horseradish peroxid | 5e-27 | |
| cd00692 | 328 | cd00692, ligninase, Ligninase and other manganese- | 4e-17 | |
| cd00649 | 409 | cd00649, catalase_peroxidase_1, N-terminal catalyt | 3e-15 | |
| TIGR00198 | 716 | TIGR00198, cat_per_HPI, catalase/peroxidase HPI | 1e-13 | |
| PRK15061 | 726 | PRK15061, PRK15061, catalase/hydroperoxidase HPI(I | 6e-12 | |
| cd08201 | 264 | cd08201, plant_peroxidase_like_1, Uncharacterized | 1e-09 | |
| PLN03030 | 324 | PLN03030, PLN03030, cationic peroxidase; Provision | 3e-06 |
| >gnl|CDD|173825 cd00691, ascorbate_peroxidase, Ascorbate peroxidases and cytochrome C peroxidases | Back alignment and domain information |
|---|
Score = 341 bits (877), Expect = e-121
Identities = 128/198 (64%), Positives = 149/198 (75%), Gaps = 8/198 (4%)
Query: 1 MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGR 60
+R E H AN GLDIA +LLEP K+++P ISYADL+QLAGVV +E GGP IPF PGR
Sbjct: 57 IRFDPELNHGANAGLDIARKLLEPIKKKYPDISYADLWQLAGVVAIEEMGGPKIPFRPGR 116
Query: 61 DDKAEP---PQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFE 117
D ++P P EGRLPDA +G DHLR VF +MG +D++IVALSG HTLGRCHKERSG++
Sbjct: 117 VDASDPEECPPEGRLPDASKGADHLRDVFY-RMGFNDQEIVALSGAHTLGRCHKERSGYD 175
Query: 118 GPWTRNPLIFDNSYFTELLTGEKD----GLLQLPSDKALLDDPVFRPLVEKYAADEDAFF 173
GPWT+NPL FDNSYF ELL + GLL LP+DKALL+DP FRP VE YA D+DAFF
Sbjct: 176 GPWTKNPLKFDNSYFKELLEEDWKLPTPGLLMLPTDKALLEDPKFRPYVELYAKDQDAFF 235
Query: 174 ADYAEAHLKLSELGFAEA 191
DYAEAH KLSELG
Sbjct: 236 KDYAEAHKKLSELGVPFP 253
|
Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. Length = 253 |
| >gnl|CDD|166005 PLN02364, PLN02364, L-ascorbate peroxidase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|178218 PLN02608, PLN02608, L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178467 PLN02879, PLN02879, L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|173823 cd00314, plant_peroxidase_like, Heme-dependent peroxidases similar to plant peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|215745 pfam00141, peroxidase, Peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|223453 COG0376, KatG, Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173827 cd00693, secretory_peroxidase, Horseradish peroxidase and related secretory plant peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|173826 cd00692, ligninase, Ligninase and other manganese-dependent fungal peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|173824 cd00649, catalase_peroxidase_1, N-terminal catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|232870 TIGR00198, cat_per_HPI, catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >gnl|CDD|237891 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173829 cd08201, plant_peroxidase_like_1, Uncharacterized family of plant peroxidase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215545 PLN03030, PLN03030, cationic peroxidase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| PLN02879 | 251 | L-ascorbate peroxidase | 100.0 | |
| PLN02364 | 250 | L-ascorbate peroxidase 1 | 100.0 | |
| PLN02608 | 289 | L-ascorbate peroxidase | 100.0 | |
| cd00691 | 253 | ascorbate_peroxidase Ascorbate peroxidases and cyt | 100.0 | |
| PLN03030 | 324 | cationic peroxidase; Provisional | 100.0 | |
| cd00692 | 328 | ligninase Ligninase and other manganese-dependent | 100.0 | |
| cd00693 | 298 | secretory_peroxidase Horseradish peroxidase and re | 100.0 | |
| cd00649 | 409 | catalase_peroxidase_1 N-terminal catalytic domain | 100.0 | |
| cd00314 | 255 | plant_peroxidase_like Heme-dependent peroxidases s | 100.0 | |
| TIGR00198 | 716 | cat_per_HPI catalase/peroxidase HPI. Note that the | 100.0 | |
| PRK15061 | 726 | catalase/hydroperoxidase HPI(I); Provisional | 100.0 | |
| PF00141 | 230 | peroxidase: Peroxidase; InterPro: IPR002016 Peroxi | 100.0 | |
| cd08200 | 297 | catalase_peroxidase_2 C-terminal non-catalytic dom | 100.0 | |
| cd08201 | 264 | plant_peroxidase_like_1 Uncharacterized family of | 100.0 | |
| TIGR00198 | 716 | cat_per_HPI catalase/peroxidase HPI. Note that the | 100.0 | |
| PRK15061 | 726 | catalase/hydroperoxidase HPI(I); Provisional | 100.0 | |
| COG0376 | 730 | KatG Catalase (peroxidase I) [Inorganic ion transp | 100.0 | |
| COG0376 | 730 | KatG Catalase (peroxidase I) [Inorganic ion transp | 99.73 |
| >PLN02879 L-ascorbate peroxidase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-64 Score=423.33 Aligned_cols=189 Identities=79% Similarity=1.320 Sum_probs=184.4
Q ss_pred CCChhhhcCcCcCChHHHHHHHHHHHHhCCCCChHHHHHHhHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCChH
Q 029599 1 MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGND 80 (191)
Q Consensus 1 ir~~~E~~~~~N~gl~~~~~~i~~ik~~~~~VS~ADiialAa~~Av~~~ggP~~~v~~GR~D~~~~~~~~~lP~p~~~~~ 80 (191)
|||++|+++++|.||+.++++|++||+++++|||||||+|||++||+++|||.|+|++||+|+.+++++++||.|+.+++
T Consensus 61 irf~~E~~~~~N~gL~~~~~~i~~iK~~~~~VScADilalAa~~AV~~~GGP~~~~~~GR~D~~~~~~~~~lP~p~~~~~ 140 (251)
T PLN02879 61 IRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVD 140 (251)
T ss_pred ecChhhccCCCcCChHHHHHHHHHHHHHcCCcCHHHHHHHHHHHHHHhcCCCccCCCCCCCCCCCCCcccCCCCCCCCHH
Confidence 79999999999999988999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcCCCccchhhccCCccccccccCCCCCCCCCCCCCCccChHHHHHHhhccCCCcccccccccccCCCChHH
Q 029599 81 HLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRP 160 (191)
Q Consensus 81 ~~~~~F~~~~Gl~~~e~VaL~GaHtiG~~~~~~~~~~~~~~~tp~~fDn~Yy~~l~~~~~~gl~~l~sD~~L~~d~~t~~ 160 (191)
++++.| +++||+++|||||+||||||++||.++++.|+|+.||.+|||+||++|+.++.+|+++|+||++|+.|++|++
T Consensus 141 ~l~~~F-~~~Gl~~~dlVALsGaHTiG~ah~~r~g~~g~~d~tp~~FDN~Yy~~ll~~~~~gll~L~SD~aL~~D~~t~~ 219 (251)
T PLN02879 141 HLRDVF-GRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLP 219 (251)
T ss_pred HHHHHH-HHcCCCHHHHeeeeccccccccccccccCCCCCCCCccceeHHHHHHHHcCCcCCCccchhhHHHhcCCcHHH
Confidence 999999 9999999999999999999999999999999999999999999999999986689999999999999999999
Q ss_pred HHHHhhhCHHHHHHHHHHHHHHHHhCCCCC
Q 029599 161 LVEKYAADEDAFFADYAEAHLKLSELGFAE 190 (191)
Q Consensus 161 ~v~~~A~d~~~f~~~F~~am~Km~~~gv~~ 190 (191)
+|++||.|+++|+++|+.||+||+++|+.+
T Consensus 220 ~V~~~A~d~~~F~~~Fa~Am~KL~~lg~~~ 249 (251)
T PLN02879 220 FVEKYAADEDAFFEDYTEAHLKLSELGFAD 249 (251)
T ss_pred HHHHHhhCHHHHHHHHHHHHHHHHccCCCC
Confidence 999999999999999999999999999976
|
|
| >PLN02364 L-ascorbate peroxidase 1 | Back alignment and domain information |
|---|
| >PLN02608 L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >cd00691 ascorbate_peroxidase Ascorbate peroxidases and cytochrome C peroxidases | Back alignment and domain information |
|---|
