Citrus Sinensis ID: 029675


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKVSSLTSSES
cccHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHcccccEEEcccccEEEcEEEEccEEEEEEEcccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccc
cccHHHHHcccccccccEEEEEEEcccccHHHHHHHHccccEEEEEEEccEEEEEEEEccEEEEEEEccccccccHHHHHHHHHEEEEEEEEEcccHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccHHHHHHHHcccccccccEEEEEcEccccEcHHHHHHHHHHHccccccccccccc
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFtvwdvggqdkirpLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFAnkqdlpnamnaAEITDKLGLHSLRQRHWYIQstcatsgeglyEGLDWLSNNIASKVSSLTSSES
mgltftklFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGlifvvdsndrDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNniaskvssltsses
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKVSSLTSSES
***TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI************
*GLT*TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA***********
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAS**********
*GLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKVSSLTSSES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q06396181 ADP-ribosylation factor 1 yes no 0.952 0.994 0.994 1e-103
O48920181 ADP-ribosylation factor O N/A no 0.952 0.994 0.988 1e-103
P51823181 ADP-ribosylation factor 2 yes no 0.952 0.994 0.988 1e-103
P51822181 ADP-ribosylation factor 1 N/A no 0.952 0.994 0.988 1e-103
P36397181 ADP-ribosylation factor 1 yes no 0.952 0.994 0.988 1e-102
P0DH91181 ADP-ribosylation factor 2 yes no 0.952 0.994 0.983 1e-102
Q9LQC8181 ADP-ribosylation factor 2 yes no 0.952 0.994 0.983 1e-102
P49076181 ADP-ribosylation factor O N/A no 0.952 0.994 0.977 1e-102
O48649181 ADP-ribosylation factor 1 N/A no 0.957 1.0 0.961 1e-100
O23778181 ADP-ribosylation factor 1 N/A no 0.952 0.994 0.966 1e-100
>sp|Q06396|ARF1_ORYSJ ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3 Back     alignment and function desciption
 Score =  374 bits (960), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/180 (99%), Positives = 180/180 (100%)

Query: 1   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60
           MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct: 1   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60

Query: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120
           ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV 120

Query: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 180
           LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK
Sbjct: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 180




GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|O48920|ARF_VIGUN ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3 Back     alignment and function description
>sp|P51823|ARF2_ORYSJ ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2 Back     alignment and function description
>sp|P51822|ARF1_DAUCA ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2 Back     alignment and function description
>sp|P36397|ARF1_ARATH ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2 Back     alignment and function description
>sp|P0DH91|ARF2B_ARATH ADP-ribosylation factor 2-B OS=Arabidopsis thaliana GN=ARF2-B PE=2 SV=1 Back     alignment and function description
>sp|Q9LQC8|ARF2A_ARATH ADP-ribosylation factor 2-A OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=2 Back     alignment and function description
>sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2 Back     alignment and function description
>sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3 Back     alignment and function description
>sp|O23778|ARF1_CATRO ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
413932673206 hypothetical protein ZEAMMB73_332083 [Ze 1.0 0.917 0.957 1e-103
20161472 376 ADP-ribosylation factor [Oryza sativa Ja 0.952 0.478 0.994 1e-103
357495837248 ADP-ribosylation factor [Medicago trunca 0.957 0.729 0.994 1e-103
449446863 368 PREDICTED: ADP-ribosylation factor 1-lik 0.968 0.497 0.989 1e-103
125546170 354 hypothetical protein OsI_14032 [Oryza sa 0.952 0.508 0.988 1e-102
357511441206 ADP-ribosylation factor-like protein [Me 0.962 0.883 0.989 1e-102
6573751186 F20B24.7 [Arabidopsis thaliana] 0.984 1.0 0.973 1e-102
15241463188 ADP-ribosylation factor A1B [Arabidopsis 0.973 0.978 0.978 1e-102
449434939189 PREDICTED: ADP-ribosylation factor 2-lik 0.962 0.962 0.989 1e-102
357485863 454 ADP-ribosylation factor [Medicago trunca 0.952 0.396 0.994 1e-102
>gi|413932673|gb|AFW67224.1| hypothetical protein ZEAMMB73_332083 [Zea mays] Back     alignment and taxonomy information
 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/189 (95%), Positives = 185/189 (97%)

Query: 1   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60
           MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct: 1   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60

Query: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120
           ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120

Query: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 180
           LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+K
Sbjct: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATK 180

Query: 181 VSSLTSSES 189
           VSS   S +
Sbjct: 181 VSSPIMSPT 189




Source: Zea mays

Species: Zea mays

Genus: Zea

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|20161472|dbj|BAB90396.1| ADP-ribosylation factor [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357495837|ref|XP_003618207.1| ADP-ribosylation factor [Medicago truncatula] gi|355493222|gb|AES74425.1| ADP-ribosylation factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|449446863|ref|XP_004141190.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|125546170|gb|EAY92309.1| hypothetical protein OsI_14032 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|357511441|ref|XP_003626009.1| ADP-ribosylation factor-like protein [Medicago truncatula] gi|355501024|gb|AES82227.1| ADP-ribosylation factor-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|6573751|gb|AAF17671.1|AC009398_20 F20B24.7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15241463|ref|NP_196971.1| ADP-ribosylation factor A1B [Arabidopsis thaliana] gi|7573316|emb|CAB87634.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana] gi|332004678|gb|AED92061.1| ADP-ribosylation factor A1B [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449434939|ref|XP_004135253.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis sativus] gi|449517565|ref|XP_004165816.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357485863|ref|XP_003613219.1| ADP-ribosylation factor [Medicago truncatula] gi|355514554|gb|AES96177.1| ADP-ribosylation factor [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2222677188 ARFA1B "ADP-ribosylation facto 0.973 0.978 0.978 4.8e-94
UNIPROTKB|P51823181 ARF "ADP-ribosylation factor 2 0.952 0.994 0.988 4.3e-93
TAIR|locus:2019948181 ARFA1F "ADP-ribosylation facto 0.952 0.994 0.988 7e-93
TAIR|locus:2065114181 ARF1A1C [Arabidopsis thaliana 0.952 0.994 0.988 1.1e-92
TAIR|locus:2028926181 ARF1 "ADP-ribosylation factor 0.952 0.994 0.983 1.9e-92
TAIR|locus:2026780181 ARFA1D [Arabidopsis thaliana ( 0.952 0.994 0.983 1.9e-92
TAIR|locus:2098063181 ARFA1E "ADP-ribosylation facto 0.952 0.994 0.977 5e-92
UNIPROTKB|P84081181 ARF2 "ADP-ribosylation factor 0.952 0.994 0.888 5e-83
UNIPROTKB|J9NWP6181 LOC480487 "Uncharacterized pro 0.952 0.994 0.888 5e-83
MGI|MGI:99595181 Arf2 "ADP-ribosylation factor 0.952 0.994 0.888 5e-83
TAIR|locus:2222677 ARFA1B "ADP-ribosylation factor A1B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 936 (334.5 bits), Expect = 4.8e-94, P = 4.8e-94
 Identities = 180/184 (97%), Positives = 183/184 (99%)

Query:     1 MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60
             MGL FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct:     1 MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60

Query:    61 ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120
             ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct:    61 ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120

Query:   121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 180
             LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K
Sbjct:   121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIATK 180

