Citrus Sinensis ID: 029612

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRLLLPEIF
ccccHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccEEEcccccccccccccHHHHHHHHHHHHHHcccccc
ccHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHcccccEccHHHHcHHHHHHHHHHHHHccccccc
mtlfkklypkhrTKEVKNFIAKATKFIEDIqksdgswygswgICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQcedggwgesyrscpnkkyipldgnrsNLVQTAWAMMSLIHagqmerdptpLHRAAKLLINsqledgdfpqqelTGVFMEncmlhypiyrnifPMWALAEYRSrlllpeif
mtlfkklypkhrtkeVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRLLLPEIF
MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRLLLPEIF
*******Y**HRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQ*******LHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRLLL****
MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRLLLPEI*
MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRLLLPEIF
MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRLLLPE**
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRLLLPEIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
A8CDT2759 Beta-amyrin synthase OS=B N/A no 0.984 0.246 0.732 3e-85
A8C980759 Germanicol synthase OS=Rh N/A no 0.984 0.246 0.727 2e-83
E2IUA9765 Lupeol synthase OS=Kalanc N/A no 0.978 0.243 0.731 5e-83
Q8W3Z1779 Beta-amyrin synthase OS=B N/A no 0.984 0.240 0.711 2e-82
Q9MB42765 Beta-amyrin synthase OS=G N/A no 0.984 0.244 0.716 4e-82
Q9LRH8758 Beta-amyrin synthase OS=P N/A no 0.984 0.246 0.721 5e-82
O82140763 Beta-Amyrin Synthase 1 OS N/A no 0.994 0.247 0.703 5e-82
E2IUA8767 Friedelin synthase OS=Kal N/A no 0.952 0.235 0.729 9e-80
P0C8Y0769 Camelliol C synthase OS=A yes no 0.984 0.243 0.700 2e-79
Q8RWT0763 Amyrin synthase LUP2 OS=A no no 0.952 0.237 0.734 3e-79
>sp|A8CDT2|BAS_BRUGY Beta-amyrin synthase OS=Bruguiera gymnorhiza GN=BAS PE=1 SV=1 Back     alignment and function desciption
 Score =  314 bits (804), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 163/187 (87%)

Query: 1   MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAK 60
           + LFKKLYP HR KE+ NFI  A +++E IQ SDG WYG+WG+CFTY  WFA+ GL AA 
Sbjct: 572 LVLFKKLYPGHRKKEIDNFIVNAVRYLESIQTSDGGWYGNWGVCFTYGTWFALGGLAAAG 631

Query: 61  KTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIH 120
           KTY+NCLA+RKA DFLL+IQ ++GGWGESY SCP K+Y+PL+GNRSNLV TAWA+M+LIH
Sbjct: 632 KTYNNCLAMRKAVDFLLRIQRDNGGWGESYLSCPEKRYVPLEGNRSNLVHTAWALMALIH 691

Query: 121 AGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEY 180
           AGQM+RDPTPLHRAA+L+INSQLEDGDFPQQE+TGVFM+NCMLHY  YRNI+P+WALAEY
Sbjct: 692 AGQMDRDPTPLHRAARLMINSQLEDGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEY 751

Query: 181 RSRLLLP 187
           R R+ LP
Sbjct: 752 RRRVPLP 758
Oxidosqualene cyclase involved in the biosynthesis of beta-amyrin.
Bruguiera gymnorhiza (taxid: 39984)
EC: 5EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 3EC: 9
>sp|A8C980|GERS_RHISY Germanicol synthase OS=Rhizophora stylosa GN=M1 PE=1 SV=1 Back     alignment and function description
>sp|E2IUA9|LUPS_KALDA Lupeol synthase OS=Kalanchoe daigremontiana PE=1 SV=1 Back     alignment and function description
>sp|Q8W3Z1|BAMS_BETPL Beta-amyrin synthase OS=Betula platyphylla GN=OSCBPY PE=1 SV=1 Back     alignment and function description
>sp|Q9MB42|BAMS_GLYGL Beta-amyrin synthase OS=Glycyrrhiza glabra GN=GgbAS1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRH8|BAMS_PEA Beta-amyrin synthase OS=Pisum sativum GN=OSCPSY PE=2 SV=1 Back     alignment and function description
>sp|O82140|BAMS1_PANGI Beta-Amyrin Synthase 1 OS=Panax ginseng GN=OSCPNY1 PE=1 SV=1 Back     alignment and function description
>sp|E2IUA8|FRIES_KALDA Friedelin synthase OS=Kalanchoe daigremontiana PE=1 SV=1 Back     alignment and function description
>sp|P0C8Y0|LUP3_ARATH Camelliol C synthase OS=Arabidopsis thaliana GN=CAMS1 PE=1 SV=1 Back     alignment and function description
>sp|Q8RWT0|LUP2_ARATH Amyrin synthase LUP2 OS=Arabidopsis thaliana GN=LUP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
353678016 759 RecName: Full=Beta-amyrin synthase; Shor 0.984 0.246 0.732 1e-83
392621787 763 lupeol synthase [Eleutherococcus trifoli 0.994 0.247 0.714 5e-82
357467673 762 Beta-amyrin synthase [Medicago truncatul 0.984 0.245 0.732 6e-82
73991374 762 beta-amyrin synthase [Euphorbia tirucall 0.984 0.245 0.716 6e-82
353558864 759 RecName: Full=Germanicol synthase; Short 0.984 0.246 0.727 8e-82
300431227 763 beta-amyrin synthase [Aralia elata] 0.994 0.247 0.719 1e-81
403399452 765 RecName: Full=Lupeol synthase; Short=KdL 0.978 0.243 0.731 3e-81
28194504 762 beta-amyrin synthase [Medicago truncatul 0.984 0.245 0.727 3e-81
75248718 779 RecName: Full=Beta-amyrin synthase gi|18 0.984 0.240 0.711 1e-80
357513599 472 Beta-amyrin synthase [Medicago truncatul 1.0 0.402 0.721 2e-80
>gi|353678016|sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=BgbAS gi|157679391|dbj|BAF80443.1| beta amyrin synthase [Bruguiera gymnorhiza] Back     alignment and taxonomy information
 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 163/187 (87%)

Query: 1   MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAK 60
           + LFKKLYP HR KE+ NFI  A +++E IQ SDG WYG+WG+CFTY  WFA+ GL AA 
Sbjct: 572 LVLFKKLYPGHRKKEIDNFIVNAVRYLESIQTSDGGWYGNWGVCFTYGTWFALGGLAAAG 631

Query: 61  KTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIH 120
           KTY+NCLA+RKA DFLL+IQ ++GGWGESY SCP K+Y+PL+GNRSNLV TAWA+M+LIH
Sbjct: 632 KTYNNCLAMRKAVDFLLRIQRDNGGWGESYLSCPEKRYVPLEGNRSNLVHTAWALMALIH 691

Query: 121 AGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEY 180
           AGQM+RDPTPLHRAA+L+INSQLEDGDFPQQE+TGVFM+NCMLHY  YRNI+P+WALAEY
Sbjct: 692 AGQMDRDPTPLHRAARLMINSQLEDGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEY 751