| >PLN03030 cationic peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd00692 ligninase Ligninase and other manganese-dependent fungal peroxidases | Back alignment and domain information |
|---|
| >cd00693 secretory_peroxidase Horseradish peroxidase and related secretory plant peroxidases | Back alignment and domain information |
|---|
| >cd00649 catalase_peroxidase_1 N-terminal catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >cd00314 plant_peroxidase_like Heme-dependent peroxidases similar to plant peroxidases | Back alignment and domain information |
|---|
| >TIGR00198 cat_per_HPI catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >PRK15061 catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >PF00141 peroxidase: Peroxidase; InterPro: IPR002016 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions | Back alignment and domain information |
|---|
| >cd08200 catalase_peroxidase_2 C-terminal non-catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >cd08201 plant_peroxidase_like_1 Uncharacterized family of plant peroxidase-like proteins | Back alignment and domain information |
|---|
| >TIGR00198 cat_per_HPI catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >PRK15061 catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 191 | ||||
| 1apx_A | 249 | Crystal Structure Of Recombinant Ascorbate Peroxida | 1e-81 | ||
| 3zch_A | 261 | Ascorbate Peroxidase W41a-h42m Mutant Length = 261 | 1e-79 | ||
| 2ggn_X | 261 | Conformational Mobility In The Active Site Of A Hem | 2e-79 | ||
| 2vcs_A | 261 | Structure Of Isoniazid (Inh) Bound To Cytosolic Soy | 2e-79 | ||
| 3zcg_A | 261 | Ascorbate Peroxidase W41a-h42c Mutant Length = 261 | 2e-79 | ||
| 1oaf_A | 261 | Ascobate Peroxidase From Soybean Cytosol In Complex | 2e-79 | ||
| 3zcy_A | 249 | Ascorbate Peroxidase W41a-h42y Mutant Length = 249 | 2e-79 | ||
| 2vcf_X | 264 | Structure Of Isoniazid (Inh) Bound To Cytosolic Soy | 3e-79 | ||
| 2y6b_A | 249 | Ascorbate Peroxidase R38k Mutant Length = 249 | 3e-79 | ||
| 2xif_A | 249 | The Structure Of Ascorbate Peroxidase Compound Ii L | 3e-79 | ||
| 2y6a_A | 249 | Ascorbate Peroxidase R38a Mutant Length = 249 | 3e-79 | ||
| 2cl4_X | 261 | Ascorbate Peroxidase R172a Mutant Length = 261 | 1e-78 | ||
| 1iyn_A | 295 | Crystal Structure Of Chloroplastic Ascorbate Peroxi | 1e-36 | ||
| 3riv_A | 271 | The Crystal Structure Of Leishmania Major Peroxidas | 4e-35 | ||
| 4ged_A | 268 | Crystal Structure Of The Leishmania Major Peroxidas | 4e-35 | ||
| 3riw_A | 271 | The Crystal Structure Of Leishmania Major Peroxidas | 7e-34 | ||
| 1stq_A | 294 | Cyrstal Structure Of Cytochrome C Peroxidase Mutant | 8e-33 | ||
| 1jci_A | 294 | Stabilization Of The Engineered Cation-Binding Loop | 3e-32 | ||
| 1sog_A | 294 | Cyrstal Structure Of Cytochrome C Peroxidase Mutant | 4e-32 | ||
| 1jdr_A | 294 | Crystal Structure Of A Proximal Domain Potassium Bi | 3e-31 | ||
| 1krj_A | 294 | Engineering Calcium-Binding Site Into Cytochrome C | 8e-30 | ||
| 3m23_A | 291 | Crystallographic And Single Crystal Spectral Analys | 3e-28 | ||
| 4a71_A | 296 | Cytochrome C Peroxidase In Complex With Phenol Leng | 3e-28 | ||
| 2v2e_A | 294 | Structure Of Isoniazid (Inh) Bound To Cytochrome C | 3e-28 | ||
| 2v23_A | 296 | Structure Of Cytochrome C Peroxidase Mutant N184r Y | 3e-28 | ||
| 2xj5_A | 294 | The Structure Of Cytochrome C Peroxidase Compound I | 1e-27 | ||
| 3r98_A | 293 | Joint Neutron And X-Ray Structure Of Cytochrome C P | 1e-27 | ||
| 1mk8_A | 294 | Crystal Structure Of A Mutant Cytochrome C Peroxida | 1e-27 | ||
| 1kok_A | 294 | Crystal Structure Of Mesopone Cytochrome C Peroxida | 1e-27 | ||
| 2xil_A | 294 | The Structure Of Cytochrome C Peroxidase Compound I | 1e-27 | ||
| 1ebe_A | 294 | Laue Diffraction Study On The Structure Of Cytochro | 1e-27 | ||
| 4a78_A | 296 | Cytochrome C Peroxidase M119w In Complex With Guiac | 1e-27 | ||
| 3e2o_A | 294 | Crystal Structure Of Cytochrome C Peroxidase, N184r | 2e-27 | ||
| 1s6v_A | 294 | Structure Of A Cytochrome C Peroxidase-Cytochrome C | 2e-27 | ||
| 4a7m_A | 296 | Cytochrome C Peroxidase S81w Mutant Length = 296 | 2e-27 | ||
| 1cck_A | 291 | Altering Substrate Specificity Of Cytochrome C Pero | 3e-27 | ||
| 3e2n_A | 287 | Engineering Ascorbate Peroxidase Activity Into Cyto | 5e-27 | ||
| 2x07_A | 293 | Cytochrome C Peroxidase: Engineered Ascorbate Bindi | 5e-27 | ||
| 1a2f_A | 291 | Probing The Strength And Character Of An Asp-His-X | 7e-27 | ||
| 1dj1_A | 291 | Crystal Structure Of R48a Mutant Of Cytochrome C Pe | 8e-27 | ||
| 1cyf_A | 296 | Identifying The Physiological Electron Transfer Sit | 8e-27 | ||
| 2pcb_A | 296 | Crystal Structure Of A Complex Between Electron Tra | 8e-27 | ||
| 1cca_A | 297 | The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con | 8e-27 | ||
| 1a2g_A | 291 | Probing The Strength And Character Of An Asp-His-X | 8e-27 | ||
| 7ccp_A | 296 | Effect Of Arginine-48 Replacement On The Reaction B | 9e-27 | ||
| 6ccp_A | 296 | Effect Of Arginine-48 Replacement On The Reaction B | 9e-27 | ||
| 1bva_A | 294 | Manganese Binding Mutant In Cytochrome C Peroxidase | 9e-27 | ||
| 4ccp_A | 296 | X-Ray Structures Of Recombinant Yeast Cytochrome C | 9e-27 | ||
| 5ccp_A | 296 | Histidine 52 Is A Critical Residue For Rapid Format | 9e-27 | ||
| 1bep_A | 291 | Effect Of Unnatural Heme Substitution On Kinetics O | 9e-27 | ||
| 2gb8_A | 294 | Solution Structure Of The Complex Between Yeast Iso | 9e-27 | ||
| 2cep_A | 296 | Role Of Met-230 In Intramolecular Electron Transfer | 9e-27 | ||
| 1bek_A | 291 | Effect Of Unnatural Heme Substitution On Kinetics O | 1e-26 | ||
| 2ccp_A | 296 | X-Ray Structures Of Recombinant Yeast Cytochrome C | 2e-26 | ||
| 1ccb_A | 297 | The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con | 3e-26 | ||
| 4ccx_A | 294 | Altering Substrate Specificity At The Heme Edge Of | 3e-26 | ||
| 3ccx_A | 294 | Altering Substrate Specificity At The Heme Edge Of | 3e-26 | ||
| 1ccl_A | 291 | Probing The Strength And Character Of An Asp-His-X | 4e-26 | ||
| 1cci_A | 294 | How Flexible Are Proteins? Trapping Of A Flexible L | 5e-26 | ||
| 1ccc_A | 297 | The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con | 7e-26 | ||
| 2ia8_A | 291 | Kinetic And Crystallographic Studies Of A Redesigne | 7e-26 | ||
| 1beq_A | 291 | Interaction Between Proximal And Distals Regions Of | 1e-25 | ||
| 1ds4_A | 292 | Cytochrome C Peroxidase H175g Mutant, Imidazole Com | 1e-25 | ||
| 1cce_A | 291 | Construction Of A Bis-Aquo Heme Enzyme And Replacem | 1e-25 | ||