Query:   181 VSSL 184
             V++L
Sbjct:   181 VNNL 184




GO:0005525 "GTP binding" evidence=IEA;ISS;TAS
GO:0005622 "intracellular" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0016004 "phospholipase activator activity" evidence=TAS
GO:0005829 "cytosol" evidence=RCA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
UNIPROTKB|P51823 ARF "ADP-ribosylation factor 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2019948 ARFA1F "ADP-ribosylation factor A1F" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065114 ARF1A1C [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028926 ARF1 "ADP-ribosylation factor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026780 ARFA1D [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098063 ARFA1E "ADP-ribosylation factor A1E" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P84081 ARF2 "ADP-ribosylation factor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWP6 LOC480487 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:99595 Arf2 "ADP-ribosylation factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O48920ARF_VIGUNNo assigned EC number0.98880.95230.9944N/Ano
P51644ARF4_XENLANo assigned EC number0.82220.95231.0N/Ano
O00909ARF1_DICDINo assigned EC number0.86590.94700.9835yesno
P51643ARF1_XENLANo assigned EC number0.88330.95230.9944N/Ano
P91924ARF_DUGJANo assigned EC number0.87770.95230.9836N/Ano
P36397ARF1_ARATHNo assigned EC number0.98880.95230.9944yesno
Q61LA8ARF12_CAEBRNo assigned EC number0.87220.95230.9944N/Ano
Q7RVM2ARF_NEUCRNo assigned EC number0.88060.93120.9513N/Ano
Q3SZF2ARF4_BOVINNo assigned EC number0.82220.95231.0nono
P61210ARF1_LOCMINo assigned EC number0.87700.94700.9835N/Ano
P84082ARF2_RATNo assigned EC number0.88880.95230.9944yesno
P84083ARF5_RATNo assigned EC number0.81110.95231.0nono
P84080ARF1_BOVINNo assigned EC number0.88330.95230.9944yesno
P84081ARF2_BOVINNo assigned EC number0.88880.95230.9944yesno
Q5R5P7ARF3_PONABNo assigned EC number0.87220.95230.9944yesno
Q10943ARF12_CAEELNo assigned EC number0.86660.95230.9944nono
P84084ARF5_MOUSENo assigned EC number0.81110.95231.0nono
P22274ARF_CANALNo assigned EC number0.82580.94170.9944N/Ano
P51822ARF1_DAUCANo assigned EC number0.98880.95230.9944N/Ano
P51823ARF2_ORYSJNo assigned EC number0.98880.95230.9944yesno
P51821ARF1_CHLRENo assigned EC number0.96110.95230.9944N/Ano
P51824ARF1_SOLTUNo assigned EC number0.90900.98940.9492N/Ano
P84077ARF1_HUMANNo assigned EC number0.88330.95230.9944yesno
P36579ARF1_SCHPONo assigned EC number0.85550.95231.0yesno
P84085ARF5_HUMANNo assigned EC number0.81110.95231.0nono
P61209ARF1_DROMENo assigned EC number0.87700.94700.9835yesno
P84079ARF1_RATNo assigned EC number0.88330.95230.9944yesno
P84078ARF1_MOUSENo assigned EC number0.88330.95230.9944yesno
P18085ARF4_HUMANNo assigned EC number0.81110.95231.0nono
P0CM17ARF_CRYNBNo assigned EC number0.86660.95230.9890N/Ano
P0CM16ARF_CRYNJNo assigned EC number0.86660.95230.9890yesno
Q06396ARF1_ORYSJNo assigned EC number0.99440.95230.9944yesno
P40945ARF2_DROMENo assigned EC number0.84440.95231.0nono
P61205ARF3_MOUSENo assigned EC number0.87220.95230.9944nono
P61204ARF3_HUMANNo assigned EC number0.87220.95230.9944yesno
P61207ARF3_TAKRUNo assigned EC number0.87220.95230.9944N/Ano
P61206ARF3_RATNo assigned EC number0.87220.95230.9944nono
O48649ARF1_SALBANo assigned EC number0.96130.95761.0N/Ano
Q8BSL7ARF2_MOUSENo assigned EC number0.88880.95230.9944yesno
Q5RCF1ARF4_PONABNo assigned EC number0.81110.95231.0nono
Q9LQC8ARF2A_ARATHNo assigned EC number0.98330.95230.9944yesno
P49076ARF_MAIZENo assigned EC number0.97770.95230.9944N/Ano
Q4R5P2ARF1_MACFANo assigned EC number0.88330.95230.9944N/Ano
P34727ARF_AJECANo assigned EC number0.85310.93650.9672N/Ano
Q5E9I6ARF3_BOVINNo assigned EC number0.87220.95230.9944nono
P49702ARF5_CHICKNo assigned EC number0.80.95231.0nono
P0DH91ARF2B_ARATHNo assigned EC number0.98330.95230.9944yesno
Q75A26ARF_ASHGONo assigned EC number0.82220.95230.9944yesno
P61751ARF4_RATNo assigned EC number0.81110.95231.0nono
O23778ARF1_CATRONo assigned EC number0.96660.95230.9944N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
PLN00223181 PLN00223, PLN00223, ADP-ribosylation factor; Provi 1e-137
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 1e-129
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 1e-127
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 1e-122
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 1e-113
cd04149168 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) 1e-108
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 1e-105
cd04151158 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) 3e-93
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 1e-87
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 7e-71
cd04154173 cd04154, Arl2, Arf-like 2 (Arl2) GTPase 2e-69
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 1e-68
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 6e-68
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 9e-61
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 2e-57
cd00879191 cd00879, Sar1, Sar1 is an essential component of C 2e-46
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 4e-42
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 1e-39
cd04162164 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp 6e-37
cd04161167 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A 1e-33
smart00178184 smart00178, SAR, Sar1p-like members of the Ras-fam 1e-30
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 5e-30
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 3e-19
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-17
cd04105202 cd04105, SR_beta, Signal recognition particle rece 3e-15
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 5e-14
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 6e-13
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 3e-12
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 6e-11
pfam00071162 pfam00071, Ras, Ras family 3e-10
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 9e-10
pfam09439181 pfam09439, SRPRB, Signal recognition particle rece 4e-09
pfam00503329 pfam00503, G-alpha, G-protein alpha subunit 8e-09
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 2e-08
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 3e-08
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 1e-07
smart00275342 smart00275, G_alpha, G protein alpha subunit 3e-07
cd04108170 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 4e-07
cd00066315 cd00066, G-alpha, Alpha subunit of G proteins (gua 7e-07
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 7e-07
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 2e-06
cd04115170 cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu 3e-06
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 3e-06
cd04117164 cd04117, Rab15, Rab GTPase family 15 (Rab15) 4e-06
cd01864165 cd01864, Rab19, Rab GTPase family 19 (Rab19) 5e-06
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 6e-06
cd00877166 cd00877, Ran, Ras-related nuclear proteins (Ran)/T 6e-06
cd04120202 cd04120, Rab12, Rab GTPase family 12 (Rab12) 1e-05
cd09914161 cd09914, RocCOR, Ras of complex proteins (Roc) C-t 1e-05
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 1e-05
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 1e-05
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 2e-05
cd04129190 cd04129, Rho2, Ras homology family 2 (Rho2) of sma 2e-05
pfam04670230 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserve 2e-05
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 3e-05
PLN03071219 PLN03071, PLN03071, GTP-binding nuclear protein Ra 4e-05
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 4e-05
pfam08477116 pfam08477, Miro, Miro-like protein 7e-05
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 7e-05
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 2e-04
cd00157171 cd00157, Rho, Ras homology family (Rho) of small g 2e-04
cd04126220 cd04126, Rab20, Rab GTPase family 20 (Rab20) 3e-04
cd01898170 cd01898, Obg, Obg GTPase 4e-04
cd09915175 cd09915, Rag, Rag GTPase subfamily of Ras-related 4e-04
PTZ00132215 PTZ00132, PTZ00132, GTP-binding nuclear protein Ra 4e-04
COG0536369 COG0536, Obg, Predicted GTPase [General function p 5e-04
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 6e-04
cd04121189 cd04121, Rab40, Rab GTPase family 40 (Rab40) conta 9e-04
smart00176200 smart00176, RAN, Ran (Ras-related nuclear proteins 0.001
cd04134185 cd04134, Rho3, Ras homology family 3 (Rho3) of sma 0.004
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 0.004
>gnl|CDD|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional Back     alignment and domain information
 Score =  380 bits (976), Expect = e-137
 Identities = 178/180 (98%), Positives = 180/180 (100%)

Query: 1   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60
           MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct: 1   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60

Query: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120
           ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120

Query: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 180
           LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K
Sbjct: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 180