Query: 181 RSRLLLP 187
           R R+ LP
Sbjct: 752 RRRVPLP 758

Source: Bruguiera gymnorhiza

Species: Bruguiera gymnorhiza

Genus: Bruguiera

Family: Rhizophoraceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|392621787|gb|AFM82492.1| lupeol synthase [Eleutherococcus trifoliatus] Back     alignment and taxonomy information
>gi|357467673|ref|XP_003604121.1| Beta-amyrin synthase [Medicago truncatula] gi|27475608|emb|CAD23247.1| beta-amyrin synthase [Medicago truncatula] gi|355505176|gb|AES86318.1| Beta-amyrin synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|73991374|dbj|BAE43642.1| beta-amyrin synthase [Euphorbia tirucalli] Back     alignment and taxonomy information
>gi|353558864|sp|A8C980.1|GERS_RHISY RecName: Full=Germanicol synthase; Short=RsM1 gi|157679387|dbj|BAF80441.1| multifunctional triterpene synthase [Rhizophora stylosa] Back     alignment and taxonomy information
>gi|300431227|gb|ADK12003.1| beta-amyrin synthase [Aralia elata] Back     alignment and taxonomy information
>gi|403399452|sp|E2IUA9.1|LUPS_KALDA RecName: Full=Lupeol synthase; Short=KdLUS gi|300807980|gb|ADK35126.1| lupeol synthase [Kalanchoe daigremontiana] Back     alignment and taxonomy information
>gi|28194504|gb|AAO33578.1|AF478453_1 beta-amyrin synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|75248718|sp|Q8W3Z1.1|BAMS_BETPL RecName: Full=Beta-amyrin synthase gi|18147596|dbj|BAB83088.1| beta-amyrin synthase [Betula platyphylla] Back     alignment and taxonomy information
>gi|357513599|ref|XP_003627088.1| Beta-amyrin synthase [Medicago truncatula] gi|355521110|gb|AET01564.1| Beta-amyrin synthase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
UNIPROTKB|A8CDT2759 BAS "Beta-amyrin synthase" [Br 0.984 0.246 0.732 4.7e-80
UNIPROTKB|E2IUA9765 E2IUA9 "Lupeol synthase" [Kala 0.978 0.243 0.731 3.8e-78
UNIPROTKB|Q8W3Z1779 OSCBPY "Beta-amyrin synthase" 0.984 0.240 0.711 1.3e-77
UNIPROTKB|E2IUA8767 E2IUA8 "Friedelin synthase" [K 0.952 0.235 0.729 2.1e-75
TAIR|locus:504956092769 CAMS1 "AT1G78955" [Arabidopsis 0.984 0.243 0.700 1.2e-74
UNIPROTKB|E2IUA6779 E2IUA6 "Taraxerol synthase" [K 0.984 0.240 0.689 2.5e-74
UNIPROTKB|E2IUA7767 E2IUA7 "Glutinol synthase" [Ka 0.952 0.235 0.707 4e-74
TAIR|locus:2207300763 LUP2 "lupeol synthase 2" [Arab 0.952 0.237 0.734 6.5e-74
UNIPROTKB|Q2XPU7769 Q2XPU7 "Lupeol synthase" [Rici 0.984 0.243 0.695 1.1e-73
UNIPROTKB|Q9LRH7764 OSCPSM "Mixed-amyrin synthase" 0.978 0.243 0.704 1.6e-72
UNIPROTKB|A8CDT2 BAS "Beta-amyrin synthase" [Bruguiera gymnorhiza (taxid:39984)] Back     alignment and assigned GO terms
 Score = 804 (288.1 bits), Expect = 4.7e-80, P = 4.7e-80
 Identities = 137/187 (73%), Positives = 163/187 (87%)

Query:     1 MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAK 60
             + LFKKLYP HR KE+ NFI  A +++E IQ SDG WYG+WG+CFTY  WFA+ GL AA 
Sbjct:   572 LVLFKKLYPGHRKKEIDNFIVNAVRYLESIQTSDGGWYGNWGVCFTYGTWFALGGLAAAG 631

Query:    61 KTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIH 120
             KTY+NCLA+RKA DFLL+IQ ++GGWGESY SCP K+Y+PL+GNRSNLV TAWA+M+LIH
Sbjct:   632 KTYNNCLAMRKAVDFLLRIQRDNGGWGESYLSCPEKRYVPLEGNRSNLVHTAWALMALIH 691

Query:   121 AGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEY 180
             AGQM+RDPTPLHRAA+L+INSQLEDGDFPQQE+TGVFM+NCMLHY  YRNI+P+WALAEY
Sbjct:   692 AGQMDRDPTPLHRAARLMINSQLEDGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEY 751

Query:   181 RSRLLLP 187
             R R+ LP
Sbjct:   752 RRRVPLP 758
GO:0016104 "triterpenoid biosynthetic process" evidence=IDA
GO:0042300 "beta-amyrin synthase activity" evidence=IDA
UNIPROTKB|E2IUA9 E2IUA9 "Lupeol synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
UNIPROTKB|Q8W3Z1 OSCBPY "Beta-amyrin synthase" [Betula platyphylla (taxid:78630)] Back     alignment and assigned GO terms
UNIPROTKB|E2IUA8 E2IUA8 "Friedelin synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
TAIR|locus:504956092 CAMS1 "AT1G78955" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2IUA6 E2IUA6 "Taraxerol synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
UNIPROTKB|E2IUA7 E2IUA7 "Glutinol synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
TAIR|locus:2207300 LUP2 "lupeol synthase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2XPU7 Q2XPU7 "Lupeol synthase" [Ricinus communis (taxid:3988)] Back     alignment and assigned GO terms
UNIPROTKB|Q9LRH7 OSCPSM "Mixed-amyrin synthase" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C8Y0LUP3_ARATH5, ., 4, ., 9, 9, ., 3, 80.70050.98420.2431yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.4.990.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
PLN02993763 PLN02993, PLN02993, lupeol synthase 1e-108
PLN03012759 PLN03012, PLN03012, Camelliol C synthase 1e-100
cd02892634 cd02892, SQCY_1, Squalene cyclase (SQCY) domain su 1e-94
cd02889348 cd02889, SQCY, Squalene cyclase (SQCY) domain; fou 3e-91
TIGR01787621 TIGR01787, squalene_cyclas, squalene/oxidosqualene 2e-71
TIGR03463634 TIGR03463, osq_cycl, 2,3-oxidosqualene cyclase 2e-43
COG1657517 COG1657, SqhC, Squalene cyclase [Lipid metabolism] 1e-29
cd00688300 cd00688, ISOPREN_C2_like, This group contains clas 5e-27
TIGR01507635 TIGR01507, hopene_cyclase, squalene-hopene cyclase 2e-25
pfam13249112 pfam13249, Prenyltrans_2, Prenyltransferase-like 3e-13
TIGR04277624 TIGR04277, squa_tetra_cyc, squalene--tetrahymanol 4e-13
cd00688 300 cd00688, ISOPREN_C2_like, This group contains clas 1e-10
cd00688300 cd00688, ISOPREN_C2_like, This group contains clas 8e-10
pfam13243109 pfam13243, Prenyltrans_1, Prenyltransferase-like 1e-09
pfam13249112 pfam13249, Prenyltrans_2, Prenyltransferase-like 9e-09
cd02889 348 cd02889, SQCY, Squalene cyclase (SQCY) domain; fou 5e-07
pfam0043244 pfam00432, Prenyltrans, Prenyltransferase and squa 1e-05
pfam13243109 pfam13243, Prenyltrans_1, Prenyltransferase-like 4e-05
pfam0043244 pfam00432, Prenyltrans, Prenyltransferase and squa 2e-04
cd02891282 cd02891, A2M_like, Proteins similar to alpha2-macr 0.002
>gnl|CDD|215537 PLN02993, PLN02993, lupeol synthase Back     alignment and domain information 
 Score =  326 bits (836), Expect = e-108
 Identities = 129/186 (69%), Positives = 147/186 (79%)

Query: 1   MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAK 60
           + LFK+LYP HRTKE+   I KA +FIE  Q  DGSWYG+WGICF YA WFA+ GL AA 
Sbjct: 573 LVLFKQLYPDHRTKEIIKSIEKAVQFIESKQTPDGSWYGNWGICFIYATWFALGGLAAAG 632