| 1dcc_A | 296 | 2.2 Angstrom Structure Of Oxyperoxidase: A Model Fo | 2e-25 | ||
| 1dse_A | 292 | Cytochrome C Peroxidase H175g Mutant, Imidazole Com | 3e-25 | ||
| 1cpg_A | 296 | A Cation Binding Motif Stabilizes The Compound I Ra | 4e-25 | ||
| 1bem_A | 291 | Interaction Between Proximal And Distals Regions Of | 5e-25 | ||
| 1cpd_A | 296 | A Cation Binding Motif Stabilizes The Compound I Ra | 5e-25 | ||
| 2aqd_A | 294 | Cytochrome C Peroxidase (Ccp) In Complex With 2,5- | 5e-25 | ||
| 2anz_A | 294 | Cytochrome C Peroxidase In Complex With 2,6-Diamino | 5e-25 | ||
| 2rbu_X | 292 | Cytochrome C Peroxidase In Complex With Cyclopentan | 6e-25 | ||
| 1bej_A | 291 | Interaction Between Proximal And Distals Regions Of | 6e-25 | ||
| 1cmu_A | 294 | The Role Of Aspartate-235 In The Binding Of Cations | 1e-24 | ||
| 1kxm_A | 290 | Crystal Structure Of Cytochrome C Peroxidase With A | 3e-24 | ||
| 3exb_A | 295 | Crystal Structure Of Cytochrome C Peroxidase With A | 3e-24 | ||
| 1kxn_A | 289 | Crystal Structure Of Cytochrome C Peroxidase With A | 3e-24 | ||
| 1mn1_A | 357 | Manganese Peroxidase Substrate Binding Site Mutant | 2e-13 | ||
| 1mn2_A | 357 | Manganese Peroxidase Substrate Binding Site Mutant | 2e-13 | ||
| 1yyd_A | 357 | High Resolution Crystal Structure Of Manganese Pero | 4e-13 | ||
| 3q3u_A | 338 | Trametes Cervina Lignin Peroxidase Length = 338 | 2e-09 | ||
| 3fm6_A | 331 | Crystal Structure Analysis Of Fungal Versatile Pero | 2e-08 | ||
| 3vlh_A | 737 | Crystal Structure Analysis Of The Arg409leu Variant | 3e-08 | ||
| 1ub2_A | 720 | Crystal Structure Of Catalase-Peroxidase From Synec | 3e-08 | ||
| 1itk_A | 731 | Crystal Structure Of Catalase-peroxidase From Haloa | 3e-08 | ||
| 4fef_A | 315 | The Crystal Structures Of Several Mutants Of Pleuro | 5e-08 | ||
| 3uw8_A | 737 | Crystal Structure Analysis Of The Ser305thr Variant | 6e-08 | ||
| 3vlk_A | 737 | Crystal Structure Analysis Of The Ser305ala Variant | 7e-08 | ||
| 4a5g_A | 308 | Raphanus Sativus Anionic Peroxidase. Length = 308 | 2e-07 | ||
| 3vlm_A | 737 | Crystal Structure Analysis Of The Met244ala Variant | 2e-07 | ||
| 1b80_A | 351 | Rec. Lignin Peroxidase H8 Oxidatively Processed Len | 1e-05 | ||
| 1mwv_A | 714 | Crystal Structure Of Catalase-peroxidase Katg Of Bu | 2e-05 | ||
| 2dv1_A | 748 | Crystal Structure Of D141e Mutant Of Bpkatg Length | 2e-05 | ||
| 2dv2_A | 748 | Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8 | 2e-05 | ||
| 1b82_A | 351 | Pristine Recomb. Lignin Peroxidase H8 Length = 351 | 2e-05 | ||
| 1b85_A | 351 | Lignin Peroxidase Length = 351 | 2e-05 | ||
| 3n3s_A | 748 | Crystal Structure Of The E198a Variant Of Burkholde | 2e-05 | ||
| 3n3r_A | 748 | Crystal Structure Of The E198a Variant Of Catalase- | 2e-05 | ||
| 1x7u_A | 748 | Crystal Structure Of The S324t Of Catalase-Peroxida | 2e-05 | ||
| 1fhf_A | 304 | The Structure Of Soybean Peroxidase Length = 304 | 2e-05 | ||
| 2fxg_A | 748 | Crystal Structure Of Katg At Ph 4.5 Length = 748 | 2e-05 | ||
| 3n3q_A | 748 | Crystal Structure Of The S324t Variant Of Burkholde | 2e-05 | ||
| 2fxj_A | 748 | Crystal Structure Of Katg At Ph 8.5 Length = 748 | 2e-05 | ||
| 3ut2_A | 764 | Crystal Structure Of Fungal Magkatg2 Length = 764 | 5e-05 | ||
| 1bgp_A | 309 | Crystal Structure Of Barley Grain Peroxidase 1 Leng | 6e-05 | ||
| 1pa2_A | 306 | Arabidopsis Thaliana Peroxidase A2 Length = 306 | 8e-05 | ||
| 1gx2_A | 309 | Recombinant Horseradish Peroxidase Phe209ser Comple | 1e-04 | ||
| 4atj_A | 309 | Distal Heme Pocket Mutant (H42e) Of Recombinant Hor | 1e-04 | ||
| 3atj_A | 309 | Heme Ligand Mutant Of Recombinant Horseradish Perox | 1e-04 | ||
| 1kzm_A | 308 | Distal Heme Pocket Mutant (r38s/h42e) Of Recombinan | 1e-04 | ||
| 6atj_A | 308 | Recombinant Horseradish Peroxidase C Complex With F | 2e-04 | ||
| 1w4w_A | 323 | Ferric Horseradish Peroxidase C1a In Complex With F | 2e-04 | ||
| 1atj_A | 306 | Recombinant Horseradish Peroxidase C1a Length = 306 | 2e-04 | ||
| 2atj_A | 308 | Recombinant Horseradish Peroxidase Complex With Ben | 2e-04 | ||
| 1gwo_A | 309 | Recombinant Horseradish Peroxidase C1a Ala170gln Le | 2e-04 | ||
| 1gwu_A | 309 | Recombinant Horseradish Peroxidase C1a Ala140gly Le | 2e-04 | ||
| 1gw2_A | 308 | Recombinant Horseradish Peroxidase C1a Thr171ser In | 4e-04 | ||
| 2ylj_A | 306 | Horse Radish Peroxidase, Mutant S167y Length = 306 | 8e-04 |
| >pdb|1APX|A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase Length = 249 | Back alignment and structure |
|
| >pdb|3ZCH|A Chain A, Ascorbate Peroxidase W41a-h42m Mutant Length = 261 | Back alignment and structure |
| >pdb|2GGN|X Chain X, Conformational Mobility In The Active Site Of A Heme Peroxidase Length = 261 | Back alignment and structure |
| >pdb|2VCS|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Mutant H42a Length = 261 | Back alignment and structure |
| >pdb|3ZCG|A Chain A, Ascorbate Peroxidase W41a-h42c Mutant Length = 261 | Back alignment and structure |
| >pdb|1OAF|A Chain A, Ascobate Peroxidase From Soybean Cytosol In Complex With Ascorbate Length = 261 | Back alignment and structure |
| >pdb|3ZCY|A Chain A, Ascorbate Peroxidase W41a-h42y Mutant Length = 249 | Back alignment and structure |
| >pdb|2VCF|X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Length = 264 | Back alignment and structure |
| >pdb|2Y6B|A Chain A, Ascorbate Peroxidase R38k Mutant Length = 249 | Back alignment and structure |
| >pdb|2XIF|A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii Length = 249 | Back alignment and structure |
| >pdb|2Y6A|A Chain A, Ascorbate Peroxidase R38a Mutant Length = 249 | Back alignment and structure |
| >pdb|2CL4|X Chain X, Ascorbate Peroxidase R172a Mutant Length = 261 | Back alignment and structure |
| >pdb|1IYN|A Chain A, Crystal Structure Of Chloroplastic Ascorbate Peroxidase From Tobacco Plants And Structural Insights For Its Instability Length = 295 | Back alignment and structure |
| >pdb|3RIV|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Length = 271 | Back alignment and structure |
| >pdb|4GED|A Chain A, Crystal Structure Of The Leishmania Major Peroxidase-Cytochrome C Complex Length = 268 | Back alignment and structure |
| >pdb|3RIW|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Mutant C197t Length = 271 | Back alignment and structure |
| >pdb|1STQ|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m3 Length = 294 | Back alignment and structure |
| >pdb|1JCI|A Chain A, Stabilization Of The Engineered Cation-Binding Loop In Cytochrome C Peroxidase (Ccp) Length = 294 | Back alignment and structure |
| >pdb|1SOG|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m2 Length = 294 | Back alignment and structure |
| >pdb|1JDR|A Chain A, Crystal Structure Of A Proximal Domain Potassium Binding Variant Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1KRJ|A Chain A, Engineering Calcium-Binding Site Into Cytochrome C Peroxidase (Ccp) Length = 294 | Back alignment and structure |
| >pdb|3M23|A Chain A, Crystallographic And Single Crystal Spectral Analysis Of The Peroxidase Ferryl Intermediate Length = 291 | Back alignment and structure |
| >pdb|4A71|A Chain A, Cytochrome C Peroxidase In Complex With Phenol Length = 296 | Back alignment and structure |
| >pdb|2V2E|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytochrome C Peroxidase Mutant N184r Y36a Length = 294 | Back alignment and structure |
| >pdb|2V23|A Chain A, Structure Of Cytochrome C Peroxidase Mutant N184r Y36a Length = 296 | Back alignment and structure |
| >pdb|2XJ5|A Chain A, The Structure Of Cytochrome C Peroxidase Compound Ii Length = 294 | Back alignment and structure |
| >pdb|3R98|A Chain A, Joint Neutron And X-Ray Structure Of Cytochrome C Peroxidase Length = 293 | Back alignment and structure |
| >pdb|1MK8|A Chain A, Crystal Structure Of A Mutant Cytochrome C Peroxidase Showing A Novel Trp-Tyr Covalent Cross-Link Length = 294 | Back alignment and structure |
| >pdb|1KOK|A Chain A, Crystal Structure Of Mesopone Cytochrome C Peroxidase (Mpccp) Length = 294 | Back alignment and structure |
| >pdb|2XIL|A Chain A, The Structure Of Cytochrome C Peroxidase Compound I Length = 294 | Back alignment and structure |
| >pdb|1EBE|A Chain A, Laue Diffraction Study On The Structure Of Cytochrome C Peroxidase Compound I Length = 294 | Back alignment and structure |
| >pdb|4A78|A Chain A, Cytochrome C Peroxidase M119w In Complex With Guiacol Length = 296 | Back alignment and structure |
| >pdb|3E2O|A Chain A, Crystal Structure Of Cytochrome C Peroxidase, N184r Mutant Length = 294 | Back alignment and structure |
| >pdb|1S6V|A Chain A, Structure Of A Cytochrome C Peroxidase-Cytochrome C Site Specific Cross-Link Length = 294 | Back alignment and structure |
| >pdb|4A7M|A Chain A, Cytochrome C Peroxidase S81w Mutant Length = 296 | Back alignment and structure |
| >pdb|1CCK|A Chain A, Altering Substrate Specificity Of Cytochrome C Peroxidase Towards A Small Molecular Substrate Peroxidase By Substituting Tyrosine For Phe 202 Length = 291 | Back alignment and structure |
| >pdb|3E2N|A Chain A, Engineering Ascorbate Peroxidase Activity Into Cytochrome C Peroxidase Length = 287 | Back alignment and structure |
| >pdb|2X07|A Chain A, Cytochrome C Peroxidase: Engineered Ascorbate Binding Site Length = 293 | Back alignment and structure |
| >pdb|1A2F|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 | Back alignment and structure |
| >pdb|1DJ1|A Chain A, Crystal Structure Of R48a Mutant Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1CYF|A Chain A, Identifying The Physiological Electron Transfer Site Of Cytochrome C Peroxidase By Structure-Based Engineering Length = 296 | Back alignment and structure |
| >pdb|2PCB|A Chain A, Crystal Structure Of A Complex Between Electron Transfer Partners, Cytochrome C Peroxidase And Cytochrome C Length = 296 | Back alignment and structure |
| >pdb|1CCA|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 | Back alignment and structure |
| >pdb|1A2G|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 | Back alignment and structure |
| >pdb|7CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 | Back alignment and structure |
| >pdb|6CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 | Back alignment and structure |
| >pdb|1BVA|A Chain A, Manganese Binding Mutant In Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|4CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 | Back alignment and structure |
| >pdb|5CCP|A Chain A, Histidine 52 Is A Critical Residue For Rapid Formation Of Cytochrome C Peroxidase Compound I Length = 296 | Back alignment and structure |
| >pdb|1BEP|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|2GB8|A Chain A, Solution Structure Of The Complex Between Yeast Iso-1- Cytochrome C And Yeast Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|2CEP|A Chain A, Role Of Met-230 In Intramolecular Electron Transfer Between The Oxyferryl Heme And Trp 191 In Cytochrome C Peroxidase Compound Ii Length = 296 | Back alignment and structure |
| >pdb|1BEK|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|2CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 | Back alignment and structure |
| >pdb|1CCB|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 | Back alignment and structure |
| >pdb|4CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|3CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1CCL|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 | Back alignment and structure |
| >pdb|1CCI|A Chain A, How Flexible Are Proteins? Trapping Of A Flexible Loop Length = 294 | Back alignment and structure |
| >pdb|1CCC|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 | Back alignment and structure |
| >pdb|2IA8|A Chain A, Kinetic And Crystallographic Studies Of A Redesigned Manganese-Binding Site In Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1BEQ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1DS4|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, Ph 6, 100k Length = 292 | Back alignment and structure |
| >pdb|1CCE|A Chain A, Construction Of A Bis-Aquo Heme Enzyme And Replacement With Exogenous Ligand Length = 291 | Back alignment and structure |
| >pdb|1DCC|A Chain A, 2.2 Angstrom Structure Of Oxyperoxidase: A Model For The Enzyme:peroxide Complex Length = 296 | Back alignment and structure |
| >pdb|1DSE|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, With Phosphate Bound, Ph 6, 100k Length = 292 | Back alignment and structure |
| >pdb|1CPG|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 | Back alignment and structure |
| >pdb|1BEM|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1CPD|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 | Back alignment and structure |
| >pdb|2AQD|A Chain A, Cytochrome C Peroxidase (Ccp) In Complex With 2,5- Diaminopyridine Length = 294 | Back alignment and structure |
| >pdb|2ANZ|A Chain A, Cytochrome C Peroxidase In Complex With 2,6-Diaminopyridine Length = 294 | Back alignment and structure |
| >pdb|2RBU|X Chain X, Cytochrome C Peroxidase In Complex With Cyclopentane-Carboximidamide Length = 292 | Back alignment and structure |
| >pdb|1BEJ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1CMU|A Chain A, The Role Of Aspartate-235 In The Binding Of Cations To An Artificial Cavity At The Radical Site Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1KXM|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 290 | Back alignment and structure |
| >pdb|3EXB|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Pathway Excised In A Complex With A Peptide Wire Length = 295 | Back alignment and structure |
| >pdb|1KXN|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 289 | Back alignment and structure |
| >pdb|1MN1|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant D179n Length = 357 | Back alignment and structure |
| >pdb|1MN2|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant E35q, D179n Length = 357 | Back alignment and structure |
| >pdb|1YYD|A Chain A, High Resolution Crystal Structure Of Manganese Peroxidase Length = 357 | Back alignment and structure |
| >pdb|3Q3U|A Chain A, Trametes Cervina Lignin Peroxidase Length = 338 | Back alignment and structure |
| >pdb|3FM6|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 | Back alignment and structure |
| >pdb|3VLH|A Chain A, Crystal Structure Analysis Of The Arg409leu Variants Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|1UB2|A Chain A, Crystal Structure Of Catalase-Peroxidase From Synechococcus Pcc 7942 Length = 720 | Back alignment and structure |
| >pdb|1ITK|A Chain A, Crystal Structure Of Catalase-peroxidase From Haloarcula Marismortui Length = 731 | Back alignment and structure |
| >pdb|4FEF|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 315 | Back alignment and structure |
| >pdb|3UW8|A Chain A, Crystal Structure Analysis Of The Ser305thr Variants Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|3VLK|A Chain A, Crystal Structure Analysis Of The Ser305ala Variant Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|4A5G|A Chain A, Raphanus Sativus Anionic Peroxidase. Length = 308 | Back alignment and structure |
| >pdb|3VLM|A Chain A, Crystal Structure Analysis Of The Met244ala Variant Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|1B80|A Chain A, Rec. Lignin Peroxidase H8 Oxidatively Processed Length = 351 | Back alignment and structure |
| >pdb|1MWV|A Chain A, Crystal Structure Of Catalase-peroxidase Katg Of Burkholderia Pseudomallei Length = 714 | Back alignment and structure |
| >pdb|2DV1|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg Length = 748 | Back alignment and structure |
| >pdb|2DV2|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8.0 Length = 748 | Back alignment and structure |
| >pdb|1B82|A Chain A, Pristine Recomb. Lignin Peroxidase H8 Length = 351 | Back alignment and structure |
| >pdb|1B85|A Chain A, Lignin Peroxidase Length = 351 | Back alignment and structure |
| >pdb|3N3S|A Chain A, Crystal Structure Of The E198a Variant Of Burkholderia Pseudomallei Catalase-Peroxidase Katg With Inh Length = 748 | Back alignment and structure |
| >pdb|3N3R|A Chain A, Crystal Structure Of The E198a Variant Of Catalase-Peroxidase Katg Of Burkholderia Pseudomallei Length = 748 | Back alignment and structure |
| >pdb|1X7U|A Chain A, Crystal Structure Of The S324t Of Catalase-Peroxidase Katg Length = 748 | Back alignment and structure |
| >pdb|1FHF|A Chain A, The Structure Of Soybean Peroxidase Length = 304 | Back alignment and structure |
| >pdb|2FXG|A Chain A, Crystal Structure Of Katg At Ph 4.5 Length = 748 | Back alignment and structure |
| >pdb|3N3Q|A Chain A, Crystal Structure Of The S324t Variant Of Burkholderia Pseudomallei Katg With Isonicotinic Acid Hydrazide Bound Length = 748 | Back alignment and structure |
| >pdb|2FXJ|A Chain A, Crystal Structure Of Katg At Ph 8.5 Length = 748 | Back alignment and structure |
| >pdb|3UT2|A Chain A, Crystal Structure Of Fungal Magkatg2 Length = 764 | Back alignment and structure |
| >pdb|1BGP|A Chain A, Crystal Structure Of Barley Grain Peroxidase 1 Length = 309 | Back alignment and structure |
| >pdb|1PA2|A Chain A, Arabidopsis Thaliana Peroxidase A2 Length = 306 | Back alignment and structure |
| >pdb|1GX2|A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid Length = 309 | Back alignment and structure |
| >pdb|4ATJ|A Chain A, Distal Heme Pocket Mutant (H42e) Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 | Back alignment and structure |
| >pdb|3ATJ|A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 | Back alignment and structure |
| >pdb|1KZM|A Chain A, Distal Heme Pocket Mutant (r38s/h42e) Of Recombinant Horseradish Peroxidase C (hrp C) Length = 308 | Back alignment and structure |
| >pdb|6ATJ|A Chain A, Recombinant Horseradish Peroxidase C Complex With Ferulic Acid Length = 308 | Back alignment and structure |
| >pdb|1W4W|A Chain A, Ferric Horseradish Peroxidase C1a In Complex With Formate Length = 323 | Back alignment and structure |
| >pdb|1ATJ|A Chain A, Recombinant Horseradish Peroxidase C1a Length = 306 | Back alignment and structure |
| >pdb|2ATJ|A Chain A, Recombinant Horseradish Peroxidase Complex With Benzhydroxamic Acid Length = 308 | Back alignment and structure |
| >pdb|1GWO|A Chain A, Recombinant Horseradish Peroxidase C1a Ala170gln Length = 309 | Back alignment and structure |
| >pdb|1GWU|A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly Length = 309 | Back alignment and structure |
| >pdb|1GW2|A Chain A, Recombinant Horseradish Peroxidase C1a Thr171ser In Complex With Ferulic Acid Length = 308 | Back alignment and structure |
| >pdb|2YLJ|A Chain A, Horse Radish Peroxidase, Mutant S167y Length = 306 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| 3riv_A | 271 | Ascorbate peroxidase; alpha helical bundle, heme p | 1e-108 | |
| 2vcn_A | 261 | Ascorbate peroxidase; INH, APX, isoniazid, oxidore | 1e-101 | |
| 3e2o_A | 294 | CCP, cytochrome C peroxidase; cytochrome C peroxid | 1e-100 | |
| 1iyn_A | 295 | Chloroplastic ascorbate peroxidase; hydrogen perox | 4e-97 | |
| 3m5q_A | 357 | Manganese peroxidase 1; heme, Mn(II)-binding site, | 3e-82 | |
| 3q3u_A | 338 | Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A | 4e-82 | |
| 1llp_A | 343 | LIP4.15, lignin peroxidase; heme protein, glyco pr | 3e-81 | |
| 3fmu_A | 331 | VersatIle peroxidase VPL2; class II (fungal) perox | 1e-80 | |
| 2e39_A | 344 | Peroxidase; heme protein, coordination geometry of | 3e-79 | |
| 3rrw_A | 268 | Thylakoid lumenal 29 kDa protein, chloroplastic; c | 2e-50 | |
| 1sch_A | 294 | PNP, peanut peroxidase, major cationic isozyme; ca | 8e-26 | |
| 1bgp_A | 309 | Barley grain peroxidase; chromoprotein, oxidoreduc | 3e-25 | |
| 3hdl_A | 304 | Royal PALM TREE peroxidase; glycosylated, oxidored | 2e-24 | |
| 1qgj_A | 300 | Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A | 2e-24 | |
| 1fhf_A | 304 | SEED coat peroxidase; oxidoreductase; HET: HEM; 2. | 5e-24 | |
| 1pa2_A | 306 | Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 | 5e-23 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 5e-23 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 2e-06 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 5e-23 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 3e-22 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 5e-07 | |
| 1gwu_A | 309 | Peroxidase C1A; oxidoreductase, glycoprotein, heme | 4e-22 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 2e-21 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 1e-06 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 4e-21 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 4e-05 | |
| 1u2k_A | 309 | Peroxidase/catalase HPI; KATG, catalase-peroxidase | 3e-06 |
| >3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* Length = 271 | Back alignment and structure |
|---|
Score = 310 bits (796), Expect = e-108
Identities = 91/206 (44%), Positives = 118/206 (57%), Gaps = 20/206 (9%)
Query: 1 MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGR 60
MR E ++ N GLDI + LE K+++P ISYADL+ LA V +E GGP IPF GR
Sbjct: 55 MRFKPECLYAGNKGLDIPRKALETLKKKYPQISYADLWVLAAYVAIEYMGGPTIPFCWGR 114
Query: 61 DDKAEP---PQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFE 117
D + +GRLPD + H+R+VF ++G +D++ VAL G HT G CH E SG+
Sbjct: 115 VDAKDGSVCGPDGRLPDGSKTQSHVREVFR-RLGFNDQETVALIGAHTCGECHIEFSGYH 173
Query: 118 GPWTRNPLIFDNSYFTELLTGE----------------KDGLLQLPSDKALLDDPVFRPL 161
GPWT + FDNS+FT+LL + L+ LPSD LL DP +R
Sbjct: 174 GPWTHDKNGFDNSFFTQLLDEDWVLNPKVEQMQLMDRATTKLMMLPSDVCLLLDPSYRKY 233
Query: 162 VEKYAADEDAFFADYAEAHLKLSELG 187
VE YA D D F D+A A KL+ELG
Sbjct: 234 VELYAKDNDRFNKDFANAFKKLTELG 259
|
| >2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Length = 261 | Back alignment and structure |
|---|
| >3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} PDB: 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* 1mk8_A* 1mkq_A* ... Length = 294 | Back alignment and structure |
|---|
| >1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Length = 295 | Back alignment and structure |
|---|
| >3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Length = 357 | Back alignment and structure |
|---|
| >3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} Length = 338 | Back alignment and structure |
|---|
| >1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Length = 343 | Back alignment and structure |
|---|
| >3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* Length = 331 | Back alignment and structure |
|---|
| >2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Length = 344 | Back alignment and structure |
|---|
| >3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} Length = 268 | Back alignment and structure |
|---|
| >1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Length = 294 | Back alignment and structure |
|---|
| >1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Length = 309 | Back alignment and structure |
|---|
| >3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} Length = 304 | Back alignment and structure |
|---|
| >1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Length = 300 | Back alignment and structure |
|---|
| >1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Length = 304 | Back alignment and structure |
|---|
| >1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Length = 306 | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Length = 748 | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 | Back alignment and structure |
|---|
| >1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Length = 309 | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 | Back alignment and structure |
|---|
| >1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A Length = 309 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| 2vcn_A | 261 | Ascorbate peroxidase; INH, APX, isoniazid, oxidore | 100.0 | |
| 1iyn_A | 295 | Chloroplastic ascorbate peroxidase; hydrogen perox | 100.0 | |
| 3riv_A | 271 | Ascorbate peroxidase; alpha helical bundle, heme p | 100.0 | |
| 3e2o_A | 294 | CCP, cytochrome C peroxidase; cytochrome C peroxid | 100.0 | |
| 3hdl_A | 304 | Royal PALM TREE peroxidase; glycosylated, oxidored | 100.0 | |
| 1sch_A | 294 | PNP, peanut peroxidase, major cationic isozyme; ca | 100.0 | |
| 1fhf_A | 304 | SEED coat peroxidase; oxidoreductase; HET: HEM; 2. | 100.0 | |
| 1pa2_A | 306 | Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 | 100.0 | |
| 1gwu_A | 309 | Peroxidase C1A; oxidoreductase, glycoprotein, heme | 100.0 | |
| 1bgp_A | 309 | Barley grain peroxidase; chromoprotein, oxidoreduc | 100.0 | |
| 1qgj_A | 300 | Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A | 100.0 | |
| 3fmu_A | 331 | VersatIle peroxidase VPL2; class II (fungal) perox | 100.0 | |
| 3m5q_A | 357 | Manganese peroxidase 1; heme, Mn(II)-binding site, | 100.0 | |
| 3q3u_A | 338 | Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A | 100.0 | |
| 1u2k_A | 309 | Peroxidase/catalase HPI; KATG, catalase-peroxidase | 100.0 | |
| 2e39_A | 344 | Peroxidase; heme protein, coordination geometry of | 100.0 | |
| 1llp_A | 343 | LIP4.15, lignin peroxidase; heme protein, glyco pr | 100.0 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 100.0 | |
| 3vli_A | 737 | Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 | 100.0 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 100.0 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 100.0 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 100.0 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 100.0 | |
| 3vli_A | 737 | Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 | 100.0 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 100.0 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 100.0 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 100.0 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 100.0 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 100.0 | |
| 3rrw_A | 268 | Thylakoid lumenal 29 kDa protein, chloroplastic; c | 100.0 |
| >2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=8.7e-65 Score=426.71 Aligned_cols=191 Identities=82% Similarity=1.343 Sum_probs=184.9
Q ss_pred CCChhhhcCcCcCChHHHHHHHHHHHHhCCCCChHHHHHHhHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCChH
Q 029599 1 MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGND 80 (191)
Q Consensus 1 ir~~~E~~~~~N~gl~~~~~~i~~ik~~~~~VS~ADiialAa~~Av~~~ggP~~~v~~GR~D~~~~~~~~~lP~p~~~~~ 80 (191)
|||++|+++++|.||.+++++|++||+++++|||||||+||||+||+++|||.|+|++||+|++++.++++||.|+.+++
T Consensus 71 i~~~~E~~~~~N~~l~~g~~~i~~iK~~~~~VScADilalAardaV~~~GGP~~~v~~GRrD~~~s~~~~~lP~p~~~~~ 150 (261)
T 2vcn_A 71 IKHPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSD 150 (261)
T ss_dssp GGSHHHHTSGGGTTHHHHHHHHHHHHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHH
T ss_pred ccchhhccCccccCHHHHHHHHHHHHHHhCCCCHHHHHHHHhhhheeeccCCcccCcCCCCCCCCCCcccccCCcccCHH
Confidence 68899999999999988999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcCCCccchhhccCCccccccccCCCCCCCCCCCCCCccChHHHHHHhhccCCCcccccccccccCCCChHH
Q 029599 81 HLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRP 160 (191)
Q Consensus 81 ~~~~~F~~~~Gl~~~e~VaL~GaHtiG~~~~~~~~~~~~~~~tp~~fDn~Yy~~l~~~~~~gl~~l~sD~~L~~d~~t~~ 160 (191)
++++.|++++||+++|||||+||||||.+||.+++|.|+|+.||.+|||+||++|+.++.+|+++|+||++|+.|++|++
T Consensus 151 ~l~~~F~~~~Gl~~~d~VaLsGaHTiG~ahc~r~~f~g~~~~tp~~FDN~Yy~~Ll~~~~~gll~L~SD~~L~~d~~t~~ 230 (261)
T 2vcn_A 151 HLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRP 230 (261)
T ss_dssp HHHHHHTTTTCCCHHHHHHHHGGGGSCEECTTTTSCCEESSSCTTSCSTHHHHHHHHCCCTTCCCCHHHHHHHHCTTHHH
T ss_pred HHHHHHHhhCCCChHHheeeccCcccccccccCCCCCCCCCCcccccchHHHHHhhccCcCCcccchhhHHHhcCccHHH
Confidence 99999977999999999999999999999999999999999999999999999999986679998899999999999999
Q ss_pred HHHHhhhCHHHHHHHHHHHHHHHHhCCCCCC
Q 029599 161 LVEKYAADEDAFFADYAEAHLKLSELGFAEA 191 (191)
Q Consensus 161 ~v~~~A~d~~~f~~~F~~am~Km~~~gv~~~ 191 (191)
+|+.||.|++.|+++|++||+||+++|+++.
T Consensus 231 ~V~~ya~~~~~F~~~Fa~Am~Km~~lg~~~~ 261 (261)
T 2vcn_A 231 LVDKYAADEDAFFADYAEAHQKLSELGFADA 261 (261)
T ss_dssp HHHHHHHCHHHHHHHHHHHHHHHHTTTSSCC
T ss_pred HHHHHhhCHHHHHHHHHHHHHHHHhcCCCCC
Confidence 9999999999999999999999999999984
|
| >1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* 4ged_A* | Back alignment and structure |
|---|
| >3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} SCOP: a.93.1.1 PDB: 4a71_A* 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 4a6z_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* ... | Back alignment and structure |
|---|
| >3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} SCOP: a.93.1.0 | Back alignment and structure |
|---|
| >1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* | Back alignment and structure |
|---|
| >1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... | Back alignment and structure |
|---|
| >1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* 4fcn_A* 4g05_A* 4fcs_A* 4fef_A* 4fdq_A* | Back alignment and structure |
|---|
| >3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* | Back alignment and structure |
|---|
| >3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} SCOP: a.93.1.0 | Back alignment and structure |
|---|
| >1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A | Back alignment and structure |
|---|
| >2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* | Back alignment and structure |
|---|
| >1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* | Back alignment and structure |
|---|
| >3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* | Back alignment and structure |
|---|
| >3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 191 | ||||
| d1oafa_ | 250 | a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glyci | 2e-65 | |
| d1yyda1 | 357 | a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) { | 2e-52 | |
| d2euta1 | 291 | a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {B | 9e-52 | |
| d2e39a1 | 336 | a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) { | 2e-50 | |
| d1llpa_ | 343 | a.93.1.1 (A:) Fungal peroxidase (ligninase) {White | 9e-50 | |
| d1iyna_ | 275 | a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco | 2e-47 | |
| d1pa2a_ | 306 | a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A | 1e-44 | |
| d1gwua_ | 307 | a.93.1.1 (A:) Plant peroxidase {Horseradish (Armor | 2e-41 | |
| d1qgja_ | 300 | a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A | 2e-40 | |
| d1fhfa_ | 304 | a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine m | 3e-40 | |
| d1bgpa_ | 309 | a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vu | 3e-39 | |
| d1scha_ | 294 | a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hy | 4e-39 | |
| d1mwva1 | 406 | a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burk | 3e-34 | |
| d1ub2a1 | 406 | a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Syne | 4e-33 | |
| d1itka1 | 406 | a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Arch | 5e-33 | |
| d2ccaa1 | 410 | a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Myco | 2e-32 | |
| d1u2ka_ | 292 | a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholder | 4e-29 | |
| d1ub2a2 | 294 | a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Syn | 1e-26 | |
| d1itka2 | 308 | a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Arc | 3e-26 | |
| d1mwva2 | 308 | a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Bur | 2e-24 | |
| d2ccaa2 | 285 | a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Myc | 4e-20 |
| >d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 250 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme-dependent peroxidases superfamily: Heme-dependent peroxidases family: CCP-like domain: Ascorbate peroxidase species: Soybean (Glycine max) [TaxId: 3847]
Score = 199 bits (507), Expect = 2e-65
Identities = 156/191 (81%), Positives = 172/191 (90%)
Query: 1 MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGR 60
++ AE AHSANNGLDIAVRLLEP K +FP +SYAD YQLAGVV VEVTGGP++PFHPGR
Sbjct: 60 IKHPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGR 119
Query: 61 DDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPW 120
+DK EPP EGRLPDA +G+DHLR VFG MGL+D+DIVALSGGHT+G HKERSGFEGPW
Sbjct: 120 EDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPW 179
Query: 121 TRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAH 180
T NPLIFDNSYFTELL+GEK+GLLQLPSDKALL DPVFRPLV+KYAADEDAFFADYAEAH
Sbjct: 180 TSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPLVDKYAADEDAFFADYAEAH 239
Query: 181 LKLSELGFAEA 191
KLSELGFA+A
Sbjct: 240 QKLSELGFADA 250
|
| >d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 357 | Back information, alignment and structure |
|---|
| >d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 291 | Back information, alignment and structure |
|---|
| >d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Length = 336 | Back information, alignment and structure |
|---|
| >d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 343 | Back information, alignment and structure |
|---|
| >d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 275 | Back information, alignment and structure |
|---|
| >d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Length = 306 | Back information, alignment and structure |
|---|
| >d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Length = 307 | Back information, alignment and structure |
|---|
| >d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Length = 300 | Back information, alignment and structure |
|---|
| >d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 304 | Back information, alignment and structure |
|---|
| >d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Length = 309 | Back information, alignment and structure |
|---|
| >d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 294 | Back information, alignment and structure |
|---|
| >d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 406 | Back information, alignment and structure |
|---|
| >d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 406 | Back information, alignment and structure |
|---|
| >d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 406 | Back information, alignment and structure |
|---|
| >d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 410 | Back information, alignment and structure |
|---|
| >d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 292 | Back information, alignment and structure |
|---|
| >d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 294 | Back information, alignment and structure |
|---|
| >d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 308 | Back information, alignment and structure |
|---|
| >d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 308 | Back information, alignment and structure |
|---|
| >d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 285 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| d1oafa_ | 250 | Ascorbate peroxidase {Soybean (Glycine max) [TaxId | 100.0 | |
| d1iyna_ | 275 | Ascorbate peroxidase {Common tobacco (Nicotiana ta | 100.0 | |
| d2euta1 | 291 | Cytochrome c peroxidase, CCP {Baker's yeast (Sacch | 100.0 | |
| d1fhfa_ | 304 | Plant peroxidase {Soybean (Glycine max) [TaxId: 38 | 100.0 | |
| d1pa2a_ | 306 | Plant peroxidase {Mouse-ear cress (Arabidopsis tha | 100.0 | |
| d1yyda1 | 357 | Fungal peroxidase (ligninase) {Basidomycetos fungu | 100.0 | |
| d2e39a1 | 336 | Fungal peroxidase (ligninase) {Arthromyces ramosus | 100.0 | |
| d1llpa_ | 343 | Fungal peroxidase (ligninase) {White rot basidiomy | 100.0 | |
| d1qgja_ | 300 | Plant peroxidase {Mouse-ear cress (Arabidopsis tha | 100.0 | |
| d1bgpa_ | 309 | Plant peroxidase {Barley (Hordeum vulgare), peroxi | 100.0 | |
| d1scha_ | 294 | Plant peroxidase {Peanut (Arachis hypogaea) [TaxId | 100.0 | |
| d1gwua_ | 307 | Plant peroxidase {Horseradish (Armoracia rusticana | 100.0 | |
| d1itka1 | 406 | Catalase-peroxidase KatG {Archaeon Haloarcula mari | 100.0 | |
| d1mwva1 | 406 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 100.0 | |
| d1mwva2 | 308 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 100.0 | |
| d1u2ka_ | 292 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 100.0 | |
| d2ccaa1 | 410 | Catalase-peroxidase KatG {Mycobacterium tuberculos | 100.0 | |
| d1ub2a2 | 294 | Catalase-peroxidase KatG {Synechococcus sp. pcc 79 | 100.0 | |
| d1ub2a1 | 406 | Catalase-peroxidase KatG {Synechococcus sp. pcc 79 | 100.0 | |
| d1itka2 | 308 | Catalase-peroxidase KatG {Archaeon Haloarcula mari | 100.0 | |
| d2ccaa2 | 285 | Catalase-peroxidase KatG {Mycobacterium tuberculos | 100.0 |
| >d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme-dependent peroxidases superfamily: Heme-dependent peroxidases family: CCP-like domain: Ascorbate peroxidase species: Soybean (Glycine max) [TaxId: 3847]
Probab=100.00 E-value=2.2e-61 Score=402.81 Aligned_cols=190 Identities=82% Similarity=1.340 Sum_probs=183.5
Q ss_pred CCChhhhcCcCcCChHHHHHHHHHHHHhCCCCChHHHHHHhHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCChH
Q 029599 1 MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGND 80 (191)
Q Consensus 1 ir~~~E~~~~~N~gl~~~~~~i~~ik~~~~~VS~ADiialAa~~Av~~~ggP~~~v~~GR~D~~~~~~~~~lP~p~~~~~ 80 (191)
|++.+|+++++|.||+.+.++++++|++||.|||||||+|||++||+++|||.|+|++||+|+..+.+++.+|.|+.+++
T Consensus 60 ~~~~~E~~~~~N~Gl~~i~~~~~~~~~~~p~VS~ADiialAa~~Av~~~GGp~~~~~~GR~D~~~~~~~g~~P~p~~~~~ 139 (250)
T d1oafa_ 60 IKHPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSD 139 (250)
T ss_dssp GGSHHHHTSGGGTTHHHHHHHHHHHHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHH
T ss_pred cccccccccccccCHHHHHHHHHHHHhccCcccHHHHHHHHHHHHHHhcCCceeccCCCCccccCCCCcccCCChHHHHH
Confidence 57889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHH-hcCCCccchhhccCCccccccccCCCCCCCCCCCCCCccChHHHHHHhhccCCCcccccccccccCCCChH
Q 029599 81 HLRQVFGA-QMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFR 159 (191)
Q Consensus 81 ~~~~~F~~-~~Gl~~~e~VaL~GaHtiG~~~~~~~~~~~~~~~tp~~fDn~Yy~~l~~~~~~gl~~l~sD~~L~~d~~t~ 159 (191)
++++.| . ++||+.+|||||+||||||.+||..+++.++|+.||.+|||+||++|+.++++|+++|+||+.|+.|++|+
T Consensus 140 ~l~~~F-~~~~Gl~~~e~VaL~GaHTiG~~h~~~s~~~~~~~~tP~~fDN~Yf~~ll~~~~~gl~~l~SD~~L~~d~~t~ 218 (250)
T d1oafa_ 140 HLRDVF-GKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFR 218 (250)
T ss_dssp HHHHHH-TTTTCCCHHHHHHHHGGGGSCEECTTTTSCCEESSSCTTCCSTHHHHHHHHCCCTTCCCCHHHHHHHHSTTHH
T ss_pred HHHHHH-HHhcCCCHHHHHHHhhhhhhhhhcccccccccccccccchhhhHHHHHHHhccccccccCHHHHHHhhCHHHH
Confidence 999999 6 58999999999999999999999999999999999999999999999998778999999999999999999
Q ss_pred HHHHHhhhCHHHHHHHHHHHHHHHHhCCCCCC
Q 029599 160 PLVEKYAADEDAFFADYAEAHLKLSELGFAEA 191 (191)
Q Consensus 160 ~~v~~~A~d~~~f~~~F~~am~Km~~~gv~~~ 191 (191)
++|+.||.|++.|+++|+.||+||+++||+.+
T Consensus 219 ~~v~~~A~d~~~F~~~Fa~Am~Km~~lGv~~~ 250 (250)
T d1oafa_ 219 PLVDKYAADEDAFFADYAEAHQKLSELGFADA 250 (250)
T ss_dssp HHHHHHHHCHHHHHHHHHHHHHHHHTTTSSCC
T ss_pred HHHHHHhcCHHHHHHHHHHHHHHHHhcCCCCC
Confidence 99999999999999999999999999999864
|
| >d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} | Back information, alignment and structure |
|---|
| >d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} | Back information, alignment and structure |
|---|
| >d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|