Length = 181

>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|206645 cd00879, Sar1, Sar1 is an essential component of COPII vesicle coats Back     alignment and domain information
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase Back     alignment and domain information
>gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13 Back     alignment and domain information
>gnl|CDD|197556 smart00178, SAR, Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206691 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta), together with SR-alpha, forms the heterodimeric signal recognition particle (SRP) Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|204242 pfam09439, SRPRB, Signal recognition particle receptor beta subunit Back     alignment and domain information
>gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit Back     alignment and domain information
>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) Back     alignment and domain information
>gnl|CDD|206639 cd00066, G-alpha, Alpha subunit of G proteins (guanine nucleotide binding) Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) Back     alignment and domain information
>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases Back     alignment and domain information
>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) Back     alignment and domain information
>gnl|CDD|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|218203 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserved region Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133326 cd04126, Rab20, Rab GTPase family 20 (Rab20) Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|206742 cd09915, Rag, Rag GTPase subfamily of Ras-related GTPases Back     alignment and domain information
>gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c Back     alignment and domain information
>gnl|CDD|128473 smart00176, RAN, Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PLN00223181 ADP-ribosylation factor; Provisional 100.0
PTZ00133182 ADP-ribosylation factor; Provisional 100.0
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 100.0
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 100.0
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 100.0
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 100.0
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 100.0
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 100.0
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 100.0
PF00025175 Arf: ADP-ribosylation factor family The prints ent 100.0
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 100.0
KOG0078207 consensus GTP-binding protein SEC4, small G protei 100.0
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 100.0
KOG0080209 consensus GTPase Rab18, small G protein superfamil 100.0
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 100.0
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 100.0
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 100.0
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 100.0
KOG0098216 consensus GTPase Rab2, small G protein superfamily 100.0
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 100.0
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 100.0
smart00178184 SAR Sar1p-like members of the Ras-family of small 100.0
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 100.0
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 100.0
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 100.0
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 100.0
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 100.0
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 100.0
PTZ00369189 Ras-like protein; Provisional 100.0
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 100.0
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 100.0
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 100.0
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 100.0
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 100.0
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 100.0
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 100.0
KOG0093193 consensus GTPase Rab3, small G protein superfamily 100.0
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 100.0
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 100.0
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 100.0
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 100.0
KOG0086214 consensus GTPase Rab4, small G protein superfamily 100.0
KOG0394210 consensus Ras-related GTPase [General function pre 100.0
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 100.0
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 100.0
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 100.0
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 100.0
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 100.0
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 100.0
PLN03071219 GTP-binding nuclear protein Ran; Provisional 100.0
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 100.0
KOG0095213 consensus GTPase Rab30, small G protein superfamil 100.0
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 100.0
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 100.0
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 100.0
KOG0079198 consensus GTP-binding protein H-ray, small G prote 100.0
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 100.0
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.98
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.98
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.98
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.98
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.98
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.98
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.98
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.98
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.98
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.98
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.98
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.98
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.97
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.97
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.97
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.97
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.97
PLN03110216 Rab GTPase; Provisional 99.97
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.97
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.97
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.97
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.97
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.97
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.97
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.97
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.97
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.97
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.97
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.97
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.97
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.97
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.97
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.97
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.97
PLN03118211 Rab family protein; Provisional 99.97
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.97
KOG0081219 consensus GTPase Rab27, small G protein superfamil 99.97
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.97
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.97
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.97
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.97
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.97
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.97
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.97
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.97
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.97
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.97
PLN03108210 Rab family protein; Provisional 99.97
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.97
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.97
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.97
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.97
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.97
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.97
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.97
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.96
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.96
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.96
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.96
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.96
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.96
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.96
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.96
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.96
KOG0395196 consensus Ras-related GTPase [General function pre 99.96
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.96
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.96
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.95
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.95
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.95
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.95
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.95
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 99.94
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.94
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.94
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 99.93
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.93
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.93
PLN00023 334 GTP-binding protein; Provisional 99.93
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.92
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.92
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.92
PRK03003472 GTP-binding protein Der; Reviewed 99.92
PRK15494 339 era GTPase Era; Provisional 99.92
PRK04213201 GTP-binding protein; Provisional 99.92
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.92
PRK12299335 obgE GTPase CgtA; Reviewed 99.91
COG1100219 GTPase SAR1 and related small G proteins [General 99.91
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.91
cd00881189 GTP_translation_factor GTP translation factor fami 99.91
PTZ00099176 rab6; Provisional 99.91
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.91
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.91
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.91
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.91
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.91
cd04105203 SR_beta Signal recognition particle receptor, beta 99.91
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.9
PRK03003 472 GTP-binding protein Der; Reviewed 99.9
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.9
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.9
KOG4252246 consensus GTP-binding protein [Signal transduction 99.9
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.9
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.9
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.9
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.9
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.9
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.89
PRK11058426 GTPase HflX; Provisional 99.89
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.88
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.88
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.88
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.88
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.88
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.88
PRK00093435 GTP-binding protein Der; Reviewed 99.87
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.87
PRK00093 435 GTP-binding protein Der; Reviewed 99.87
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.87
PRK12296 500 obgE GTPase CgtA; Reviewed 99.87
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.87
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.87
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.87
PRK12297424 obgE GTPase CgtA; Reviewed 99.87
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.87
PRK00089 292 era GTPase Era; Reviewed 99.87
PRK05306 787 infB translation initiation factor IF-2; Validated 99.86
COG2229187 Predicted GTPase [General function prediction only 99.86
COG1160 444 Predicted GTPases [General function prediction onl 99.86
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.86
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.85
CHL00189 742 infB translation initiation factor 2; Provisional 99.85
PRK12317 425 elongation factor 1-alpha; Reviewed 99.85
KOG3883198 consensus Ras family small GTPase [Signal transduc 99.85
PRK05433 600 GTP-binding protein LepA; Provisional 99.85
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.84
cd01896233 DRG The developmentally regulated GTP-binding prot 99.84
PRK12298390 obgE GTPase CgtA; Reviewed 99.84
KOG1673205 consensus Ras GTPases [General function prediction 99.84
COG0486454 ThdF Predicted GTPase [General function prediction 99.83
COG1159 298 Era GTPase [General function prediction only] 99.83
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.83
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.83
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.83
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.83
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 99.82
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.82
COG1160444 Predicted GTPases [General function prediction onl 99.82
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.82
PRK10218 607 GTP-binding protein; Provisional 99.82
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.81
PRK04004 586 translation initiation factor IF-2; Validated 99.81
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.8
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.8
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 99.8
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.8
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.8
COG0218200 Predicted GTPase [General function prediction only 99.79
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.79
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.79
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 99.79
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.78
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.77
KOG0090238 consensus Signal recognition particle receptor, be 99.77
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 99.77
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.76
PRK12736 394 elongation factor Tu; Reviewed 99.76
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.76
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.76
PRK12735 396 elongation factor Tu; Reviewed 99.76
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.75
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.74
PRK13351 687 elongation factor G; Reviewed 99.74
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.74
COG1084346 Predicted GTPase [General function prediction only 99.74
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.74
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.74
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.74
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.73
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.73
CHL00071 409 tufA elongation factor Tu 99.73
PLN00043 447 elongation factor 1-alpha; Provisional 99.73
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.72
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.72
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.72
PRK00049 396 elongation factor Tu; Reviewed 99.71
PLN03126 478 Elongation factor Tu; Provisional 99.71
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.71
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.71
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.7
KOG0462 650 consensus Elongation factor-type GTP-binding prote 99.7
KOG1145 683 consensus Mitochondrial translation initiation fac 99.7
PTZ00141 446 elongation factor 1- alpha; Provisional 99.69
PLN03127 447 Elongation factor Tu; Provisional 99.68
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 99.67
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 99.67
COG2262411 HflX GTPases [General function prediction only] 99.66
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.66
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.66
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.66
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.65
COG1163365 DRG Predicted GTPase [General function prediction 99.65
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.64
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.64
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.63
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.62
COG0536369 Obg Predicted GTPase [General function prediction 99.6
PRK12740 668 elongation factor G; Reviewed 99.59
PRK12739 691 elongation factor G; Reviewed 99.59
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.59
PRK00007 693 elongation factor G; Reviewed 99.56
PRK14845 1049 translation initiation factor IF-2; Provisional 99.55
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.54
COG3596296 Predicted GTPase [General function prediction only 99.52
KOG0082354 consensus G-protein alpha subunit (small G protein 99.52
PRK09602 396 translation-associated GTPase; Reviewed 99.51
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 99.51
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 99.51
PRK13768253 GTPase; Provisional 99.5
PRK09866 741 hypothetical protein; Provisional 99.5
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.5
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.49
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.49
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.49
PRK09435332 membrane ATPase/protein kinase; Provisional 99.47
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.46
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.46
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.45
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.45
TIGR00101199 ureG urease accessory protein UreG. This model rep 99.41
COG3276 447 SelB Selenocysteine-specific translation elongatio 99.4
PTZ00416 836 elongation factor 2; Provisional 99.39
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 99.39
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.38
KOG0458 603 consensus Elongation factor 1 alpha [Translation, 99.38
KOG3886 295 consensus GTP-binding protein [Signal transduction 99.37
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 99.37
KOG3905 473 consensus Dynein light intermediate chain [Cell mo 99.36
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 99.35
TIGR00157 245 ribosome small subunit-dependent GTPase A. The Aqu 99.33
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 99.32
PRK07560 731 elongation factor EF-2; Reviewed 99.32
KOG3887 347 consensus Predicted small GTPase involved in nucle 99.3
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 99.28
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 99.27
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 99.27
KOG0461 522 consensus Selenocysteine-specific elongation facto 99.27
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 99.26
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 99.26
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 99.24
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.24
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 99.24
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 99.23
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 99.2
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 99.18
COG0050 394 TufB GTPases - translation elongation factors [Tra 99.17
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 99.16
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 99.14
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 99.11
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 99.04
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 99.04
PTZ00258 390 GTP-binding protein; Provisional 99.01
KOG1954 532 consensus Endocytosis/signaling protein EHD1 [Sign 99.01
KOG0705 749 consensus GTPase-activating protein Centaurin gamm 99.0
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.98
KOG1486 364 consensus GTP-binding protein DRG2 (ODN superfamil 98.97
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.95
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.95
PRK09601 364 GTP-binding protein YchF; Reviewed 98.94
KOG0099379 consensus G protein subunit Galphas, small G prote 98.94
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.94
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.92
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.91
KOG0410410 consensus Predicted GTP binding protein [General f 98.89
PRK12289 352 GTPase RsgA; Reviewed 98.86
COG5019 373 CDC3 Septin family protein [Cell division and chro 98.86
KOG0085359 consensus G protein subunit Galphaq/Galphay, small 98.85
KOG0459 501 consensus Polypeptide release factor 3 [Translatio 98.84
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.83
KOG2655 366 consensus Septin family protein (P-loop GTPase) [C 98.82
COG5258 527 GTPBP1 GTPase [General function prediction only] 98.78
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.76
PRK00098 298 GTPase RsgA; Reviewed 98.76
PRK12288 347 GTPase RsgA; Reviewed 98.75
cd01854 287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.75
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.73
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.73
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.72
KOG0467 887 consensus Translation elongation factor 2/ribosome 98.72
KOG2486320 consensus Predicted GTPase [General function predi 98.71
COG1161322 Predicted GTPases [General function prediction onl 98.7
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.69
KOG0460 449 consensus Mitochondrial translation elongation fac 98.68
PRK09563287 rbgA GTPase YlqF; Reviewed 98.67
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.64
KOG0465 721 consensus Mitochondrial elongation factor [Transla 98.61
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 98.6
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.59
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.58
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.57
KOG1143 591 consensus Predicted translation elongation factor 98.57
KOG1487 358 consensus GTP-binding protein DRG1 (ODN superfamil 98.57
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.56
COG0012 372 Predicted GTPase, probable translation factor [Tra 98.54
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 98.54
KOG1491 391 consensus Predicted GTP-binding protein (ODN super 98.51
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.51
KOG0464 753 consensus Elongation factor G [Translation, riboso 98.45
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 98.41
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.41
PRK14974336 cell division protein FtsY; Provisional 98.37
KOG0447 980 consensus Dynamin-like GTP binding protein [Genera 98.37
PRK12288347 GTPase RsgA; Reviewed 98.36
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 98.33
PRK10416318 signal recognition particle-docking protein FtsY; 98.32
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.32
TIGR00064272 ftsY signal recognition particle-docking protein F 98.3
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 98.3
KOG0463 641 consensus GTP-binding protein GP-1 [General functi 98.29
PRK13796365 GTPase YqeH; Provisional 98.27
PRK12289352 GTPase RsgA; Reviewed 98.27
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.27
cd03112158 CobW_like The function of this protein family is u 98.26
PRK09563 287 rbgA GTPase YlqF; Reviewed 98.24
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 98.24
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 98.22
cd03114148 ArgK-like The function of this protein family is u 98.22
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.2
PRK01889 356 GTPase RsgA; Reviewed 98.1
KOG0466 466 consensus Translation initiation factor 2, gamma s 98.07
PRK13796 365 GTPase YqeH; Provisional 98.06
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.05
KOG3859 406 consensus Septins (P-loop GTPases) [Cell cycle con 98.04
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.02
COG1162301 Predicted GTPases [General function prediction onl 98.01
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.95
PRK00098298 GTPase RsgA; Reviewed 97.94
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.93
cd03115173 SRP The signal recognition particle (SRP) mediates 97.92
COG0523 323 Putative GTPases (G3E family) [General function pr 97.86
PRK13695174 putative NTPase; Provisional 97.86
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.84
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.83
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 97.81
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 97.8
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.78
KOG0469 842 consensus Elongation factor 2 [Translation, riboso 97.73
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.72
KOG2484435 consensus GTPase [General function prediction only 97.72
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.7
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.66
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.64
PRK10867 433 signal recognition particle protein; Provisional 97.64
KOG2423572 consensus Nucleolar GTPase [General function predi 97.63
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 97.62
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.61
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.61
PRK11537318 putative GTP-binding protein YjiA; Provisional 97.6
TIGR00959 428 ffh signal recognition particle protein. This mode 97.59
COG1162 301 Predicted GTPases [General function prediction onl 97.59
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 97.59
COG3523 1188 IcmF Type VI protein secretion system component Va 97.57
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.55
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.54
KOG1534273 consensus Putative transcription factor FET5 [Tran 97.54
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.54
KOG0780 483 consensus Signal recognition particle, subunit Srp 97.51
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 97.51
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.47
PRK08118167 topology modulation protein; Reviewed 97.46
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 97.45
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.45
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.45
cd03111106 CpaE_like This protein family consists of proteins 97.45
KOG1533290 consensus Predicted GTPase [General function predi 97.44
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.44
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.44
PRK07261171 topology modulation protein; Provisional 97.41
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 97.38
cd03116159 MobB Molybdenum is an essential trace element in t 97.37
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 97.35
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 97.35
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.33
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.31
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.31
PF1355562 AAA_29: P-loop containing region of AAA domain 97.31
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.3
PRK05480209 uridine/cytidine kinase; Provisional 97.22
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.16
PHA00729226 NTP-binding motif containing protein 97.15
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.15
PRK06217183 hypothetical protein; Validated 97.14
cd02036179 MinD Bacterial cell division requires the formatio 97.14
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.12
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.12
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.1
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.09
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.08
PRK14530215 adenylate kinase; Provisional 97.07
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.07
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.07
smart00382148 AAA ATPases associated with a variety of cellular 97.06
PRK08233182 hypothetical protein; Provisional 97.06
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.06
PRK06547172 hypothetical protein; Provisional 97.05
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.05
PRK14738206 gmk guanylate kinase; Provisional 97.04
PRK01889356 GTPase RsgA; Reviewed 97.04
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.04
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 97.04
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 97.03
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.02
PRK03839180 putative kinase; Provisional 97.01
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 97.01
COG0552340 FtsY Signal recognition particle GTPase [Intracell 97.01
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 97.01
PF00004132 AAA: ATPase family associated with various cellula 97.01
KOG4273 418 consensus Uncharacterized conserved protein [Funct 97.01
PRK13833323 conjugal transfer protein TrbB; Provisional 97.0
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.98
PRK05439311 pantothenate kinase; Provisional 96.97
PRK09270229 nucleoside triphosphate hydrolase domain-containin 96.96
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.96
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.93
PRK14531183 adenylate kinase; Provisional 96.93
PRK13949169 shikimate kinase; Provisional 96.92
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 96.92
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 96.91
COG3638258 ABC-type phosphate/phosphonate transport system, A 96.88
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.88
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.88
PRK14532188 adenylate kinase; Provisional 96.87
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.87
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.87
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.87
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.83
PRK14737186 gmk guanylate kinase; Provisional 96.83
PRK06696223 uridine kinase; Validated 96.83
PTZ00088229 adenylate kinase 1; Provisional 96.82
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.82
PRK00300205 gmk guanylate kinase; Provisional 96.82
PRK13851344 type IV secretion system protein VirB11; Provision 96.81
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.81
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-38  Score=223.46  Aligned_cols=180  Identities=99%  Similarity=1.470  Sum_probs=160.0