Query: 61  KTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIH 120
           KTY++CLA+RK   FLL IQ +DGGWGESY SCP ++YIPL+GNRSNLVQTAWAMM LIH
Sbjct: 633 KTYNDCLAMRKGVHFLLTIQRDDGGWGESYLSCPEQRYIPLEGNRSNLVQTAWAMMGLIH 692

Query: 121 AGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEY 180
           AGQ ERD  PLHRAAKL+I SQLE+GDFPQQE+ G FM  CMLHY  YRN FP+WALAEY
Sbjct: 693 AGQAERDLIPLHRAAKLIITSQLENGDFPQQEILGAFMNTCMLHYATYRNTFPLWALAEY 752

Query: 181 RSRLLL 186
           R    +
Sbjct: 753 RKAAFI 758

Length = 763
>gnl|CDD|166653 PLN03012, PLN03012, Camelliol C synthase Back     alignment and domain information
>gnl|CDD|239222 cd02892, SQCY_1, Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>gnl|CDD|239219 cd02889, SQCY, Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>gnl|CDD|233578 TIGR01787, squalene_cyclas, squalene/oxidosqualene cyclases Back     alignment and domain information
>gnl|CDD|234220 TIGR03463, osq_cycl, 2,3-oxidosqualene cyclase Back     alignment and domain information
>gnl|CDD|224571 COG1657, SqhC, Squalene cyclase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|238362 cd00688, ISOPREN_C2_like, This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>gnl|CDD|233442 TIGR01507, hopene_cyclase, squalene-hopene cyclase Back     alignment and domain information
>gnl|CDD|222007 pfam13249, Prenyltrans_2, Prenyltransferase-like Back     alignment and domain information
>gnl|CDD|212000 TIGR04277, squa_tetra_cyc, squalene--tetrahymanol cyclase Back     alignment and domain information
>gnl|CDD|238362 cd00688, ISOPREN_C2_like, This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>gnl|CDD|238362 cd00688, ISOPREN_C2_like, This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>gnl|CDD|205423 pfam13243, Prenyltrans_1, Prenyltransferase-like Back     alignment and domain information
>gnl|CDD|222007 pfam13249, Prenyltrans_2, Prenyltransferase-like Back     alignment and domain information
>gnl|CDD|239219 cd02889, SQCY, Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>gnl|CDD|109488 pfam00432, Prenyltrans, Prenyltransferase and squalene oxidase repeat Back     alignment and domain information
>gnl|CDD|205423 pfam13243, Prenyltrans_1, Prenyltransferase-like Back     alignment and domain information
>gnl|CDD|109488 pfam00432, Prenyltrans, Prenyltransferase and squalene oxidase repeat Back     alignment and domain information
>gnl|CDD|239221 cd02891, A2M_like, Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
PLN03012759 Camelliol C synthase 100.0
PLN02993763 lupeol synthase 100.0
KOG0497760 consensus Oxidosqualene-lanosterol cyclase and rel 100.0
TIGR03463634 osq_cycl 2,3-oxidosqualene cyclase. This model ide 100.0
TIGR01507635 hopene_cyclase squalene-hopene cyclase. SHC is an 100.0
TIGR01787621 squalene_cyclas squalene/oxidosqualene cyclases. T 100.0
cd02892634 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; 100.0
cd02889348 SQCY Squalene cyclase (SQCY) domain; found in clas 99.95
PF13249113 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 99.87
PLN03012759 Camelliol C synthase 99.87
PLN02993763 lupeol synthase 99.86
TIGR01507635 hopene_cyclase squalene-hopene cyclase. SHC is an 99.85
cd02896297 complement_C3_C4_C5 Proteins similar to C3, C4 and 99.84
cd02897292 A2M_2 Proteins similar to alpha2-macroglobulin (al 99.83
TIGR03463634 osq_cycl 2,3-oxidosqualene cyclase. This model ide 99.83
cd02889 348 SQCY Squalene cyclase (SQCY) domain; found in clas 99.81
COG1657517 SqhC Squalene cyclase [Lipid metabolism] 99.81
cd02896297 complement_C3_C4_C5 Proteins similar to C3, C4 and 99.79
PF13243109 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 99.78
cd02897292 A2M_2 Proteins similar to alpha2-macroglobulin (al 99.78
TIGR01787621 squalene_cyclas squalene/oxidosqualene cyclases. T 99.77
cd02892634 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; 99.76
PF07678246 A2M_comp: A-macroglobulin complement component; In 99.75
cd00688300 ISOPREN_C2_like This group contains class II terpe 99.73
cd00688300 ISOPREN_C2_like This group contains class II terpe 99.7
cd02894287 GGTase-II Geranylgeranyltransferase type II (GGTas 99.7
cd02890286 PTase Protein prenyltransferase (PTase) domain, be 99.65
PLN03201316 RAB geranylgeranyl transferase beta-subunit; Provi 99.61
cd02891282 A2M_like Proteins similar to alpha2-macroglobulin 99.6
cd02890286 PTase Protein prenyltransferase (PTase) domain, be 99.58
cd02895307 GGTase-I Geranylgeranyltransferase types I (GGTase 99.54
cd02894287 GGTase-II Geranylgeranyltransferase type II (GGTas 99.52
cd02893299 FTase Protein farnesyltransferase (FTase)_like pro 99.51
cd02893299 FTase Protein farnesyltransferase (FTase)_like pro 99.46
cd02895307 GGTase-I Geranylgeranyltransferase types I (GGTase 99.44
PLN03201 316 RAB geranylgeranyl transferase beta-subunit; Provi 99.44
PLN02710 439 farnesyltranstransferase subunit beta 99.43
PF13243109 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 99.43
PF13249113 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 99.39
KOG0366329 consensus Protein geranylgeranyltransferase type I 99.35
KOG0497760 consensus Oxidosqualene-lanosterol cyclase and rel 99.32
PLN02710 439 farnesyltranstransferase subunit beta 99.28
COG5029342 CAL1 Prenyltransferase, beta subunit [Posttranslat 99.22
cd02891282 A2M_like Proteins similar to alpha2-macroglobulin 99.18
KOG1366 1436 consensus Alpha-macroglobulin [Posttranslational m 99.12
TIGR02474290 pec_lyase pectate lyase, PelA/Pel-15E family. Memb 99.01
TIGR02474290 pec_lyase pectate lyase, PelA/Pel-15E family. Memb 98.88
KOG0366 329 consensus Protein geranylgeranyltransferase type I 98.83
COG5029342 CAL1 Prenyltransferase, beta subunit [Posttranslat 98.82
KOG0367347 consensus Protein geranylgeranyltransferase Type I 98.69
KOG0365 423 consensus Beta subunit of farnesyltransferase [Pos 98.68
KOG0367347 consensus Protein geranylgeranyltransferase Type I 98.65
PF07678 246 A2M_comp: A-macroglobulin complement component; In 98.59
COG1657517 SqhC Squalene cyclase [Lipid metabolism] 98.57
) (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF00432">PF0043244 Prenyltrans: Prenyltransferase and squalene oxidas 98.51
) (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF00432">PF0043244 Prenyltrans: Prenyltransferase and squalene oxidas 98.18
KOG0365 423 consensus Beta subunit of farnesyltransferase [Pos 98.09
PF09492289 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 98.06
PF09492289 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 97.97
PLN02592 800 ent-copalyl diphosphate synthase 97.8
COG1689274 Uncharacterized protein conserved in archaea [Func 97.68
PF01122326 Cobalamin_bind: Eukaryotic cobalamin-binding prote 97.54
PF01122326 Cobalamin_bind: Eukaryotic cobalamin-binding prote 97.41
TIGR01535 648 glucan_glucosid glucan 1,4-alpha-glucosidase. Gluc 97.28
PLN02279 784 ent-kaur-16-ene synthase 97.18
COG1689274 Uncharacterized protein conserved in archaea [Func 96.91
TIGR01577 616 oligosac_amyl oligosaccharide amylase. The name of 96.9
PF07470336 Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte 96.59
PLN02592 800 ent-copalyl diphosphate synthase 96.22
PF07470336 Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte 95.95
PLN02279 784 ent-kaur-16-ene synthase 95.41
KOG1366 1436 consensus Alpha-macroglobulin [Posttranslational m 95.35
cd00249 384 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase d 94.78
COG4225357 Predicted unsaturated glucuronyl hydrolase involve 93.05
COG2373 1621 Large extracellular alpha-helical protein [General 92.57
COG4225357 Predicted unsaturated glucuronyl hydrolase involve 90.97
COG2373 1621 Large extracellular alpha-helical protein [General 90.82
cd00249 384 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase d 90.13
TIGR01577 616 oligosac_amyl oligosaccharide amylase. The name of 89.98
COG2942 388 N-acyl-D-glucosamine 2-epimerase [Carbohydrate tra 86.11
PF10022361 DUF2264: Uncharacterized protein conserved in bact 84.27
TIGR01535 648 glucan_glucosid glucan 1,4-alpha-glucosidase. Gluc 83.87
PF07221 346 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcN 81.81
>PLN03012 Camelliol C synthase Back     alignment and domain information 
Probab=100.00  E-value=3.3e-44  Score=319.73  Aligned_cols=185  Identities=69%  Similarity=1.275  Sum_probs=173.6

Q ss_pred             hhhhhCCCCCchHHHHHHHHHHHHHHHhcccCCCcccccccchhhHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHhhccC
Q 029612            3 LFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCE   82 (190)
Q Consensus         3 ~~~~~~~~~~~~~~~~~i~~a~~~L~~~Q~~dGsw~~~~g~~~~~~Ta~al~aL~~~g~~~~~~~~i~ra~~~Ll~~Q~~   82 (190)
                      .|++.+|.++.+++++.|++|++||++.|++||||.+.||++++|.|++||.+|..+|.++.+.+.|+||++||++.|++
T Consensus       575 ~f~~~~~~~r~~~i~~~i~rAv~~L~~~Q~~DGsW~G~Wgv~y~YgT~~aL~aL~a~g~~~~~~~~Irrav~fLls~Q~~  654 (759)
T PLN03012        575 LFKQLYPDHRTEEINAFIKKAAEYIENIQMLDGSWYGNWGICFTYGTWFALAGLAAAGKTFNDCEAIRKGVHFLLAAQKD  654 (759)
T ss_pred             HHhhhCcccchhhhHHHHHHHHHHHHHhcCCCCCCcccccccCCcHHHHHHHHHHHhCccCCCcHHHHHHHHHHHHhcCC
Confidence            46777899999999999999999999999999999999999999999999999999998765679999999999999999


Q ss_pred             CCccccCCCccCCCccCCCCCCCCcHHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHhcccCCCCCCCCcccccccCcee
Q 029612           83 DGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCM  162 (190)
Q Consensus        83 DGgw~~~~~~~~~~~~~~~~~~~s~~~~Ta~al~aL~~~~~~~~~~~~i~~a~~~L~~~Q~~~Ggw~~~~~~g~~~~~~~  162 (190)
                      ||||++.+.+|..+.|.+.+++.|+++.|||||+||+.+|....++.+|+||++||+++|.+||+|.+..++|+|++.||
T Consensus       655 DGGWGEs~~Sc~~~~y~~~~~~~S~~~qTaWAl~aLi~ag~~~~~~~~i~Rg~~~Ll~~Q~~dG~W~q~~~~G~F~~~~~  734 (759)
T PLN03012        655 NGGWGESYLSCPKKIYIAQEGEISNLVQTAWALMGLIHAGQAERDPIPLHRAAKLIINSQLENGDFPQQEATGAFLKNCL  734 (759)
T ss_pred             CCCcCCCCCCCCCccccCCCCCCCcHHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHHcccCCCCCCCceeeeeeccceE
Confidence            99999999999999998865668999999999999999998766666899999999999999999999999999999999


Q ss_pred             eccCCccchHHHHHHHHHHHhhcCC
Q 029612          163 LHYPIYRNIFPMWALAEYRSRLLLP  187 (190)
Q Consensus       163 ~~~~~~~~~~~l~aL~~~~~~~~~~  187 (190)
                      ++|+.|+++|||+||++|++.+++|
T Consensus       735 i~Y~~Yr~~FPl~ALg~Y~~~~~~~  759 (759)
T PLN03012        735 LHYAAYRNIFPLWALAEYRARVPLP  759 (759)
T ss_pred             EecCccchHHHHHHHHHHHHhccCC
Confidence            9999999999999999999998876

>PLN02993 lupeol synthase Back     alignment and domain information
>KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase Back     alignment and domain information
>TIGR01507 hopene_cyclase squalene-hopene cyclase Back     alignment and domain information
>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases Back     alignment and domain information
>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C Back     alignment and domain information
>PLN03012 Camelliol C synthase Back     alignment and domain information
>PLN02993 lupeol synthase Back     alignment and domain information
>TIGR01507 hopene_cyclase squalene-hopene cyclase Back     alignment and domain information
>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement Back     alignment and domain information
>cd02897 A2M_2 Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>COG1657 SqhC Squalene cyclase [Lipid metabolism] Back     alignment and domain information
>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement Back     alignment and domain information
>PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A Back     alignment and domain information
>cd02897 A2M_2 Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases Back     alignment and domain information
>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family Back     alignment and domain information
>cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>cd02894 GGTase-II Geranylgeranyltransferase type II (GGTase-II)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02890 PTase Protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>PLN03201 RAB geranylgeranyl transferase beta-subunit; Provisional Back     alignment and domain information
>cd02891 A2M_like Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>cd02890 PTase Protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02895 GGTase-I Geranylgeranyltransferase types I (GGTase-I)-like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02894 GGTase-II Geranylgeranyltransferase type II (GGTase-II)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02893 FTase Protein farnesyltransferase (FTase)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02893 FTase Protein farnesyltransferase (FTase)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02895 GGTase-I Geranylgeranyltransferase types I (GGTase-I)-like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>PLN03201 RAB geranylgeranyl transferase beta-subunit; Provisional Back     alignment and domain information
>PLN02710 farnesyltranstransferase subunit beta Back     alignment and domain information
>PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A Back     alignment and domain information
>PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C Back     alignment and domain information
>KOG0366 consensus Protein geranylgeranyltransferase type II, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PLN02710 farnesyltranstransferase subunit beta Back     alignment and domain information
>COG5029 CAL1 Prenyltransferase, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02891 A2M_like Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>KOG1366 consensus Alpha-macroglobulin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>KOG0366 consensus Protein geranylgeranyltransferase type II, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5029 CAL1 Prenyltransferase, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0367 consensus Protein geranylgeranyltransferase Type I, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0365 consensus Beta subunit of farnesyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0367 consensus Protein geranylgeranyltransferase Type I, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family Back     alignment and domain information
>COG1657 SqhC Squalene cyclase [Lipid metabolism] Back     alignment and domain information
>PF00432 Prenyltrans: Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family Back     alignment and domain information
>PF00432 Prenyltrans: Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family Back     alignment and domain information
>KOG0365 consensus Beta subunit of farnesyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09492 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 Members of this family are isozymes of pectate lyase (4 Back     alignment and domain information
>PF09492 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 Members of this family are isozymes of pectate lyase (4 Back     alignment and domain information
>PLN02592 ent-copalyl diphosphate synthase Back     alignment and domain information
>COG1689 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF01122 Cobalamin_bind: Eukaryotic cobalamin-binding protein; InterPro: IPR002157 Cobalamin (Cbl or vitamin B12) is only accessible through diet in mammals Back     alignment and domain information
>PF01122 Cobalamin_bind: Eukaryotic cobalamin-binding protein; InterPro: IPR002157 Cobalamin (Cbl or vitamin B12) is only accessible through diet in mammals Back     alignment and domain information
>TIGR01535 glucan_glucosid glucan 1,4-alpha-glucosidase Back     alignment and domain information
>PLN02279 ent-kaur-16-ene synthase Back     alignment and domain information
>COG1689 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR01577 oligosac_amyl oligosaccharide amylase Back     alignment and domain information
>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases [] Back     alignment and domain information
>PLN02592 ent-copalyl diphosphate synthase Back     alignment and domain information
>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases [] Back     alignment and domain information
>PLN02279 ent-kaur-16-ene synthase Back     alignment and domain information
>KOG1366 consensus Alpha-macroglobulin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid Back     alignment and domain information
>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only] Back     alignment and domain information
>COG2373 Large extracellular alpha-helical protein [General function prediction only] Back     alignment and domain information
>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only] Back     alignment and domain information
>COG2373 Large extracellular alpha-helical protein [General function prediction only] Back     alignment and domain information
>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid Back     alignment and domain information
>TIGR01577 oligosac_amyl oligosaccharide amylase Back     alignment and domain information
>COG2942 N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10022 DUF2264: Uncharacterized protein conserved in bacteria (DUF2264); InterPro: IPR016624 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR01535 glucan_glucosid glucan 1,4-alpha-glucosidase Back     alignment and domain information
>PF07221 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase); InterPro: IPR010819 N-acylglucosamine 2-epimerase (AGE, 5 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1w6j_A732 Structure Of Human Osc In Complex With Ro 48-8071 L 4e-39
1w6k_A732 Structure Of Human Osc In Complex With Lanosterol L 5e-39
1gsz_A631 Crystal Structure Of A Squalene Cyclase In Complex 1e-19
3sqc_A631 Squalene-Hopene Cyclase Length = 631 1e-19
2sqc_A631 Squalene-Hopene Cyclase From Alicyclobacillus Acido 1e-19
>pdb|1W6J|A Chain A, Structure Of Human Osc In Complex With Ro 48-8071 Length = 732 Back     alignment and structure 
Iteration: 1

 Score =  157 bits (396), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 107/191 (56%), Gaps = 9/191 (4%)
Query: 1   MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAK 60
           +  F K +P+HR  E++  + +  +F    Q++DGSW GSWG+CFTY  WF +       
Sbjct: 541 LKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMG 600
Query: 61  KTYSN---CLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMS 117
           +TY +   C  + +A DFLL  Q  DGGWGE + SC  ++Y  L   +S +  T WAMM 
Sbjct: 601 QTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRY--LQSAQSQIHNTCWAMMG 658
Query: 118 LIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWAL 177
           L+       D     R  + L+  QL +GD+PQ+ + GVF ++C + Y  YRNIFP+WAL
Sbjct: 659 LMAV--RHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWAL 716
Query: 178 AEYRSRLLLPE 188
             +    L PE
Sbjct: 717 GRFSQ--LYPE 725
>pdb|1W6K|A Chain A, Structure Of Human Osc In Complex With Lanosterol Length = 732 Back     alignment and structure
>pdb|1GSZ|A Chain A, Crystal Structure Of A Squalene Cyclase In Complex With The Potential Anticholesteremic Drug Ro48-8071 Length = 631 Back     alignment and structure
>pdb|3SQC|A Chain A, Squalene-Hopene Cyclase Length = 631 Back     alignment and structure
>pdb|2SQC|A Chain A, Squalene-Hopene Cyclase From Alicyclobacillus Acidocaldarius Length = 631 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 7e-63
1w6k_A 732 Lanosterol synthase; cyclase, cholesterol, monotop 1e-05
2sqc_A631 Squalene-hopene cyclase; isomerase, triterpene cyc 1e-61
2sqc_A 631 Squalene-hopene cyclase; isomerase, triterpene cyc 8e-09
2sqc_A 631 Squalene-hopene cyclase; isomerase, triterpene cyc 2e-04
1r76_A408 Pectate lyase; A-helical structure; 2.65A {Azospir 5e-12
3q7a_B 520 Farnesyltransferase beta subunit; protein prenyltr 5e-07
3dss_B331 Geranylgeranyl transferase type-2 subunit beta; pr 1e-06
1gxm_A 332 Pectate lyase; mechanism, elimination; 1.32A {Cell 7e-05
2h6f_B 437 Protein farnesyltransferase beta subunit; ftase, f 2e-04
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Length = 732 Back     alignment and structure
 Score =  205 bits (523), Expect = 7e-63
 Identities = 70/187 (37%), Positives = 104/187 (55%), Gaps = 7/187 (3%)

Query: 1   MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAK 60
           +  F K +P+HR  E++  + +  +F    Q++DGSW GSWG+CFTY  WF +       
Sbjct: 541 LKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMG 600

Query: 61  KTYSN---CLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMS 117
           +TY +   C  + +A DFLL  Q  DGGWGE + SC  ++Y+     +S +  T WAMM 
Sbjct: 601 QTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYVQ--SAQSQIHNTCWAMMG 658

Query: 118 LIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWAL 177
           L+       D     R  + L+  QL +GD+PQ+ + GVF ++C + Y  YRNIFP+WAL
Sbjct: 659 LMAVRH--PDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWAL 716

Query: 178 AEYRSRL 184
             +    
Sbjct: 717 GRFSQLY 723
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Length = 732 Back     alignment and structure
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Length = 631 Back     alignment and structure
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Length = 631 Back     alignment and structure
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Length = 631 Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Length = 408 Back     alignment and structure
>3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* Length = 520 Back     alignment and structure
>3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* Length = 331 Back     alignment and structure
>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* Length = 332 Back     alignment and structure
>2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... Length = 437 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 100.0
2sqc_A631 Squalene-hopene cyclase; isomerase, triterpene cyc 99.98
1qqf_A277 Protein (complement C3DG); alpha-alpha barrel, imm 99.85
1hzf_A367 Complement factor C4A; alpha-alpha 6 barrel, immun 99.84
3dss_B331 Geranylgeranyl transferase type-2 subunit beta; pr 99.84
2wy7_A310 Complement C3D fragment; immune system, immune res 99.84
2h6f_B 437 Protein farnesyltransferase beta subunit; ftase, f 99.83
2h6f_B 437 Protein farnesyltransferase beta subunit; ftase, f 99.82
1n4q_B377 Geranyltransferase type-I beta subunit; protein ge 99.79
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 99.78
1qqf_A277 Protein (complement C3DG); alpha-alpha barrel, imm 99.77
2sqc_A631 Squalene-hopene cyclase; isomerase, triterpene cyc 99.77
3dss_B331 Geranylgeranyl transferase type-2 subunit beta; pr 99.75
3q7a_B 520 Farnesyltransferase beta subunit; protein prenyltr 99.73
2wy7_A310 Complement C3D fragment; immune system, immune res 99.72
4acq_A 1451 Alpha-2-macroglobulin; hydrolase inhibitor, protei 99.7
4fxk_B 767 Complement C4-A alpha chain; immune system, proteo 99.65
2hr0_B 915 Complement C3 alpha' chain; complement component C 99.63
1n4q_B 377 Geranyltransferase type-I beta subunit; protein ge 99.57
3prx_B 1642 Cobra venom factor; immune system, complement, imm 99.55
2pn5_A 1325 TEP1R, thioester-containing protein I; FULL-length 99.55
1r76_A408 Pectate lyase; A-helical structure; 2.65A {Azospir 99.54
3q7a_B 520 Farnesyltransferase beta subunit; protein prenyltr 99.52
2hr0_B 915 Complement C3 alpha' chain; complement component C 99.44
1r76_A408 Pectate lyase; A-helical structure; 2.65A {Azospir 99.44
2b39_A 1661 C3; thioester, immune defense, immune system; HET: 99.42
1gxm_A332 Pectate lyase; mechanism, elimination; 1.32A {Cell 99.4
2pn5_A 1325 TEP1R, thioester-containing protein I; FULL-length 99.35
3cu7_A 1676 Complement C5; Mg domain, inflammation, anaphylato 99.27
1gxm_A332 Pectate lyase; mechanism, elimination; 1.32A {Cell 99.24
3dra_B390 Geranylgeranyltransferase type I beta subunit; ger 99.22
1hzf_A 367 Complement factor C4A; alpha-alpha 6 barrel, immun 99.12
3dra_B390 Geranylgeranyltransferase type I beta subunit; ger 99.08
2bb6_A 414 TCII, TC II, transcobalamin II; alpha_6 - alpha_6 99.04
2pmv_A 399 Gastric intrinsic factor; cobalamin transport prot 98.85
4acq_A 1451 Alpha-2-macroglobulin; hydrolase inhibitor, protei 98.63
2bb6_A414 TCII, TC II, transcobalamin II; alpha_6 - alpha_6 98.52
2pmv_A399 Gastric intrinsic factor; cobalamin transport prot 98.43
4fxk_B 767 Complement C4-A alpha chain; immune system, proteo 98.27
3sdr_A 817 Alpha-bisabolene synthase; lyase, terpene synthase 98.01
2b39_A 1661 C3; thioester, immune defense, immune system; HET: 97.96
3s9v_A 785 Abietadiene synthase, chloroplastic; alpha bundle/ 97.86
3p5p_A 764 Taxadiene synthase; class I and II terpene cyclase 97.84
3pya_A 727 ENT-copalyl diphosphate synthase, chloroplastic; c 97.78
3prx_B 1642 Cobra venom factor; immune system, complement, imm 97.77
3cu7_A 1676 Complement C5; Mg domain, inflammation, anaphylato 97.57
3pmm_A382 Putative cytoplasmic protein; structural genomics, 96.96
3pya_A 727 ENT-copalyl diphosphate synthase, chloroplastic; c 96.73
3p5p_A 764 Taxadiene synthase; class I and II terpene cyclase 96.67
3s9v_A 785 Abietadiene synthase, chloroplastic; alpha bundle/ 96.66
3sdr_A 817 Alpha-bisabolene synthase; lyase, terpene synthase 96.64
1lf6_A 684 Glucoamylase; (alpha/alpha) barrel, 6 alpha-helica 96.51
1nc5_A373 Hypothetical protein YTER; structural genomics, he 96.27
1ulv_A 1020 Glucodextranase; GH family 15, (alpha-alpha)6-barr 95.74
3pmm_A382 Putative cytoplasmic protein; structural genomics, 95.06
2gz6_A 388 N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C 94.76
3k11_A445 Putative glycosyl hydrolase; structural genomics, 93.23
1nc5_A373 Hypothetical protein YTER; structural genomics, he 93.15
2gz6_A 388 N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C 92.35
3k11_A445 Putative glycosyl hydrolase; structural genomics, 90.51
3gt5_A 402 N-acetylglucosamine 2-epimerase; structural genomi 89.92
3gt5_A 402 N-acetylglucosamine 2-epimerase; structural genomi 88.79
1fp3_A 402 N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr 88.11
2vn4_A 599 Glucoamylase; hydrolase, carbohydrate binding, gly 86.58
1fp3_A 402 N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr 84.79
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 83.31
2ahf_A377 Unsaturated glucuronyl hydrolase; alpha6/alpha6 ba 83.16
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Back     alignment and structure
Probab=100.00  E-value=2.6e-33  Score=252.48  Aligned_cols=180  Identities=38%  Similarity=0.861  Sum_probs=157.6

Q ss_pred             hhhCCCCCchHHHHHHHHHHHHHHHhcccCCCcccccccchhhHHHHHHHHHHhcCCCCCcH---HHHHHHHHHHHhhcc
Q 029612            5 KKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNC---LAIRKATDFLLKIQC   81 (190)
Q Consensus         5 ~~~~~~~~~~~~~~~i~~a~~~L~~~Q~~dGsw~~~~g~~~~~~Ta~al~aL~~~g~~~~~~---~~i~ra~~~Ll~~Q~   81 (190)
                      .+.+|.++.++.++.|++|++||++.|++||+|.+.||.+++|.|++++.+|..+|....++   +.++|+++||+++|+
T Consensus       545 ~~~~~~~~~~~~~~~i~rAv~yL~~~Q~~DGsW~g~wg~~~~Y~T~~al~AL~~aG~~~~~~~~~~~i~rav~~Lls~Q~  624 (732)
T 1w6k_A          545 HKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQM  624 (732)
T ss_dssp             HHHCTTSSHHHHHHHHHHHHHHHHHHSCTTSCCCCSSBSSHHHHHHHHHHHHHHTTCCCBTTBCCHHHHHHHHHHHTTCC
T ss_pred             ccccccccchhhHHHHHHHHHHHHhhcCCCCCccCcCCCccchHHHHHHHHHHHhCCcccccchhHHHHHHHHHHHHhcc
Confidence            34467777788889999999999999999999999999999999999999999999864333   799999999999999


Q ss_pred             CCCccccCCCccCCCccCCCCCCCCcHHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHhcccCCCCCCCCcccccccCce
Q 029612           82 EDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENC  161 (190)
Q Consensus        82 ~DGgw~~~~~~~~~~~~~~~~~~~s~~~~Ta~al~aL~~~~~~~~~~~~i~~a~~~L~~~Q~~~Ggw~~~~~~g~~~~~~  161 (190)
                      +||||++...++....|.+  +..+++..|+|||++|..++..  +..+++++++||+++|+++|+|.++.++|+||+.|
T Consensus       625 ~DGGWge~~~s~~~~~y~~--~~~s~v~~TAwALlALl~ag~~--~~~~i~r~v~wL~~~Q~~~Ggf~~~~~~g~f~~~~  700 (732)
T 1w6k_A          625 ADGGWGEDFESCEERRYVQ--SAQSQIHNTCWAMMGLMAVRHP--DIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSC  700 (732)
T ss_dssp             TTSCCCBCTHHHHHTSCCB--CSSCCHHHHHHHHHHHHHTTCS--CHHHHHHHHHHHHHHCCTTSCCCCCSCCEEETTTE
T ss_pred             cCCCCCCCCccccccccCC--CCCCCHHHHHHHHHHHHHcCCC--ChHHHHHHHHHHHHhcCCCCCccCCcccccccchh
Confidence            9999998655554444554  4578999999999999998765  44589999999999999999999999999999999


Q ss_pred             eeccCCccchHHHHHHHHHHHhhcCCc
Q 029612          162 MLHYPIYRNIFPMWALAEYRSRLLLPE  188 (190)
Q Consensus       162 ~~~~~~~~~~~~l~aL~~~~~~~~~~~  188 (190)
                      +++|+.|+++|+|+||++|+++.+.++
T Consensus       701 ~i~Y~~y~~~fpl~AL~~y~~~~~~~~  727 (732)
T 1w6k_A          701 AISYTSYRNIFPIWALGRFSQLYPERA  727 (732)
T ss_dssp             EECCTTHHHHHHHHHHHHHHHHCTTSG
T ss_pred             hhcccchhHHHHHHHHHHHHHhcchhh
Confidence            999999999999999999999776543
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Back     alignment and structure
>1qqf_A Protein (complement C3DG); alpha-alpha barrel, immune system; 1.45A {Rattus norvegicus} SCOP: a.102.4.4 PDB: 1qsj_A 3d5r_A 2noj_A 2gox_A 3d5s_A 1c3d_A 2xqw_A Back     alignment and structure
>1hzf_A Complement factor C4A; alpha-alpha 6 barrel, immune system; 2.30A {Homo sapiens} SCOP: a.102.4.4 Back     alignment and structure
>3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* 4ehm_B* 4gts_B* 4gtt_B* 4gtv_B* Back     alignment and structure
>2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A Back     alignment and structure
>2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... Back     alignment and structure
>2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... Back     alignment and structure
>1n4q_B Geranyltransferase type-I beta subunit; protein geranylgeranyltransferase type-I, ggtase; HET: MGM GER; 2.40A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1n4p_B* 1n4r_B* 1n4s_B* 1s64_B* 1tnb_B* 1tno_B* 1tnu_B* 1tny_B* 1tnz_B* Back     alignment and structure
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Back     alignment and structure
>1qqf_A Protein (complement C3DG); alpha-alpha barrel, immune system; 1.45A {Rattus norvegicus} SCOP: a.102.4.4 PDB: 1qsj_A 3d5r_A 2noj_A 2gox_A 3d5s_A 1c3d_A 2xqw_A Back     alignment and structure
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Back     alignment and structure
>3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* 4ehm_B* 4gts_B* 4gtt_B* 4gtv_B* Back     alignment and structure
>3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* Back     alignment and structure
>2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A Back     alignment and structure
>4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} Back     alignment and structure
>4fxk_B Complement C4-A alpha chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_B* Back     alignment and structure
>2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... Back     alignment and structure
>1n4q_B Geranyltransferase type-I beta subunit; protein geranylgeranyltransferase type-I, ggtase; HET: MGM GER; 2.40A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1n4p_B* 1n4r_B* 1n4s_B* 1s64_B* 1tnb_B* 1tno_B* 1tnu_B* 1tny_B* 1tnz_B* Back     alignment and structure
>3prx_B Cobra venom factor; immune system, complement, immune SYS complex; HET: NAG; 4.30A {Naja kaouthia} PDB: 3pvm_B* Back     alignment and structure
>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Back     alignment and structure
>3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* Back     alignment and structure
>2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure
>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* Back     alignment and structure
>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A Back     alignment and structure
>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* Back     alignment and structure
>3dra_B Geranylgeranyltransferase type I beta subunit; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hzf_A Complement factor C4A; alpha-alpha 6 barrel, immune system; 2.30A {Homo sapiens} SCOP: a.102.4.4 Back     alignment and structure
>3dra_B Geranylgeranyltransferase type I beta subunit; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* Back     alignment and structure
>2pmv_A Gastric intrinsic factor; cobalamin transport protein alpha6-alpha6 motif two domain P transport protein; HET: NAG B12; 2.60A {Homo sapiens} PDB: 3kq4_A* Back     alignment and structure
>4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} Back     alignment and structure
>2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* Back     alignment and structure
>2pmv_A Gastric intrinsic factor; cobalamin transport protein alpha6-alpha6 motif two domain P transport protein; HET: NAG B12; 2.60A {Homo sapiens} PDB: 3kq4_A* Back     alignment and structure
>4fxk_B Complement C4-A alpha chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_B* Back     alignment and structure
>3sdr_A Alpha-bisabolene synthase; lyase, terpene synthase; HET: 210; 1.86A {Abies grandis} PDB: 3sdq_A 3sae_A* 3sdt_A* 3sdu_A* 3sdv_A* Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure
>3s9v_A Abietadiene synthase, chloroplastic; alpha bundle/barrel, lyase, isomerase; 2.30A {Abies grandis} Back     alignment and structure
>3p5p_A Taxadiene synthase; class I and II terpene cyclase fold, diterpene cyclase, DDXX NSE/DTE motif, 3-azacopalyl diphosphate; HET: A3C; 1.82A {Taxus brevifolia} PDB: 3p5r_A* Back     alignment and structure
>3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A* Back     alignment and structure
>3prx_B Cobra venom factor; immune system, complement, immune SYS complex; HET: NAG; 4.30A {Naja kaouthia} PDB: 3pvm_B* Back     alignment and structure
>3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A Back     alignment and structure
>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A Back     alignment and structure
>3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A* Back     alignment and structure
>3p5p_A Taxadiene synthase; class I and II terpene cyclase fold, diterpene cyclase, DDXX NSE/DTE motif, 3-azacopalyl diphosphate; HET: A3C; 1.82A {Taxus brevifolia} PDB: 3p5r_A* Back     alignment and structure
>3s9v_A Abietadiene synthase, chloroplastic; alpha bundle/barrel, lyase, isomerase; 2.30A {Abies grandis} Back     alignment and structure
>3sdr_A Alpha-bisabolene synthase; lyase, terpene synthase; HET: 210; 1.86A {Abies grandis} PDB: 3sdq_A 3sae_A* 3sdt_A* 3sdu_A* 3sdv_A* Back     alignment and structure
>1lf6_A Glucoamylase; (alpha/alpha) barrel, 6 alpha-helical hairpin torroid, super beta sandwich, carbohydrase family GH15; 2.10A {Thermoanaerobacteriumthermosaccharolyticum} SCOP: a.102.1.5 b.30.5.5 PDB: 1lf9_A* Back     alignment and structure
>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A* Back     alignment and structure
>1ulv_A Glucodextranase; GH family 15, (alpha-alpha)6-barrel, SLH domain, hydrolase; HET: ACR; 2.42A {Arthrobacter globiformis} SCOP: a.102.1.5 b.1.18.2 b.1.9.3 b.30.5.5 PDB: 1ug9_A* Back     alignment and structure
>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A Back     alignment and structure
>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Back     alignment and structure
>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A* Back     alignment and structure
>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Back     alignment and structure
>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Back     alignment and structure
>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Back     alignment and structure
>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Back     alignment and structure
>2vn4_A Glucoamylase; hydrolase, carbohydrate binding, glycoside hydrolase family 15, amyloglucosidase; HET: MAN NAG BTB; 1.85A {Hypocrea jecorina} PDB: 2vn7_A* Back     alignment and structure
>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ahf_A Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, glycoside hydrolase family 88; 1.52A {Bacillus SP} PDB: 2ahg_A* 2fv0_A* 2fv1_A* 2d5j_A 1vd5_A 2fuz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d1w6ka1448 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase { 4e-71
d1w6ka1 448 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase { 1e-05
d2sqca1352 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cycla 2e-60
d2sqca1 352 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cycla 6e-06
d2sqca1 352 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cycla 2e-05
d1r76a_408 a.102.5.1 (A:) Polygalacturonic acid lyase (pectat 6e-09
d1r76a_408 a.102.5.1 (A:) Polygalacturonic acid lyase (pectat 6e-05
d3dssb1325 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, 2e-08
d3dssb1 325 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, 0.001
d1gxma_ 324 a.102.5.1 (A:) Polygalacturonic acid lyase (pectat 9e-06
d1gxma_ 324 a.102.5.1 (A:) Polygalacturonic acid lyase (pectat 4e-05
d1gxma_324 a.102.5.1 (A:) Polygalacturonic acid lyase (pectat 0.001
d2h6fb1401 a.102.4.3 (B:521-921) Protein farnesyltransferase, 1e-05
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 448 Back     information, alignment and structure

class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Terpenoid cyclases/Protein prenyltransferases
family: Terpene synthases
domain: Lanosterol synthase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  220 bits (561), Expect = 4e-71
 Identities = 70/186 (37%), Positives = 104/186 (55%), Gaps = 7/186 (3%)

Query: 1   MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAK 60
           +  F K +P+HR  E++  + +  +F    Q++DGSW GSWG+CFTY  WF +       
Sbjct: 257 LKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMG 316

Query: 61  KTYSN---CLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMS 117
           +TY +   C  + +A DFLL  Q  DGGWGE + SC  ++Y+     +S +  T WAMM 
Sbjct: 317 QTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYVQ--SAQSQIHNTCWAMMG 374

Query: 118 LIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFMENCMLHYPIYRNIFPMWAL 177
           L+       D     R  + L+  QL +GD+PQ+ + GVF ++C + Y  YRNIFP+WAL
Sbjct: 375 LMAVR--HPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWAL 432

Query: 178 AEYRSR 183
             +   
Sbjct: 433 GRFSQL 438
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 448 Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 352 Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 352 Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 352 Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Length = 408 Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Length = 408 Back     information, alignment and structure
>d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 325 Back     information, alignment and structure
>d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 325 Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Length = 324 Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Length = 324 Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Length = 324 Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d1w6ka1448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 100.0
d2sqca1352 Squalene-hopene cyclase {Alicyclobacillus acidocal 100.0
d2sqca1352 Squalene-hopene cyclase {Alicyclobacillus acidocal 99.88
d1w6ka1448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 99.82
d1hzfa_326 C4adg fragment of complement factor C4a {Human (Ho 99.68
d3dssb1325 Rab geranylgeranyltransferase, beta subunit {Rat ( 99.67
d1c3da_294 C3D, a C3 fragment and ligand for complement recep 99.59
d3dssb1 325 Rab geranylgeranyltransferase, beta subunit {Rat ( 99.53
d2h6fb1401 Protein farnesyltransferase, beta-subunit {Human ( 99.51
d2sqca2271 Squalene-hopene cyclase {Alicyclobacillus acidocal 99.47
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azosp 99.44
d2h6fb1 401 Protein farnesyltransferase, beta-subunit {Human ( 99.44
d1n4qb_346 Protein farnesyltransferase, beta-subunit {Rat (Ra 99.37
d2sqca2 271 Squalene-hopene cyclase {Alicyclobacillus acidocal 99.21
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azosp 99.19
d1gxma_324 Polygalacturonic acid lyase (pectate lyase) {Cellv 99.13
d1n4qb_346 Protein farnesyltransferase, beta-subunit {Rat (Ra 99.12
d1gxma_324 Polygalacturonic acid lyase (pectate lyase) {Cellv 99.09
d1w6ka2 279 Lanosterol synthase {Human (Homo sapiens) [TaxId: 98.93
d1hzfa_ 326 C4adg fragment of complement factor C4a {Human (Ho 98.53
d1w6ka2279 Lanosterol synthase {Human (Homo sapiens) [TaxId: 98.47
d1c3da_ 294 C3D, a C3 fragment and ligand for complement recep 98.24
d1lf6a1 397 Bacterial glucoamylase, C-terminal domain {Thermoa 97.68
d1ulva1 413 Glucodextranase, domain A {Arthrobacter globiformi 97.48
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxI 94.16
d1fp3a_ 402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 93.7
d1lf6a1 397 Bacterial glucoamylase, C-terminal domain {Thermoa 91.3
d1fp3a_ 402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 89.59
d2d5ja1377 Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 88.61
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxI 88.48
d1ulva1 413 Glucodextranase, domain A {Arthrobacter globiformi 83.51
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Terpenoid cyclases/Protein prenyltransferases
family: Terpene synthases
domain: Lanosterol synthase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.3e-41  Score=289.35  Aligned_cols=182  Identities=38%  Similarity=0.888  Sum_probs=165.0

Q ss_pred             hhhhhCCCCCchHHHHHHHHHHHHHHHhcccCCCcccccccchhhHHHHHHHHHHhcCCCC---CcHHHHHHHHHHHHhh
Q 029612            3 LFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTY---SNCLAIRKATDFLLKI   79 (190)
Q Consensus         3 ~~~~~~~~~~~~~~~~~i~~a~~~L~~~Q~~dGsw~~~~g~~~~~~Ta~al~aL~~~g~~~---~~~~~i~ra~~~Ll~~   79 (190)
                      .|...+|.++.+++++.|+++++||++.|++||+|.+.||.++++.|+++|.+|..+|...   ...+.|+||++||++.
T Consensus       259 ~~~~~~p~~r~~~~~~~i~ral~yL~~~Q~~DGsW~g~wg~~~~ygT~~al~aL~~~G~~~~~~~~~~~v~ka~~wLls~  338 (448)
T d1w6ka1         259 YFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSR  338 (448)
T ss_dssp             HHHHHCTTSSHHHHHHHHHHHHHHHHHHSCTTSCCCCSSBSSHHHHHHHHHHHHHHTTCCCBTTBCCHHHHHHHHHHHTT
T ss_pred             HHhhhCCccccccchHHHHHHHHHHHccCCCCCcccccCCCcccHHHHHHHHHHHHhCcCcccccccHHHHHHHHHHHhc
Confidence            4667789999999999999999999999999999999999999999999999999998653   2358999999999999


Q ss_pred             ccCCCccccCCCccCCCccCCCCCCCCcHHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHhcccCCCCCCCCcccccccC
Q 029612           80 QCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQELTGVFME  159 (190)
Q Consensus        80 Q~~DGgw~~~~~~~~~~~~~~~~~~~s~~~~Ta~al~aL~~~~~~~~~~~~i~~a~~~L~~~Q~~~Ggw~~~~~~g~~~~  159 (190)
                      |++||||++...++..+.|.+  +..|+++.|||||+||..++..  +..+|+||++||+++|++||+|++..++|+||+
T Consensus       339 Q~~DGGWge~~~s~~~~~~~~--~~~s~~~~TAwAl~aL~~ag~~--~~~~v~rgv~~L~~~Q~~~G~W~~~~~~g~f~~  414 (448)
T d1w6ka1         339 QMADGGWGEDFESCEERRYVQ--SAQSQIHNTCWAMMGLMAVRHP--DIEAQERGVRCLLEKQLPNGDWPQENIAGVFNK  414 (448)
T ss_dssp             CCTTSCCCBCTHHHHHTSCCB--CSSCCHHHHHHHHHHHHHTTCS--CHHHHHHHHHHHHHHCCTTSCCCCCSCCEEETT
T ss_pred             cCCCCCccCCCccccCcccCC--CCCCcHHHHHHHHHHHHhcCCC--CcHHHHHHHHHHHHccCCCCCCCCCceeeeecc
Confidence            999999999877777666765  6789999999999999999864  345999999999999999999999999999999


Q ss_pred             ceeeccCCccchHHHHHHHHHHHhhcCCc
Q 029612          160 NCMLHYPIYRNIFPMWALAEYRSRLLLPE  188 (190)
Q Consensus       160 ~~~~~~~~~~~~~~l~aL~~~~~~~~~~~  188 (190)
                      .||++|+.|+++|||+||++|+++.+-..
T Consensus       415 ~~~l~Y~~Y~~~fpl~AL~ry~~~~~~~~  443 (448)
T d1w6ka1         415 SCAISYTSYRNIFPIWALGRFSQLYPERA  443 (448)
T ss_dssp             TEEECCTTHHHHHHHHHHHHHHHHCTTSG
T ss_pred             cceeecCCcchHHHHHHHHHHHHhCCccc
Confidence            99999999999999999999999876443
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c3da_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4qb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Back     information, alignment and structure
>d1n4qb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Back     information, alignment and structure
>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c3da_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lf6a1 a.102.1.5 (A:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} Back     information, alignment and structure
>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lf6a1 a.102.1.5 (A:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} Back     information, alignment and structure
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure