Citrus Sinensis ID: 029611

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHGNQGGSSSA
cccccccccEEEcccccccccEEEEEEEcccccEEEEEEEcccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEccccccccEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccc
cHHHHccccEEcccccccccEEEEEEEEEEEccEEEEEEEccEcccccEccEEEEEcccccccHcHHHcccccEEEEcccccccccccccccccccccccccccccccccccEEEEEEccEEEccccccccccEEcccccccccccccEEEccccccccccccccccHHccccccccccccccccccccc
MAFQLYEsgiftgrcgtsldhgvtavgygtengadYWIVknswgsswgeagYIRMERNVagtltgkcgiameasypikkgqnppnpgpsppsptkppavcdnyyscpesntcccvfeygnscfawgccpleaatccddhysccphdypicnvragtclmskdnplgvralrrtpakpywahgnqggsssa
MAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRrtpakpywahgnqggsssa
MAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYpikkgqnppnpgpsppsptkppAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHGNQGGSSSA
***QLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEAS************************VCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRR*****YW***********
MAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEAS*****************************YSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPA***************
MAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKG***************PPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWA**********
MAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKGQ***********P**PPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRR******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHGNQGGSSSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
P25776458 Oryzain alpha chain OS=Or yes no 0.921 0.382 0.772 2e-74
P43297462 Cysteine proteinase RD21a yes no 0.957 0.393 0.732 2e-72
P20721346 Low-temperature-induced c N/A no 0.984 0.540 0.643 3e-61
P25777466 Oryzain beta chain OS=Ory no no 0.910 0.371 0.666 9e-61
Q7XR52490 Cysteine protease 1 OS=Or no no 0.905 0.351 0.585 1e-49
P25251328 Cysteine proteinase COT44 N/A no 0.426 0.246 0.731 8e-31
Q94B08376 Germination-specific cyst no no 0.426 0.215 0.728 1e-30
P43156360 Thiol protease SEN102 OS= N/A no 0.431 0.227 0.678 5e-28
Q9SUS9371 Probable cysteine protein no no 0.394 0.202 0.710 4e-26
Q9STL4361 KDEL-tailed cysteine endo no no 0.436 0.229 0.619 7e-26
>sp|P25776|ORYA_ORYSJ Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2 Back     alignment and function desciption
 Score =  277 bits (709), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 159/176 (90%), Gaps = 1/176 (0%)

Query: 2   AFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAG 61
           AFQLY SGIFTG+CGT+LDHGV AVGYGTENG DYWIV+NSWG SWGE+GY+RMERN+  
Sbjct: 270 AFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKA 329

Query: 62  TLTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNS 121
           + +GKCGIA+E SYP+KKG+NPPNPGP+PPSPT PP VCDNYY+CP+S TCCC++EYG  
Sbjct: 330 S-SGKCGIAVEPSYPLKKGENPPNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKY 388

Query: 122 CFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKP 177
           C+AWGCCPLE ATCCDDHYSCCPH+YPICNV+ GTCLM+KD+PL V+AL+RT AKP
Sbjct: 389 CYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKALKRTLAKP 444

Oryza sativa subsp. japonica (taxid: 39947)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: -
>sp|P43297|RD21A_ARATH Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1 Back     alignment and function description
>sp|P20721|CYSPL_SOLLC Low-temperature-induced cysteine proteinase (Fragment) OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function description
>sp|P25777|ORYB_ORYSJ Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2 Back     alignment and function description
>sp|Q7XR52|CYSP1_ORYSJ Cysteine protease 1 OS=Oryza sativa subsp. japonica GN=CP1 PE=2 SV=2 Back     alignment and function description
>sp|P25251|CYSP4_BRANA Cysteine proteinase COT44 (Fragment) OS=Brassica napus PE=2 SV=1 Back     alignment and function description
>sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2 Back     alignment and function description
>sp|P43156|CYSP_HEMSP Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN102 PE=2 SV=1 Back     alignment and function description
>sp|Q9SUS9|CPR4_ARATH Probable cysteine proteinase At4g11320 OS=Arabidopsis thaliana GN=At4g11320 PE=2 SV=1 Back     alignment and function description
>sp|Q9STL4|CEP2_ARATH KDEL-tailed cysteine endopeptidase CEP2 OS=Arabidopsis thaliana GN=CEP2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
225458701 467 PREDICTED: cysteine proteinase RD21a-lik 0.989 0.402 0.819 1e-81
147790682 469 hypothetical protein VITISV_001146 [Viti 0.989 0.400 0.819 1e-81
302142276 388 unnamed protein product [Vitis vinifera] 0.989 0.484 0.819 7e-81
109390302 457 cysteine protease [Hevea brasiliensis] 0.978 0.407 0.807 5e-79
255538210 469 cysteine protease, putative [Ricinus com 0.984 0.398 0.787 6e-79
118486542 465 unknown [Populus trichocarpa] 0.984 0.402 0.797 2e-78
224136808 456 predicted protein [Populus trichocarpa] 0.984 0.410 0.797 2e-78
146216004 461 cysteine protease Cp6 [Actinidia delicio 0.989 0.407 0.805 2e-78
374713651 467 cysteine protease [Carica papaya] 0.994 0.404 0.783 2e-77
148927394 469 cysteine proteinase [Elaeis guineensis] 0.989 0.400 0.805 3e-77
>gi|225458701|ref|XP_002284973.1| PREDICTED: cysteine proteinase RD21a-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 154/188 (81%), Positives = 171/188 (90%)

Query: 3   FQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGT 62
           FQLY+SGIFTGRCGT+LDHGVTAVGYGTENG DYWIVKNSWG+SWGE GYIRMER++A +
Sbjct: 280 FQLYQSGIFTGRCGTALDHGVTAVGYGTENGVDYWIVKNSWGASWGEEGYIRMERDLATS 339

Query: 63  LTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSC 122
            TGKCGIAMEASYPIKKGQNPPNPGPSPPSP KPP VCDNYY+CPES+TCCC+FEY   C
Sbjct: 340 ATGKCGIAMEASYPIKKGQNPPNPGPSPPSPIKPPTVCDNYYACPESSTCCCIFEYAKYC 399

Query: 123 FAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHG 182
           F WGCCPLEAATCC+DH SCCP +YP+CNVRAGTC+MSKDNPLGV+AL+RT AKP+WA+G
Sbjct: 400 FQWGCCPLEAATCCEDHDSCCPQEYPVCNVRAGTCMMSKDNPLGVKALKRTAAKPHWAYG 459

Query: 183 NQGGSSSA 190
             G  SSA
Sbjct: 460 GDGKRSSA 467

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147790682|emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142276|emb|CBI19479.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|109390302|gb|ABG33750.1| cysteine protease [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|255538210|ref|XP_002510170.1| cysteine protease, putative [Ricinus communis] gi|223550871|gb|EEF52357.1| cysteine protease, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118486542|gb|ABK95110.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224136808|ref|XP_002326950.1| predicted protein [Populus trichocarpa] gi|222835265|gb|EEE73700.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|146216004|gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa] Back     alignment and taxonomy information
>gi|374713651|gb|AEZ65083.1| cysteine protease [Carica papaya] Back     alignment and taxonomy information
>gi|148927394|gb|ABR19828.1| cysteine proteinase [Elaeis guineensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
TAIR|locus:2825832462 RD21A "responsive to dehydrati 0.447 0.183 0.694 7.7e-70
TAIR|locus:2167821463 RD21B "esponsive to dehydratio 0.936 0.384 0.636 8.2e-67
TAIR|locus:2090614452 AT3G19390 [Arabidopsis thalian 0.884 0.371 0.545 6.1e-55
TAIR|locus:2024362437 XBCP3 "xylem bark cysteine pep 0.857 0.372 0.449 4.8e-39
TAIR|locus:2128253371 AT4G11320 [Arabidopsis thalian 0.378 0.194 0.712 1.8e-25
TAIR|locus:2038515343 AT1G06260 [Arabidopsis thalian 0.378 0.209 0.712 4.6e-25
TAIR|locus:2128243364 AT4G11310 [Arabidopsis thalian 0.378 0.197 0.698 4.6e-25
TAIR|locus:2090629362 AT3G19400 [Arabidopsis thalian 0.384 0.201 0.608 6.8e-24
TAIR|locus:505006391364 CEP3 "cysteine endopeptidase 3 0.378 0.197 0.635 1.4e-23
TAIR|locus:2157712361 CEP1 "cysteine endopeptidase 1 0.378 0.199 0.662 1.8e-23
TAIR|locus:2825832 RD21A "responsive to dehydration 21A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 405 (147.6 bits), Expect = 7.7e-70, Sum P(2) = 7.7e-70
 Identities = 59/85 (69%), Positives = 75/85 (88%)

Query:   100 CDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLM 159
             CD+YY+CPESNTCCC+FEYG  CFAWGCCPLEAATCCDD+YSCCPH+YP+C++  GTCL+
Sbjct:   375 CDSYYTCPESNTCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLL 434

Query:   160 SKDNPLGVRALRRTPAKPYWAHGNQ 184
             SK++P  V+AL+R PA P+W+ G +
Sbjct:   435 SKNSPFSVKALKRKPATPFWSQGRK 459
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;IMP
GO:0008234 "cysteine-type peptidase activity" evidence=ISS;IDA;IMP
GO:0009507 "chloroplast" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0008233 "peptidase activity" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005829 "cytosol" evidence=RCA
GO:0009506 "plasmodesma" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IMP
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0009414 "response to water deprivation" evidence=TAS
TAIR|locus:2167821 RD21B "esponsive to dehydration 21B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090614 AT3G19390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024362 XBCP3 "xylem bark cysteine peptidase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128253 AT4G11320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038515 AT1G06260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128243 AT4G11310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090629 AT3G19400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006391 CEP3 "cysteine endopeptidase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157712 CEP1 "cysteine endopeptidase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P25776ORYA_ORYSJ3, ., 4, ., 2, 2, ., -0.77270.92100.3820yesno
P43297RD21A_ARATH3, ., 4, ., 2, 2, ., -0.73220.95780.3939yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 3e-37
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 1e-32
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 2e-27
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 2e-22
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 1e-19
smart0027751 smart00277, GRAN, Granulin 6e-16
PTZ00203348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 4e-13
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 2e-12
pfam0039643 pfam00396, Granulin, Granulin 6e-12
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 1e-10
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 3e-10
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 1e-09
PTZ00462 1004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 4e-07
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 9e-07
COG4870372 COG4870, COG4870, Cysteine protease [Posttranslati 6e-05
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 2e-04
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information 
 Score =  128 bits (323), Expect = 3e-37
 Identities = 46/78 (58%), Positives = 52/78 (66%), Gaps = 6/78 (7%)

Query: 1   MAFQLYESGIFTG-RCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNV 59
             FQLY+SG++    C   LDH V  VGYGTENG  YWIVKNSWG+ WGE GY R+ R V
Sbjct: 141 DDFQLYKSGVYKHTECSGELDHAVLIVGYGTENGVPYWIVKNSWGTDWGENGYFRIARGV 200

Query: 60  AGTLTGKCGIAMEASYPI 77
                 +CGIA EASYPI
Sbjct: 201 -----NECGIASEASYPI 213

Length = 213
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|197621 smart00277, GRAN, Granulin Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|215898 pfam00396, Granulin, Granulin Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
KOG429690 consensus Epithelin/granulin [Signal transduction 99.95
cd02698239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 99.91
PTZ00021489 falcipain-2; Provisional 99.9
PTZ00203348 cathepsin L protease; Provisional 99.9
cd02620236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 99.9
cd02621243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 99.9
PTZ00200448 cysteine proteinase; Provisional 99.9
KOG1543325 consensus Cysteine proteinase Cathepsin L [Posttra 99.89
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 99.88
smart00645174 Pept_C1 Papain family cysteine protease. 99.87
KOG1542372 consensus Cysteine proteinase Cathepsin F [Posttra 99.87
smart0027751 GRAN Granulin. 99.87
PF00112219 Peptidase_C1: Papain family cysteine protease This 99.86
PTZ00049693 cathepsin C-like protein; Provisional 99.83
PTZ00364548 dipeptidyl-peptidase I precursor; Provisional 99.82
PTZ00462 1004 Serine-repeat antigen protein; Provisional 99.76
PF0039643 Granulin: Granulin; InterPro: IPR000118 Metazoan g 99.74
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 99.68
KOG1544470 consensus Predicted cysteine proteinase TIN-ag [Ge 99.58
cd00585437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 99.47
COG4870372 Cysteine protease [Posttranslational modification, 99.11
PF03051438 Peptidase_C1_2: Peptidase C1-like family This fami 98.58
COG3579444 PepC Aminopeptidase C [Amino acid transport and me 97.07
KOG4128457 consensus Bleomycin hydrolases and aminopeptidases 84.32
>KOG4296 consensus Epithelin/granulin [Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.95  E-value=7.4e-29  Score=180.80  Aligned_cols=82  Identities=52%  Similarity=1.423  Sum_probs=79.2

Q ss_pred             CCCCcccCCCCcccccccCCCcccccccccCCCceecCCCCccCCCCCCcccCCCCeeeCCCCCCccccchhccCCcccc
Q 029611          100 CDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYW  179 (190)
Q Consensus       100 Cd~~~~Cp~~~TCC~~~~~~~~c~~~gCCp~~~avCC~D~~hCCP~g~~~C~~~~~~C~~~~~~~~~~~~~~k~pa~~~~  179 (190)
                      ||.+++||+++|||++.+.+++|.+|||||+++||||+|+.|||||+||+||+.+++|++..++++.|+.|+|.||+..+
T Consensus         1 Cd~~~~Cp~~~TCCcl~e~~~~cfsWgCCp~e~A~CCdD~~hCCPh~ypVCD~~~~~Cl~k~ns~~sikal~kkpA~~~~   80 (90)
T KOG4296|consen    1 CDSYTECPDSETCCCLYEYGGYCFSWGCCPMESAVCCDDRSHCCPHGYPVCDLQRSTCLMKKNSPTSIKALKKKPAIKTL   80 (90)
T ss_pred             CCcceecCCCCceEEeeecCceeceeccccCCcceeecCCCccCCCCCcccccccceeeccCCCcccchhhccCCccccc
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999887


Q ss_pred             cc
Q 029611          180 AH  181 (190)
Q Consensus       180 ~~  181 (190)
                      ..
T Consensus        81 ~~   82 (90)
T KOG4296|consen   81 ER   82 (90)
T ss_pred             cc
Confidence            64

>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00277 GRAN Granulin Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>PF00396 Granulin: Granulin; InterPro: IPR000118 Metazoan granulins [] are a family of cysteine-rich peptides of about 6 Kd which may have multiple biological activity Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>KOG1544 consensus Predicted cysteine proteinase TIN-ag [General function prediction only] Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4128 consensus Bleomycin hydrolases and aminopeptidases of cysteine protease family [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 2e-24
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 2e-24
1cqd_A221 The 2.1 Angstrom Structure Of A Cysteine Protease W 1e-22
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 3e-22
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 3e-22
2fo5_A262 Crystal Structure Of Recombinant Barley Cysteine En 4e-22
2act_A220 Crystallographic Refinement Of The Structure Of Act 1e-21
1iwd_A215 Proposed Amino Acid Sequence And The 1.63 Angstrom 4e-21
1yal_A218 Carica Papaya Chymopapain At 1.7 Angstroms Resoluti 9e-20
3f75_A224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 3e-16
3bcn_A209 Crystal Structure Of A Papain-Like Cysteine Proteas 7e-16
3ioq_A213 Crystal Structure Of The Carica Candamarcensis Cyst 8e-16
1o0e_A208 1.9 Angstrom Crystal Structure Of A Plant Cysteine 1e-15
2pns_A208 1.9 Angstrom Resolution Crystal Structure Of A Plan 2e-15
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 3e-15
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 3e-15
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 4e-14
2bdz_A214 Mexicain From Jacaratia Mexicana Length = 214 6e-14
1ppp_A212 Crystal Structure Of Papain-E64-C Complex. Binding 7e-14
1stf_E212 The Refined 2.4 Angstroms X-Ray Crystal Structure O 7e-14
1pip_A212 Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al 7e-14
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 7e-14
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 7e-14
1khp_A212 Monoclinic Form Of Papain/zlfg-dam Covalent Complex 8e-14
2cio_A212 The High Resolution X-Ray Structure Of Papain Compl 8e-14
3ima_A212 Complex Strcuture Of Tarocystatin And Papain Length 8e-14
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 8e-14
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 9e-14
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 9e-14
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 9e-14
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 9e-14
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 9e-14
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 9e-14
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 9e-14
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 9e-14
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 1e-13
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 1e-13
3tnx_A363 Structure Of The Precursor Of A Thermostable Varian 1e-13
1ppo_A216 Determination Of The Structure Of Papaya Protease O 2e-13
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 5e-13
1meg_A216 Crystal Structure Of A Caricain D158e Mutant In Com 5e-13
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 1e-12
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 2e-12
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 2e-12
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 2e-12
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 2e-12
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 3e-12
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 3e-12
3pnr_A240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 4e-12
1yvb_A241 The Plasmodium Falciparum Cysteine Protease Falcipa 4e-12
1pci_A322 Procaricain Length = 322 4e-12
1gec_E216 Glycyl Endopeptidase-complex With Benzyloxycarbonyl 4e-12
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 6e-12
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 6e-12
8pch_A220 Crystal Structure Of Porcine Cathepsin H Determined 1e-11
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 6e-11
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 9e-11
3hwn_A258 Cathepsin L With Az13010160 Length = 258 2e-10
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 3e-10
3qj3_A331 Structure Of Digestive Procathepsin L2 Proteinase F 3e-10
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 3e-10
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 3e-10
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 3e-10
3of8_A221 Structural Basis For Reversible And Irreversible In 3e-10
3h89_A220 A Combined Crystallographic And Molecular Dynamics 3e-10
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 3e-10
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 3e-10
3u8e_A222 Crystal Structure Of Cysteine Protease From Bulbs O 5e-10
3bpm_A243 Crystal Structure Of Falcipain-3 With Its Inhibitor 8e-10
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 8e-10
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 1e-09
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 2e-09
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 2e-09
2vhs_A217 Cathsilicatein, A Chimera Length = 217 4e-09
1jqp_A438 Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric 4e-09
3pdf_A441 Discovery Of Novel Cyanamide-Based Inhibitors Of Ca 6e-09
1k3b_C69 Crystal Structure Of Human Dipeptidyl Peptidase I ( 1e-08
3qsd_A254 Structure Of Cathepsin B1 From Schistosoma Mansoni 1e-08
1pbh_A317 Crystal Structure Of Human Recombinant Procathepsin 3e-08
3ai8_B256 Cathepsin B In Complex With The Nitroxoline Length 3e-08
3k9m_A254 Cathepsin B In Complex With Stefin A Length = 254 3e-08
3cbj_A266 Chagasin-cathepsin B Complex Length = 266 4e-08
1gmy_A261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 4e-08
1huc_B205 The Refined 2.15 Angstroms X-Ray Crystal Structure 4e-08
1qdq_A253 X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 4e-08
1ito_A256 Crystal Structure Analysis Of Bovine Spleen Catheps 6e-08
1sp4_B205 Crystal Structure Of Ns-134 In Complex With Bovine 6e-08
1mir_A322 Rat Procathepsin B Length = 322 1e-07
1cpj_A260 Crystal Structures Of Recombinant Rat Cathepsin B A 1e-07
1cte_A254 Crystal Structures Of Recombinant Rat Cathepsin B A 1e-07
1m6d_A214 Crystal Structure Of Human Cathepsin F Length = 214 2e-07
1deu_A277 Crystal Structure Of Human Procathepsin X: A Cystei 3e-07
1ef7_A242 Crystal Structure Of Human Cathepsin X Length = 242 4e-07
3d6s_A223 Crystal Structure Of Mite Allergen Der F 1 Length = 5e-07
4hwy_A340 Trypanosoma Brucei Procathepsin B Solved From 40 Fs 6e-07
3hhi_A325 Crystal Structure Of Cathepsin B From T. Brucei In 6e-07
3mor_A317 Crystal Structure Of Cathepsin B From Trypanosoma B 6e-07
2jyt_A69 Human Granulin C, Isomer 1 Length = 69 2e-06
2jye_A72 Human Granulin A Length = 72 2e-06
1xkg_A312 Crystal Structure Of The Major House Dust Mite Alle 3e-06
2as8_A222 Crystal Structure Of Mature And Fully Active Der P 4e-06
3rvw_A222 Crystal Structure Of Der P 1 Complexed With Fab 4c1 4e-06
3f5v_A222 C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 4e-06
2jyv_A72 Human Granulin F Length = 72 5e-05
3ch2_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 5e-05
2wbf_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 5e-05
1icf_B42 Crystal Structure Of Mhc Class Ii Associated P41 Ii 1e-04
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure 
Iteration: 1

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/73 (69%), Positives = 60/73 (82%), Gaps = 2/73 (2%)
Query: 3   FQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGT 62
           FQ Y SGIFTG CGT++DH VT VGYGTE G DYWIVKNSWG++WGE GY+R++RNV G 
Sbjct: 144 FQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGG- 202
Query: 63  LTGKCGIAMEASY 75
             G+CGIA +ASY
Sbjct: 203 -VGQCGIAKKASY 214
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 Back     alignment and structure
>pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure
>pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 Back     alignment and structure
>pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 Back     alignment and structure
>pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 Back     alignment and structure
>pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 Back     alignment and structure
>pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 Back     alignment and structure
>pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure
>pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 Back     alignment and structure
>pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 Back     alignment and structure
>pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 Back     alignment and structure
>pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 Back     alignment and structure
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure
>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 Back     alignment and structure
>pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 Back     alignment and structure
>pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 Back     alignment and structure
>pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 Back     alignment and structure
>pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 Back     alignment and structure
>pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 Back     alignment and structure
>pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 Back     alignment and structure
>pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 Back     alignment and structure
>pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 Back     alignment and structure
>pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 Back     alignment and structure
>pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 Back     alignment and structure
>pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 Back     alignment and structure
>pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 Back     alignment and structure
>pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 Back     alignment and structure
>pdb|2JYT|A Chain A, Human Granulin C, Isomer 1 Length = 69 Back     alignment and structure
>pdb|2JYE|A Chain A, Human Granulin A Length = 72 Back     alignment and structure
>pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 Back     alignment and structure
>pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 Back     alignment and structure
>pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 Back     alignment and structure
>pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 Back     alignment and structure
>pdb|2JYV|A Chain A, Human Granulin F Length = 72 Back     alignment and structure
>pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 Back     alignment and structure
>pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 Back     alignment and structure
>pdb|1ICF|B Chain B, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 42 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 9e-50
1cqd_A221 Protein (protease II); cysteine protease, glycopro 2e-48
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 3e-48
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 2e-47
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 2e-46
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 2e-46
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 2e-46
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 2e-46
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 2e-46
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 1e-45
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 1e-45
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 2e-45
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 4e-45
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 5e-45
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 8e-45
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 1e-43
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 3e-43
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 5e-42
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 6e-42
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 2e-41
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 4e-41
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 4e-41
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 1e-40
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 2e-40
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 6e-40
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 9e-40
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 5e-39
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 4e-37
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 2e-36
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 9e-36
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 7e-35
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 1e-33
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 2e-33
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 7e-33
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 1e-32
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 2e-31
3u8e_A222 Papain-like cysteine protease; papain-like cystein 2e-31
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 2e-29
2jye_A72 Granulin A; epithelin, human, stack of hairpins, a 2e-21
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 2e-20
2jyv_A72 Granulin-2, granulin F; granulin C, epithelin, hum 2e-18
2jyt_A69 Granulin-5, granulin C; epithelin, human, stack of 2e-18
1fwo_A35 Oryzain beta chain; beta-hairpin stack fold, granu 7e-13
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 3e-08
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
 Score =  159 bits (404), Expect = 9e-50
 Identities = 41/77 (53%), Positives = 52/77 (67%), Gaps = 1/77 (1%)

Query: 2   AFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAG 61
            FQLY+ GIF G CGT +DH VTAVGYG   G  Y ++KNSWG++WGE GYIR++R    
Sbjct: 140 PFQLYKGGIFEGPCGTKVDHAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGN 199

Query: 62  TLTGKCGIAMEASYPIK 78
           +  G CG+   + YP K
Sbjct: 200 S-PGVCGLYKSSYYPTK 215
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>2jye_A Granulin A; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>2jyv_A Granulin-2, granulin F; granulin C, epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2jyt_A Granulin-5, granulin C; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} PDB: 2jyu_A Length = 69 Back     alignment and structure
>1fwo_A Oryzain beta chain; beta-hairpin stack fold, granulin/epithelin-like protein repeats, hydrolase; NMR {Synthetic} SCOP: g.3.16.1 Length = 35 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 99.94
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 99.94
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 99.94
1cqd_A221 Protein (protease II); cysteine protease, glycopro 99.94
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 99.94
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 99.94
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 99.94
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 99.94
2jye_A72 Granulin A; epithelin, human, stack of hairpins, a 99.93
3u8e_A222 Papain-like cysteine protease; papain-like cystein 99.93
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 99.93
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 99.93
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 99.93
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 99.93
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 99.93
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 99.93
3tnx_A363 Papain; hydrolase, cytoplasm for recombinant expre 99.93
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 99.93
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 99.92
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 99.92
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 99.92
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 99.92
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 99.92
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 99.92
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 99.92
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 99.92
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 99.92
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 99.92
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 99.92
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 99.92
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 99.92
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 99.91
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 99.91
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 99.91
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 99.91
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 99.91
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 99.91
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 99.91
2jyv_A72 Granulin-2, granulin F; granulin C, epithelin, hum 99.9
2jyt_A69 Granulin-5, granulin C; epithelin, human, stack of 99.89
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 99.88
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 99.85
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 99.72
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 99.67
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 99.65
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 99.44
1fwo_A35 Oryzain beta chain; beta-hairpin stack fold, granu 99.38
1g26_A31 Granulin A, HGA; granulin/epithelin protein repeat 99.15
1i8x_A30 Granulin-1; two beta-hairpin stack, cytokine; NMR 99.14
>3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Back     alignment and structure
Probab=99.94  E-value=9.8e-28  Score=199.38  Aligned_cols=77  Identities=69%  Similarity=1.335  Sum_probs=71.1

Q ss_pred             CCccCCCCeEcCCCCCCCCeEEEEEEEeeeCCEEEEEEEcCCCCCCCCCceEEEeeccCCcccCcccccccceeceecC
Q 029611            2 AFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKG   80 (190)
Q Consensus         2 ~f~~Y~~Giy~~~c~~~~~HaV~iVGyg~~~g~~YWivkNSWG~~WGe~Gy~~i~r~~~~~~~g~CgI~~~~~yp~~~~   80 (190)
                      +|++|++|||+..|+..++|||+|||||++++++|||||||||+.|||+|||||+|+.++  .++|||+++++||++..
T Consensus       143 ~f~~Y~~Giy~~~~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WGe~Gy~~i~r~~~~--~~~Cgi~~~~~~p~~~~  219 (220)
T 3p5u_A          143 NFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGG--VGQCGIAKKASYPVKYY  219 (220)
T ss_dssp             HHHTCCSSEECCCCCCSCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECCCCT--TCGGGTTSSCEEEECSC
T ss_pred             hhccccCceECCCCCCccceEEEEEEEecCCCceEEEEECCCCCCcccCCEEEEECCCCC--CCccCcccccceEEEec
Confidence            599999999998898889999999999999999999999999999999999999999753  47899999999998753
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>2jye_A Granulin A; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>2jyv_A Granulin-2, granulin F; granulin C, epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} Back     alignment and structure
>2jyt_A Granulin-5, granulin C; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} PDB: 2jyu_A Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>1fwo_A Oryzain beta chain; beta-hairpin stack fold, granulin/epithelin-like protein repeats, hydrolase; NMR {Synthetic} SCOP: g.3.16.1 Back     alignment and structure
>1g26_A Granulin A, HGA; granulin/epithelin protein repeats, beta-hairpin stack, cytokine; NMR {Synthetic} SCOP: g.3.16.1 Back     alignment and structure
>1i8x_A Granulin-1; two beta-hairpin stack, cytokine; NMR {Synthetic} SCOP: g.3.16.1 PDB: 1qgm_A 1i8y_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 4e-24
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 1e-22
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 2e-22
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 2e-22
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 3e-22
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 4e-22
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 3e-21
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 7e-20
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 8e-20
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 4e-19
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 7e-19
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 1e-18
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 9e-18
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 2e-17
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 3e-17
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 3e-17
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 1e-16
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 2e-16
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 2e-16
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 1e-15
d1fwoa_35 g.3.16.1 (A:) Oryzain beta chain {Rice (Oryza sati 8e-15
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 6e-08
d2cb5a_453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 1e-06
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Chymopapain
species: Papaya (Carica papaya) [TaxId: 3649]

 Score = 92.3 bits (228), Expect = 4e-24
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 1/77 (1%)

Query: 3   FQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGT 62
           FQLY+SG+F G CGT LDH VTAVGYGT +G +Y I+KNSWG +WGE GY+R++R   G 
Sbjct: 141 FQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQS-GN 199

Query: 63  LTGKCGIAMEASYPIKK 79
             G CG+   + YP K 
Sbjct: 200 SQGTCGVYKSSYYPFKG 216
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1fwoa_ g.3.16.1 (A:) Oryzain beta chain {Rice (Oryza sativa) [TaxId: 4530]} Length = 35 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 99.93
d1ppoa_216 Caricain (protease omega) {Papaya (Carica papaya) 99.92
d1s4va_224 Vignain (bean endopeptidase) {Castor bean (Ricinus 99.92
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 99.92
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 99.92
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 99.91
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 99.91
d1aeca_218 Actinidin {Chinese gooseberry or kiwifruit (Actini 99.91
d1me4a_215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 99.91
d1iwda_215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 99.9
d1gmya_254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 99.9
d1khqa_212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 99.9
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 99.9
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 99.9
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 99.89
d1m6da_214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1o0ea_208 Ervatamin C {East indian rosebay (Ervatamia corona 99.88
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 99.88
d1deua_275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 99.87
g1k3b.1233 Cathepsin C (dipeptidyl peptidase I), catalytic do 99.87
d1fwoa_35 Oryzain beta chain {Rice (Oryza sativa) [TaxId: 45 99.32
d1g26a_31 N-terminal domain of granulin-1 {Human (Homo sapie 99.03
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 98.77
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 98.54
d1i8ya_28 N-terminal domain of granulin-1 {Carp (Cyprinus ca 98.3
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Chymopapain
species: Papaya (Carica papaya) [TaxId: 3649]

Probab=99.93  E-value=1.7e-26  Score=186.80  Aligned_cols=77  Identities=56%  Similarity=1.178  Sum_probs=70.7

Q ss_pred             CCccCCCCeEcCCCCCCCCeEEEEEEEeeeCCEEEEEEEcCCCCCCCCCceEEEeeccCCcccCcccccccceeceec
Q 029611            2 AFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKK   79 (190)
Q Consensus         2 ~f~~Y~~Giy~~~c~~~~~HaV~iVGyg~~~g~~YWivkNSWG~~WGe~Gy~~i~r~~~~~~~g~CgI~~~~~yp~~~   79 (190)
                      .|+.|++|||...+....+|||+|||||++++++|||||||||++|||+|||||+|+.++. .+.|||++.+.||++.
T Consensus       140 ~~~~y~~Giy~~~~~~~~~Hav~IVGyg~~~g~~ywivkNSWG~~WGd~Gy~~I~~~~~~~-~~~CGI~~~~~~p~~~  216 (218)
T d1yala_         140 PFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNS-QGTCGVYKSSYYPFKG  216 (218)
T ss_dssp             HHHTCCSSEECCSCCSCCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECCCSBS-CCGGGTTSSCEEEECC
T ss_pred             chhhcccceeeecccccCCcEEEEEEeeccCCceEEEEECCCCCCcccCCEEEEEccCCCC-CCcCCccceeeeccCC
Confidence            4678999999887777789999999999999999999999999999999999999998665 7899999999999875
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwoa_ g.3.16.1 (A:) Oryzain beta chain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g26a_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ya_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Carp (Cyprinus carpio) [TaxId: 7962]} Back     information, alignment and structure