Q ss_pred             CcchHHHHHHhhhccCCceEEEEcCCCCChHHHHHhHhcCCcccccCCcCceEEEEEEcCEEEEEEEcCCCCCchhchhh
Q 029675            1 MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH   80 (189)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~i~viG~~~~GKssli~~l~~~~~~~~~~t~~~~~~~~~~~~~~~~i~D~~g~~~~~~~~~~   80 (189)
                      ||+.++.+..+....+.+||+++|.+++|||||++++..+.+..+.||++.++..++..++.+++||+||++.++.++..
T Consensus         1 m~~~~~~~~~~~~~~~~~ki~ivG~~~~GKTsl~~~l~~~~~~~~~pt~g~~~~~~~~~~~~~~i~D~~Gq~~~~~~~~~   80 (181)
T PLN00223          1 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH   80 (181)
T ss_pred             CchHHHHHHHHhcCCCccEEEEECCCCCCHHHHHHHHccCCCccccCCcceeEEEEEECCEEEEEEECCCCHHHHHHHHH
Confidence            88778777776666778999999999999999999999888887889999888888888999999999999999999999


Q ss_pred             hccCCCEEEEEEECCCcccHHHHHHHHHHHhcCCCCCCCeEEEEEeCCCCCCCCCHhHHHhhhCCccccCcceEEEEccc
Q 029675           81 YFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCA  160 (189)
Q Consensus        81 ~~~~~d~~i~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~p~ivv~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Sa  160 (189)
                      +++++|++|+|||+++++++.....++..++......+.|+++++||+|+.+....+++...++........+.+++|||
T Consensus        81 ~~~~a~~iI~V~D~s~~~s~~~~~~~l~~~l~~~~~~~~piilv~NK~Dl~~~~~~~~~~~~l~l~~~~~~~~~~~~~Sa  160 (181)
T PLN00223         81 YFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCA  160 (181)
T ss_pred             HhccCCEEEEEEeCCcHHHHHHHHHHHHHHhcCHhhCCCCEEEEEECCCCCCCCCHHHHHHHhCccccCCCceEEEeccC
Confidence            99999999999999999999999988888877654468999999999999887778888888877665556777889999


Q ss_pred             CCCCChHHHHHHHHHHHhhc
Q 029675          161 TSGEGLYEGLDWLSNNIASK  180 (189)
Q Consensus       161 ~~~~~i~~~~~~l~~~~~~~  180 (189)
                      ++|+|++++|+++.+++.++
T Consensus       161 ~~g~gv~e~~~~l~~~~~~~  180 (181)
T PLN00223        161 TSGEGLYEGLDWLSNNIANK  180 (181)
T ss_pred             CCCCCHHHHHHHHHHHHhhc
Confidence            99999999999999998765



>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>KOG0085 consensus G protein subunit Galphaq/Galphay, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG4273 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
3aq4_A184 Molecular Insights Into Plant Cell Proliferation Di 1e-104
1rrg_A181 Non-Myristoylated Rat Adp-Ribosylation Factor-1 Com 1e-91
1hur_A180 Human Adp-Ribosylation Factor 1 Complexed With Gdp, 6e-91
3o47_A329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 5e-89
1z6x_A180 Structure Of Human Adp-Ribosylation Factor 4 Length 2e-86
1re0_A164 Structure Of Arf1-Gdp Bound To Sec7 Domain Complexe 5e-86
1j2j_A166 Crystal Structure Of Gga1 Gat N-terminal Region In 4e-85
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 1e-84
2b6h_A192 Structure Of Human Adp-Ribosylation Factor 5 Length 3e-84
3lrp_A181 Crystal Structure Of Plasmodium Falciparum Adp-Ribo 8e-83
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 2e-82
3rd1_A178 Structure Of An Adp Ribosylation Factor From Entamo 3e-80
2ksq_A181 The Myristoylated Yeast Arf1 In A Gtp And Bicelle B 7e-80
3tjz_A164 Crystal Structure Of Arf1 Bound To The GammaZETA-Co 6e-77
1e0s_A174 Small G Protein Arf6-Gdp Length = 174 2e-74
2a5d_A175 Structural Basis For The Activation Of Cholera Toxi 2e-74
3lvr_E497 The Crystal Structure Of Asap3 In Complex With Arf6 7e-74
2a5g_A175 Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length 2e-73
3n5c_A162 Crystal Structure Of Arf6delta13 Complexed With Gdp 1e-70
2w83_A165 Crystal Structure Of The Arf6 Gtpase In Complex Wit 2e-70
3vhx_A172 The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesi 2e-70
4fme_C160 Espg-Rab1-Arf6 Complex Length = 160 2e-70
3pcr_B162 Structure Of Espg-Arf6 Complex Length = 162 5e-68
1moz_A183 Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharo 1e-57
1r4a_A165 Crystal Structure Of Gtp-Bound Adp-Ribosylation Fac 2e-55
4dcn_A166 Crystal Structure Analysis Of The Arfaptin2 Bar Dom 2e-54
1yzg_A179 Structure Of Human Adp-ribosylation Factor-like 8 L 2e-50
2x77_A189 Crystal Structure Of Leishmania Major Adp Ribosylat 3e-48
1zj6_A187 Crystal Structure Of Human Arl5 Length = 187 4e-48
1z6y_A179 Structure Of Human Adp-Ribosylation Factor-Like 5 L 5e-48
1upt_A171 Structure Of A Complex Of The Golgin-245 Grip Domai 4e-47
1ksg_A186 Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt 2e-45
3doe_A192 Complex Of Arl2 And Bart, Crystal Form 1 Length = 1 3e-45
1ksh_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati 3e-45
2h16_A183 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 2e-44
2h17_A181 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 2e-44
4gok_B169 The Crystal Structure Of Arl2gppnhp In Complex With 2e-43
1ksj_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Seme 2e-40
4goj_A189 The Crystal Structure Of Full Length Arl3gppnhp In 4e-39
1fzq_A181 Crystal Structure Of Murine Arl3-Gdp Length = 181 5e-39
3bh7_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 3e-38
3bh6_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 3e-37
2h57_A190 Crystal Structure Of Human Adp-Ribosylation Factor- 2e-35
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 5e-28
2h18_A193 Structure Of Human Adp-Ribosylation Factor-Like 10b 2e-27
4bas_A199 Structure Of The Arl6 Bbs3 Small Gtpase From Trypan 5e-27
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 2e-26
1m2o_B190 Crystal Structure Of The Sec23-Sar1 Complex Length 2e-24
2qtv_B167 Structure Of Sec23-Sar1 Complexed With The Active F 5e-24
2fmx_A195 An Open Conformation Of Switch I Revealed By Sar1-g 3e-20
1f6b_A198 Crystal Structure Of Sar1-Gdp Complex Length = 198 3e-20
2gao_A208 Crystal Structure Of Human Sar1a In Complex With Gd 3e-20
2fa9_A189 The Crystal Structure Of Sar1[h79g]-gdp Provides In 5e-20
1svk_A353 Structure Of The K180p Mutant Of Gi Alpha Subunit B 7e-09
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 1e-08
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 1e-08
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 2e-08
3onw_A328 Structure Of A G-Alpha-I1 Mutant With Enhanced Affi 8e-08
3tw8_B181 Gef Domain Of Dennd 1b In Complex With Rab Gtpase R 9e-08
2xns_A327 Crystal Structure Of Human G Alpha I1 Bound To A De 9e-08
3d7m_A354 Crystal Structure Of The G Protein Fast-Exchange Do 9e-08
1kjy_A325 Crystal Structure Of Human G[alpha]i1 Bound To The 9e-08
3ffb_A360 Crystal Structure Of A Fast Activating G Protein Mu 9e-08
2ik8_A324 Crystal Structure Of The Heterodimeric Complex Of H 9e-08
2g83_A313 Structure Of Activated G-alpha-i1 Bound To A Nucleo 9e-08
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 9e-08
3qe0_A325 A Galpha-I1 P-Loop Mutation Prevents Transition To 9e-08
2gtp_A323 Crystal Structure Of The Heterodimeric Complex Of H 9e-08
3qi2_A328 A Galpha P-Loop Mutation Prevents Transition To The 9e-08
1gp2_A353 G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 Wi 9e-08
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 1e-07
1y3a_A329 Structure Of G-Alpha-I1 Bound To A Gdp-Selective Pe 1e-07
2zjy_A356 Structure Of The K349p Mutant Of Gi Alpha 1 Subunit 1e-07
4g5q_A330 Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 1e-07
1bh2_A315 A326s Mutant Of An Inhibitory Alpha Subunit Length 1e-07
1as0_A353 Gtp-Gamma-S Bound G42v Gia1 Length = 353 1e-07
1fqj_A325 Crystal Structure Of The Heterotrimeric Complex Of 1e-07
4g5o_A330 Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length 1e-07
2ihb_A323 Crystal Structure Of The Heterodimeric Complex Of H 1e-07
4g5r_A330 Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 1e-07
2ode_A350 Crystal Structure Of The Heterodimeric Complex Of H 1e-07
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 2e-07
3v00_C356 Studies Of A Constitutively Active G-Alpha Subunit 2e-07
2f7s_A217 The Crystal Structure Of Human Rab27b Bound To Gdp 2e-07
4fmc_B171 Espg-Rab1 Complex Length = 171 3e-07
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 3e-07
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 3e-07
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 3e-07
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 3e-07
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 3e-07
2fu5_C183 Structure Of Rab8 In Complex With Mss4 Length = 183 3e-07
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 3e-07
3qbt_A174 Crystal Structure Of Ocrl1 540-678 In Complex With 3e-07
3ums_A354 Crystal Structure Of The G202a Mutant Of Human G-Al 4e-07
1x3s_A195 Crystal Structure Of Human Rab18 In Complex With Gp 4e-07
1gg2_A353 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 4e-07
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 5e-07
3umr_A354 Crystal Structure Of The G202d Mutant Of Human G-Al 6e-07
2il1_A192 Crystal Structure Of A Predicted Human Gtpase In Co 8e-07
1gil_A353 Structure Of Active Conformations Of Gia1 And The M 8e-07
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 9e-07
1yvd_A169 Gppnhp-Bound Rab22 Gtpase Length = 169 1e-06
1ek0_A170 Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 1e-06
3c7k_A333 Molecular Architecture Of Galphao And The Structura 2e-06
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 2e-06
1got_A350 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 2e-06
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 2e-06
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 3e-06
1shz_A340 Crystal Structure Of The P115rhogef Rgrgs Domain In 3e-06
1z0j_A170 Structure Of Gtp-Bound Rab22q64l Gtpase In Complex 4e-06
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 4e-06
4dvg_A188 Crystal Structure Of E. Histolytica Formin1 Bound T 5e-06
3ref_B194 Crystal Structure Of Ehrho1 Bound To Gdp And Magnes 6e-06
4fmc_F117 Espg-Rab1 Complex Length = 117 8e-06
2if0_A200 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 8e-06
2g6b_A180 Crystal Structure Of Human Rab26 In Complex With A 9e-06
2iez_A220 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 9e-06
2fg5_A192 Crystal Structure Of Human Rab31 In Complex With A 1e-05
1tnd_A324 The 2.2 Angstroms Crystal Structure Of Transducin-A 2e-05
2g77_B198 Crystal Structure Of Gyp1 Tbc Domain In Complex Wit 2e-05
1z08_A170 Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 2e-05
2iey_A195 Crystal Structure Of Mouse Rab27b Bound To Gdp In H 2e-05
3ah8_A355 Structure Of Heterotrimeric G Protein Galpha-Q Beta 3e-05
2bcj_Q353 Crystal Structure Of G Protein-coupled Receptor Kin 3e-05
1z06_A189 Gppnhp-Bound Rab33 Gtpase Length = 189 3e-05
1tu4_A171 Crystal Structure Of Rab5-Gdp Complex Length = 171 3e-05
2zet_A203 Crystal Structure Of The Small Gtpase Rab27b Comple 3e-05
4ekc_A347 Structure Of Human Regulator Of G Protein Signaling 3e-05
3ohm_A327 Crystal Structure Of Activated G Alpha Q Bound To I 3e-05
4gnk_A353 Crystal Structure Of Galphaq In Complex With Full-l 3e-05
3rab_A169 Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 4e-05
1n6h_A170 Crystal Structure Of Human Rab5a Length = 170 4e-05
1tu3_A171 Crystal Structure Of Rab5 Complex With Rabaptin5 C- 4e-05
1yzu_A170 Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng 4e-05
2hup_A201 Crystal Structure Of Human Rab43 In Complex With Gd 5e-05
2gf9_A189 Crystal Structure Of Human Rab3d In Complex With Gd 5e-05
1yzt_A184 Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng 5e-05
3bfk_A181 Crystal Structure Of Plasmodium Falciparum Rab11a I 6e-05
2bmd_A186 High Resolution Structure Of Gdp-Bound Human Rab4a 6e-05
1z07_A166 Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 6e-05
1zcb_A362 Crystal Structure Of G Alpha 13 In Complex With Gdp 6e-05
3cx7_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 7e-05
1huq_A164 1.8a Crystal Structure Of The Monomeric Gtpase Rab5 7e-05
2o52_A200 Crystal Structure Of Human Rab4b In Complex With Gd 9e-05
2p5s_A199 Rab Domain Of Human Rasef In Complex With Gdp Lengt 1e-04
2hei_A179 Crystal Structure Of Human Rab5b In Complex With Gd 1e-04
1byu_A216 Canine Gdp-Ran Length = 216 1e-04
1n6i_A170 Crystal Structure Of Human Rab5a A30p Mutant Comple 2e-04
2bku_A177 Kap95p:rangtp Complex Length = 177 2e-04
1n6o_A170 Crystal Structure Of Human Rab5a A30k Mutant Comple 2e-04
1n6p_A170 Crystal Structure Of Human Rab5a A30e Mutant Comple 2e-04
1n6n_A170 Crystal Structure Of Human Rab5a A30r Mutant Comple 2e-04
1z0f_A179 Gdp-Bound Rab14 Gtpase Length = 179 2e-04
1n6r_A170 Crystal Structure Of Human Rab5a A30l Mutant Comple 2e-04
1yu9_A175 Gppnhp-Bound Rab4a Length = 175 2e-04
3dz8_A191 Crystal Structure Of Human Rab3b Gtpase Bound With 3e-04
1d5c_A162 Crystal Structure Of Plasmodium Falciparum Rab6 Com 3e-04
3cpj_B223 Crystal Structure Of Ypt31 In Complex With Yeast Ra 3e-04
3bc1_A195 Crystal Structure Of The Complex Rab27a-slp2a Lengt 4e-04
3mjh_A168 Crystal Structure Of Human Rab5a In Complex With Th 4e-04
4drz_A196 Crystal Structure Of Human Rab14 Length = 196 5e-04
3sn6_A380 Crystal Structure Of The Beta2 Adrenergic Receptor- 5e-04
2fh5_B214 The Structure Of The Mammalian Srp Receptor Length 5e-04
1cul_C380 Complex Of Gs-Alpha With The Catalytic Domains Of M 5e-04
1cjk_C402 Complex Of Gs-Alpha With The Catalytic Domains Of M 5e-04
1azs_C402 Complex Of Gs-Alpha With The Catalytic Domains Of M 6e-04
1cs4_C394 Complex Of Gs-Alpha With The Catalytic Domains Of M 6e-04
1z0d_A167 Gdp-bound Rab5c Gtpase Length = 167 6e-04
3cx6_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 6e-04
>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance By Agrobacterium Protein 6b Length = 184 Back     alignment and structure

Iteration: 1

Score = 372 bits (954), Expect = e-104, Method: Compositional matrix adjust. Identities = 178/181 (98%), Positives = 179/181 (98%) Query: 1 MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60 MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN Sbjct: 4 MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 63 Query: 61 ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120 ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV Sbjct: 64 ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 123 Query: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 180 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK Sbjct: 124 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 183 Query: 181 V 181 Sbjct: 184 A 184
>pdb|1RRG|A Chain A, Non-Myristoylated Rat Adp-Ribosylation Factor-1 Complexed With Gdp, Dimeric Crystal Form Length = 181 Back     alignment and structure
>pdb|1HUR|A Chain A, Human Adp-Ribosylation Factor 1 Complexed With Gdp, Full Length = 180 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|1Z6X|A Chain A, Structure Of Human Adp-Ribosylation Factor 4 Length = 180 Back     alignment and structure
>pdb|1RE0|A Chain A, Structure Of Arf1-Gdp Bound To Sec7 Domain Complexed With Brefeldin A Length = 164 Back     alignment and structure
>pdb|1J2J|A Chain A, Crystal Structure Of Gga1 Gat N-terminal Region In Complex With Arf1 Gtp Form Length = 166 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|2B6H|A Chain A, Structure Of Human Adp-Ribosylation Factor 5 Length = 192 Back     alignment and structure
>pdb|3LRP|A Chain A, Crystal Structure Of Plasmodium Falciparum Adp-Ribosylation Factor 1 Length = 181 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|3RD1|A Chain A, Structure Of An Adp Ribosylation Factor From Entamoeba Histolytica Hm- 1:imss Bound To Mg-Gdp Length = 178 Back     alignment and structure
>pdb|2KSQ|A Chain A, The Myristoylated Yeast Arf1 In A Gtp And Bicelle Bound Conformation Length = 181 Back     alignment and structure
>pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 Back     alignment and structure
>pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 Back     alignment and structure
>pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 Back     alignment and structure
>pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 Back     alignment and structure
>pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length = 175 Back     alignment and structure
>pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|2W83|A Chain A, Crystal Structure Of The Arf6 Gtpase In Complex With A Specific Effector, Jip4 Length = 165 Back     alignment and structure
>pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesin-Like Protein 1) Complex Length = 172 Back     alignment and structure
>pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex Length = 160 Back     alignment and structure
>pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex Length = 162 Back     alignment and structure
>pdb|1MOZ|A Chain A, Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharomyces Cerevisiae Length = 183 Back     alignment and structure
>pdb|1R4A|A Chain A, Crystal Structure Of Gtp-Bound Adp-Ribosylation Factor Like Protein 1 (Arl1) And Grip Domain Of Golgin245 Complex Length = 165 Back     alignment and structure
>pdb|4DCN|A Chain A, Crystal Structure Analysis Of The Arfaptin2 Bar Domain In Complex With Arl1 Length = 166 Back     alignment and structure
>pdb|1YZG|A Chain A, Structure Of Human Adp-ribosylation Factor-like 8 Length = 179 Back     alignment and structure
>pdb|2X77|A Chain A, Crystal Structure Of Leishmania Major Adp Ribosylation Factor-Like 1. Length = 189 Back     alignment and structure
>pdb|1ZJ6|A Chain A, Crystal Structure Of Human Arl5 Length = 187 Back     alignment and structure
>pdb|1Z6Y|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 Length = 179 Back     alignment and structure
>pdb|1UPT|A Chain A, Structure Of A Complex Of The Golgin-245 Grip Domain With Arl1 Length = 171 Back     alignment and structure
>pdb|1KSG|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 1 Length = 186 Back     alignment and structure
>pdb|3DOE|A Chain A, Complex Of Arl2 And Bart, Crystal Form 1 Length = 192 Back     alignment and structure
>pdb|1KSH|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Native) Length = 186 Back     alignment and structure
>pdb|2H16|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) Length = 183 Back     alignment and structure
>pdb|2H17|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) (Casp Target) Length = 181 Back     alignment and structure
>pdb|4GOK|B Chain B, The Crystal Structure Of Arl2gppnhp In Complex With Unc119a Length = 169 Back     alignment and structure
>pdb|1KSJ|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Semet) Length = 186 Back     alignment and structure
>pdb|4GOJ|A Chain A, The Crystal Structure Of Full Length Arl3gppnhp In Complex With Unc119a Length = 189 Back     alignment and structure
>pdb|1FZQ|A Chain A, Crystal Structure Of Murine Arl3-Gdp Length = 181 Back     alignment and structure
>pdb|3BH7|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gdp-Alf4 Length = 164 Back     alignment and structure
>pdb|3BH6|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gppnhp Length = 164 Back     alignment and structure
>pdb|2H57|A Chain A, Crystal Structure Of Human Adp-Ribosylation Factor-Like 6 Length = 190 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 Back     alignment and structure
>pdb|4BAS|A Chain A, Structure Of The Arl6 Bbs3 Small Gtpase From Trypanosoma Brucei With Bound Nucleotide Analogue Gppnp Length = 199 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|1M2O|B Chain B, Crystal Structure Of The Sec23-Sar1 Complex Length = 190 Back     alignment and structure
>pdb|2QTV|B Chain B, Structure Of Sec23-Sar1 Complexed With The Active Fragment Of Sec31 Length = 167 Back     alignment and structure
>pdb|2FMX|A Chain A, An Open Conformation Of Switch I Revealed By Sar1-gdp Crystal Structure At Low Mg(2+) Length = 195 Back     alignment and structure
>pdb|1F6B|A Chain A, Crystal Structure Of Sar1-Gdp Complex Length = 198 Back     alignment and structure
>pdb|2GAO|A Chain A, Crystal Structure Of Human Sar1a In Complex With Gdp Length = 208 Back     alignment and structure
>pdb|2FA9|A Chain A, The Crystal Structure Of Sar1[h79g]-gdp Provides Insight Into The Coat-controlled Gtp Hydrolysis In The Disassembly Of Cop Ii Length = 189 Back     alignment and structure
>pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of Gi Alpha Subunit Bound To Alf4 And Gdp Length = 353 Back     alignment and structure
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|3ONW|A Chain A, Structure Of A G-Alpha-I1 Mutant With Enhanced Affinity For The Rgs14 Goloco Motif. Length = 328 Back     alignment and structure
>pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 Back     alignment and structure
>pdb|2XNS|A Chain A, Crystal Structure Of Human G Alpha I1 Bound To A Designed Helical Peptide Derived From The Goloco Motif Of Rgs14 Length = 327 Back     alignment and structure
>pdb|3D7M|A Chain A, Crystal Structure Of The G Protein Fast-Exchange Double Mutant I56cQ333C Length = 354 Back     alignment and structure
>pdb|1KJY|A Chain A, Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14 Length = 325 Back     alignment and structure
>pdb|2IK8|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 324 Back     alignment and structure
>pdb|2G83|A Chain A, Structure Of Activated G-alpha-i1 Bound To A Nucleotide- State-selective Peptide: Minimal Determinants For Recognizing The Active Form Of A G Protein Alpha Subunit Length = 313 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|3QE0|A Chain A, A Galpha-I1 P-Loop Mutation Prevents Transition To The Activated State Length = 325 Back     alignment and structure
>pdb|2GTP|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs1 And Activated Gi Alpha 1 Length = 323 Back     alignment and structure
>pdb|3QI2|A Chain A, A Galpha P-Loop Mutation Prevents Transition To The Activated State: G42r Bound To Rgs14 Goloco Length = 328 Back     alignment and structure
>pdb|1GP2|A Chain A, G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|1Y3A|A Chain A, Structure Of G-Alpha-I1 Bound To A Gdp-Selective Peptide Provides Insight Into Guanine Nucleotide Exchange Length = 329 Back     alignment and structure
>pdb|2ZJY|A Chain A, Structure Of The K349p Mutant Of Gi Alpha 1 Subunit Bound To Alf4 And Gdp Length = 356 Back     alignment and structure
>pdb|4G5Q|A Chain A, Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 Back     alignment and structure
>pdb|1BH2|A Chain A, A326s Mutant Of An Inhibitory Alpha Subunit Length = 315 Back     alignment and structure
>pdb|1AS0|A Chain A, Gtp-Gamma-S Bound G42v Gia1 Length = 353 Back     alignment and structure
>pdb|1FQJ|A Chain A, Crystal Structure Of The Heterotrimeric Complex Of The Rgs Domain Of Rgs9, The Gamma Subunit Of Phosphodiesterase And The GtI1 CHIMERA ALPHA SUBUNIT [(RGS9)-(Pdegamma)- (GtI1ALPHA)-(Gdp)-(Alf4-)-(Mg2+)] Length = 325 Back     alignment and structure
>pdb|4G5O|A Chain A, Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length = 330 Back     alignment and structure
>pdb|2IHB|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs10 And Activated Gi Alpha 3 Length = 323 Back     alignment and structure
>pdb|4G5R|A Chain A, Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 Back     alignment and structure
>pdb|2ODE|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 350 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|3V00|C Chain C, Studies Of A Constitutively Active G-Alpha Subunit Provide Insights Into The Mechanism Of G Protein Activation. Length = 356 Back     alignment and structure
>pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 Back     alignment and structure
>pdb|3UMS|A Chain A, Crystal Structure Of The G202a Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 Back     alignment and structure
>pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|3UMR|A Chain A, Crystal Structure Of The G202d Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|1GIL|A Chain A, Structure Of Active Conformations Of Gia1 And The Mechanism Of Gtp Hydrolysis Length = 353 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 Back     alignment and structure
>pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 Back     alignment and structure
>pdb|3C7K|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 333 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 350 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|1SHZ|A Chain A, Crystal Structure Of The P115rhogef Rgrgs Domain In A Complex With Galpha(13):galpha(i1) Chimera Length = 340 Back     alignment and structure
>pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|4DVG|A Chain A, Crystal Structure Of E. Histolytica Formin1 Bound To Ehrho1-Gtpgammas Length = 188 Back     alignment and structure
>pdb|3REF|B Chain B, Crystal Structure Of Ehrho1 Bound To Gdp And Magnesium Length = 194 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure
>pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 Back     alignment and structure
>pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 Back     alignment and structure
>pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 Back     alignment and structure
>pdb|1TND|A Chain A, The 2.2 Angstroms Crystal Structure Of Transducin-Alpha Complexed With Gtp Gamma S Length = 324 Back     alignment and structure
>pdb|2G77|B Chain B, Crystal Structure Of Gyp1 Tbc Domain In Complex With Rab33 Gtpase Bound To Gdp And Alf3 Length = 198 Back     alignment and structure
>pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 Back     alignment and structure
>pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 Back     alignment and structure
>pdb|3AH8|A Chain A, Structure Of Heterotrimeric G Protein Galpha-Q Beta Gamma In Complex With An Inhibitor Ym-254890 Length = 355 Back     alignment and structure
>pdb|2BCJ|Q Chain Q, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 353 Back     alignment and structure
>pdb|1Z06|A Chain A, Gppnhp-Bound Rab33 Gtpase Length = 189 Back     alignment and structure
>pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 Back     alignment and structure
>pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 Back     alignment and structure
>pdb|4EKC|A Chain A, Structure Of Human Regulator Of G Protein Signaling 2 (rgs2) In Complex With Murine Galpha-q(r183c) Length = 347 Back     alignment and structure
>pdb|3OHM|A Chain A, Crystal Structure Of Activated G Alpha Q Bound To Its Effector Phospholipase C Beta 3 Length = 327 Back     alignment and structure
>pdb|4GNK|A Chain A, Crystal Structure Of Galphaq In Complex With Full-length Human Plcbeta3 Length = 353 Back     alignment and structure
>pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 Back     alignment and structure
>pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 Back     alignment and structure
>pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 Back     alignment and structure
>pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 Back     alignment and structure
>pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 Back     alignment and structure
>pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 Back     alignment and structure
>pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 Back     alignment and structure
>pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 Back     alignment and structure
>pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 Back     alignment and structure
>pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 Back     alignment and structure
>pdb|1ZCB|A Chain A, Crystal Structure Of G Alpha 13 In Complex With Gdp Length = 362 Back     alignment and structure
>pdb|3CX7|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp-Alf4 Length = 338 Back     alignment and structure
>pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Monomeric Gtpase Rab5c (Mouse) Length = 164 Back     alignment and structure
>pdb|2O52|A Chain A, Crystal Structure Of Human Rab4b In Complex With Gdp Length = 200 Back     alignment and structure
>pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 Back     alignment and structure
>pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 Back     alignment and structure
>pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 Back     alignment and structure
>pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 Back     alignment and structure
>pdb|2BKU|A Chain A, Kap95p:rangtp Complex Length = 177 Back     alignment and structure
>pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1Z0F|A Chain A, Gdp-Bound Rab14 Gtpase Length = 179 Back     alignment and structure
>pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 Back     alignment and structure
>pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 Back     alignment and structure
>pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 Back     alignment and structure
>pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 Back     alignment and structure
>pdb|3MJH|A Chain A, Crystal Structure Of Human Rab5a In Complex With The C2h2 Zinc Finger Of Eea1 Length = 168 Back     alignment and structure
>pdb|4DRZ|A Chain A, Crystal Structure Of Human Rab14 Length = 196 Back     alignment and structure
>pdb|3SN6|A Chain A, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 380 Back     alignment and structure
>pdb|2FH5|B Chain B, The Structure Of The Mammalian Srp Receptor Length = 214 Back     alignment and structure
>pdb|1CUL|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2',5'-Dideoxy-Adenosine 3'- Triphosphate And Mg Length = 380 Back     alignment and structure
>pdb|1CJK|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With Adenosine 5'-(Alpha Thio)-Triphosphate (Rp), Mg, And Mn Length = 402 Back     alignment and structure
>pdb|1AZS|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase Length = 402 Back     alignment and structure
>pdb|1CS4|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'-Deoxy-Adenosine 3'- Monophosphate, Pyrophosphate And Mg Length = 394 Back     alignment and structure
>pdb|1Z0D|A Chain A, Gdp-bound Rab5c Gtpase Length = 167 Back     alignment and structure
>pdb|3CX6|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp Length = 338 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 1e-128
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 1e-127
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 1e-127
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 1e-127
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 1e-126
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 1e-126
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 1e-125
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 1e-124
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 1e-123
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 1e-120
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 1e-120
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 1e-119
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 1e-118
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-116
3o47_A329 ADP-ribosylation factor GTPase-activating protein 1e-114
2fh5_B214 SR-beta, signal recognition particle receptor beta 1e-85
3t1o_A198 Gliding protein MGLA; G domain containing protein, 2e-78
1nrj_B218 SR-beta, signal recognition particle receptor beta 1e-72
2ged_A193 SR-beta, signal recognition particle receptor beta 9e-72
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 3e-60
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 4e-53
3llu_A196 RAS-related GTP-binding protein C; structural geno 1e-49
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 5e-37
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 8e-21
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 6e-11
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 1e-09
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 2e-09
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 3e-09
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 7e-09
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 2e-08
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 2e-08
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 3e-08
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 3e-08
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 4e-08
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 4e-08
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 5e-08
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 7e-08
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 7e-08
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 1e-07
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 1e-07
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 1e-07
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 1e-07
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 1e-07
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 1e-07
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 2e-07
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 2e-07
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 2e-07
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 2e-07
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 2e-07
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 2e-07
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 2e-07
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 2e-07
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 2e-07
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 2e-07
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 2e-07
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 3e-07
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 3e-07
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 3e-07
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 3e-07
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 3e-07
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 3e-07
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 3e-07
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 4e-07
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 4e-07
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 4e-07
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 4e-07
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 4e-07
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 4e-07
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 5e-07
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 5e-07
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 5e-07
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 6e-07
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 6e-07
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 7e-07
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 7e-07
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 8e-07
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 8e-07
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 9e-07
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 1e-06
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 1e-06
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 1e-06
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 1e-06
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 2e-06
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 2e-06
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 2e-06
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 2e-06
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 2e-06
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 3e-06
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 3e-06
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 4e-06
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 5e-06
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 6e-06
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 6e-06
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 1e-05
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 1e-05
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 1e-05
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 2e-05
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 2e-05
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 2e-05
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 2e-05
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 3e-05
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 3e-05
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 4e-05
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 4e-05
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 6e-05
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 2e-04
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 4e-04
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
 Score =  357 bits (919), Expect = e-128
 Identities = 95/183 (51%), Positives = 135/183 (73%), Gaps = 3/183 (1%)

Query: 1   MGLTFTKL---FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE 57
           MG     L      L A +++R+LM+GLD AGKT+ILY+L LG++VTT+PT+G N+ET++
Sbjct: 3   MGAWLASLKQTLGLLPADRKIRVLMLGLDNAGKTSILYRLHLGDVVTTVPTVGVNLETLQ 62

Query: 58  YKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR 117
           YKNISF VWD+GGQ  +RP WR YF +T  +I+VVDS DRDR+  A+ EL+ +L+EDELR
Sbjct: 63  YKNISFEVWDLGGQTGVRPYWRCYFSDTDAVIYVVDSTDRDRMGVAKHELYALLDEDELR 122

Query: 118 DAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 177
            ++LL+FANKQDLP+A + AEI ++LG+ S+  R W I  + + +G+GL EG+DWL   +
Sbjct: 123 KSLLLIFANKQDLPDAASEAEIAEQLGVSSIMNRTWTIVKSSSKTGDGLVEGMDWLVERL 182

Query: 178 ASK 180
             +
Sbjct: 183 REQ 185


>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Length = 227 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Length = 327 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Length = 354 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 2e-51
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 2e-46
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 2e-41
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 5e-39
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-38
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 4e-38
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 5e-35
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 7e-34
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 4e-33
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 6e-31
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 1e-30
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 3e-29
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 2e-26
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 9e-26
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 3e-25
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 5e-25
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 4e-24
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 9e-24
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 1e-22
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 1e-21
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 6e-21
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 3e-20
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 2e-19
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 5e-18
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 7e-18
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 1e-17
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 9e-17
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 2e-16
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 3e-15
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 6e-14
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 2e-13
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 2e-12
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 2e-12
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 4e-12
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 1e-11
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 1e-11
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 4e-11
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 2e-10
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 3e-10
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 4e-09
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 4e-09
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 8e-09
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 9e-09
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 1e-08
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 4e-08
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9e-08
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 2e-07
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 3e-07
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 2e-06
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 2e-06
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 3e-06
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 7e-06
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 2e-05
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 2e-05
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 8e-05
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 1e-04
d1ls1a2207 c.37.1.10 (A:89-295) GTPase domain of the signal s 3e-04
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 4e-04
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 0.001
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 0.002
d1okkd2207 c.37.1.10 (D:97-303) GTPase domain of the signal r 0.003
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 0.004
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF6 [TaxId: 9606]
 Score =  161 bits (407), Expect = 2e-51
 Identities = 122/171 (71%), Positives = 147/171 (85%)

Query: 7   KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVW 66
           K+ S++F  KEMRILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKN+ F VW
Sbjct: 2   KVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVW 61

Query: 67  DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFAN 126
           DVGGQDKIRPLWRHY+  TQGLIFVVD  DRDR+ EAR ELHR++N+ E+RDA++L+FAN
Sbjct: 62  DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 121

Query: 127 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 177
           KQDLP+AM   EI +KLGL  +R R+WY+Q +CATSG+GLYEGL WL++N 
Sbjct: 122 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY 172


>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 100.0
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 100.0
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 100.0
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 100.0
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 100.0
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 100.0
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 100.0
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 100.0
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 100.0
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 100.0
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 100.0
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 100.0
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 100.0
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.98
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.98
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.98
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.98
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.97
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.97
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.97
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.97
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.97
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.97
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.96
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.96
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.96
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.94
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.94
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.93
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.92
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.91
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.91
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.9
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.9
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.9
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.9
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.89
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.89
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.89
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.88
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.87
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.87
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.86
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.85
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.84
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.83
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.81
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.8
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.78
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.78
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.76
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.76
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.75
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.72
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.68
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.64
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.59
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.57
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.52
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.46
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 99.16
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.16
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.15
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 99.14
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.08
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.96
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.41
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.34
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 98.28
d1u0la2 225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.26
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.14
d1okkd2207 GTPase domain of the signal recognition particle r 98.11
d1vmaa2213 GTPase domain of the signal recognition particle r 98.07
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.01
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.97
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.97
d2qy9a2211 GTPase domain of the signal recognition particle r 97.9
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.65
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.64
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.61
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.52
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.51
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.42
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.41
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.37
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.36
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.34
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.32
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.29
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.25
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.25
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.21
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.2
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.19
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.16
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.14
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.12
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.11
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.09
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.03
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.02
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.01
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.0
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.0
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.99
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.98
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.94
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 96.91
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.89
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.85
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.85
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.85
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.85
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.84
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.82
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.81
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.81
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.81
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.79
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.77
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.76
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.75
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.73
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.73
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.71
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.7
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.7
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.69
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.69
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.68
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.68
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.68
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.68
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.67
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.65
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.63
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.61
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.61
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.6
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.6
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.6
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.6
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.58
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.56
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.54
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.54
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.53
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.52
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.49
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.48
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.48
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.47
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.46
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.45
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.45
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.42
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.42
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.4
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.36
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.35
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.34
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.34
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.31
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.3
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.26
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.23
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.04
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.97
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.87
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.87
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.83
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.8
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.76
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.64
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.48
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.48
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 95.43
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.41
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 95.35
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.34
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.27
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.18
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.17
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.17
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.15
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.07
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.02
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.0
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.96
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 94.94
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.92
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.8
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.79
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.79
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.76
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.76
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 94.65
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.64
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.63
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.6
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 94.51
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.33
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.32
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 94.31
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.2
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.09
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.07
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 94.04
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.8
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.78
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.74
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 93.63
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 93.63
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.6
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.41
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.21
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.09
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 92.96
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.67
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.4
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 92.04
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.88
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 91.68
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 89.99
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.97
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 89.41
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 88.6
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 87.64
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 87.12
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 86.56
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 85.91
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 85.2
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 84.42
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 83.63
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 82.88
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.86
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 80.99
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 80.87
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 80.01
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]
Probab=100.00  E-value=2.8e-38  Score=200.85  Aligned_cols=179  Identities=56%  Similarity=0.992  Sum_probs=163.7

Q ss_pred             CCHHHHHHHHH-HCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEEECCEEEEEEECCCCCCCHHCHHH
Q ss_conf             30189999755-02577669999189987689987674198323568767137899983979999975899886010652
Q 029675            2 GLTFTKLFSRL-FAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH   80 (189)
Q Consensus         2 ~~~~~~~~~~~-~~~~~~~i~iiG~~~~GKssli~~l~~~~~~~~~~t~~~~~~~~~~~~~~~~i~D~~G~~~~~~~~~~   80 (189)
                      |..|+.+++.+ ...+.+||+++|.+++|||||++++.++.+....||.+.........+..+.+||+||++.++..+..
T Consensus         1 ~~~~~~~~~~l~~~~k~~KI~lvG~~~vGKTsLi~~l~~~~~~~~~~t~~~~~~~~~~~~~~~~i~D~~g~~~~~~~~~~   80 (182)
T d1moza_           1 GNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRC   80 (182)
T ss_dssp             CHHHHHHHGGGTTCSSCEEEEEEEETTSSHHHHHHHTCCSEEEEECSSTTCCEEEEEETTEEEEEEEEC----CCTTGGG
T ss_pred             CHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCEEEEEEECCCCCCCCHHHHH
T ss_conf             92389999987078966899999999998899998873387776433065479999638899999955642001145776


Q ss_pred             HCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCCCEEEEECCC
Q ss_conf             12587889999989995419999999999863888899849999858998798998689856199643686359997046
Q 029675           81 YFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCA  160 (189)
Q Consensus        81 ~~~~~d~~i~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~p~ivv~nK~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~Sa  160 (189)
                      ++..++++++|+|++++.++.....++...+......+.|+++++||+|+.+....+++...++...+...++.+++|||
T Consensus        81 ~~~~~~~ii~v~d~~d~~s~~~~~~~l~~~~~~~~~~~~piliv~NK~Dl~~~~~~~~i~~~~~~~~~~~~~~~~~e~SA  160 (182)
T d1moza_          81 YYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSA  160 (182)
T ss_dssp             TTTTEEEEEEEEETTCTTTHHHHHHHHHHHTTSSTTSSCEEEEEEECTTSTTCCCHHHHHHHTTTTTCCSSCEEEEEEBG
T ss_pred             HHCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             51344068888641122110258999999877531477626999996256666678999999999987617988999779


Q ss_pred             CCCCCHHHHHHHHHHHHHHC
Q ss_conf             78989699999999998512
Q 029675          161 TSGEGLYEGLDWLSNNIASK  180 (189)
Q Consensus       161 ~~~~~i~~~~~~i~~~~~~~  180 (189)
                      ++|+||+++|+++.+.+.++
T Consensus       161 ~~g~gv~e~~~~l~~~i~~~  180 (182)
T d1moza_         161 IKGEGITEGLDWLIDVIKEE  180 (182)
T ss_dssp             GGTBTHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHC
T ss_conf             89979999999999999975



>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure