Citrus Sinensis ID: 029686

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MAAVSTPTIICSCSSSSSSSSRLSSKQAHNTKQQQQQLSFDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGTWKTQTPDSTRVSIRARTCRMLFWRL
ccccccccEEccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEcccccEEEEEEcccccccccccEEEEEEEEEEccccEEcccccccccEEEEcccccEEccHHHHHcccccccccccccEEEEccccccccccccccccccccc
ccccccccEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccEEcccccEEEEEEcccccccccccEEEEEEEEEEccccEEEEHHHHcccEEEEHccccccHHHHHHHcccccccccccccEEEEEccHccccccccccEEEEEEc
maavstptiicscssssssssrlsskqahNTKQQQqqlsfdpkkrFFEVGIGLLASSVIaltpleadATRIEYyattadppcefsfarsglgycdiasgsgveapygelINVHYtarfadgiifdssykrarpltmriGVGKVikgldqgilggdgvppmhvgtwktqtpdstrVSIRARTCRMLFWRL
maavstptiicscssssssssRLSSKQAHNTKqqqqqlsfdpKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVgtwktqtpdstrvsiRARTCRMLFWRL
MAAVSTPTIICscssssssssrlssKQAHNTKqqqqqLSFDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGTWKTQTPDSTRVSIRARTCRMLFWRL
*******************************************KRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGTWKTQTPDSTRVSIRARTCRMLFW**
***********************************************EVGIGLLASSVI*************************SFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGTWKTQTPDSTRVSIRARTCRMLFWRL
***************************************FDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGTWKTQTPDSTRVSIRARTCRMLFWRL
**************SS**********QAHNTKQQQQQLSFDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGTWKTQTPDSTRVSIRARTCRMLFWRL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVSTPTIICSCSSSSSSSSRLSSKQAHNTKQQQQQLSFDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGTWKTQTPDSTRVSIRARTCRMLFWRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q9SCY3217 Peptidyl-prolyl cis-trans yes no 0.677 0.589 0.728 2e-50
Q9SCY2208 Peptidyl-prolyl cis-trans no no 0.851 0.774 0.387 2e-24
Q38936163 Peptidyl-prolyl cis-trans no no 0.275 0.319 0.5 2e-09
Q6BP84135 FK506-binding protein 2 O yes no 0.264 0.370 0.48 2e-09
O22870223 Peptidyl-prolyl cis-trans no no 0.343 0.291 0.476 2e-09
Q41649151 FK506-binding protein 2 O N/A no 0.275 0.344 0.480 4e-09
P0A0W2109 FK506-binding protein OS= yes no 0.343 0.596 0.492 9e-09
P56989109 FK506-binding protein OS= yes no 0.312 0.541 0.508 1e-08
Q38935153 Peptidyl-prolyl cis-trans no no 0.275 0.339 0.461 1e-08
P0A0W3109 FK506-binding protein OS= N/A no 0.312 0.541 0.508 2e-08
>sp|Q9SCY3|FK162_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-2 PE=1 SV=1 Back     alignment and function desciption
 Score =  198 bits (504), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/129 (72%), Positives = 110/129 (85%), Gaps = 1/129 (0%)

Query: 43  KKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGV 102
           KKR F VG+G LASS+++LTPL+ADATRI+YYAT  DP CE+S+A+SGLG+CD+  G G 
Sbjct: 48  KKRVFGVGLGFLASSILSLTPLDADATRIDYYATVGDPLCEYSYAKSGLGFCDLDVGFGD 107

Query: 103 EAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHV 162
           EAP G L+N+HYTARFADG +FDSSYKRARPLTMRIGVGKVI+GLDQGILGG+GVPPM V
Sbjct: 108 EAPRGVLVNIHYTARFADGTLFDSSYKRARPLTMRIGVGKVIRGLDQGILGGEGVPPMRV 167

Query: 163 -GTWKTQTP 170
            G  K Q P
Sbjct: 168 GGKRKLQIP 176
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Probable subunit of the chloroplast NAD(P)H dehydrogenase (NDH) lumen subcomplex L that seems to be essential for stabilizing the NDH subcomplex A.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9SCY2|FKB13_ARATH Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana GN=FKBP13 PE=1 SV=2 Back     alignment and function description
>sp|Q38936|FK152_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-2 OS=Arabidopsis thaliana GN=FKBP15-2 PE=2 SV=2 Back     alignment and function description
>sp|Q6BP84|FKBP2_DEBHA FK506-binding protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR2 PE=3 SV=2 Back     alignment and function description
>sp|O22870|FK163_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-3 PE=1 SV=2 Back     alignment and function description
>sp|Q41649|FKB15_VICFA FK506-binding protein 2 OS=Vicia faba GN=FKBP15 PE=1 SV=1 Back     alignment and function description
>sp|P0A0W2|FKBP_NEIMB FK506-binding protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbp PE=1 SV=1 Back     alignment and function description
>sp|P56989|FKBP_NEIMA FK506-binding protein OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbp PE=3 SV=1 Back     alignment and function description
>sp|Q38935|FK151_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-1 OS=Arabidopsis thaliana GN=FKBP15-1 PE=1 SV=2 Back     alignment and function description
>sp|P0A0W3|FKBP_NEIMC FK506-binding protein OS=Neisseria meningitidis serogroup C GN=fbp PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
225438635206 PREDICTED: probable FKBP-type peptidyl-p 0.724 0.665 0.696 3e-52
354464679229 fk506-binding protein [Carica papaya] 0.730 0.602 0.691 2e-50
118489786226 unknown [Populus trichocarpa x Populus d 0.862 0.721 0.597 4e-50
297802080216 hypothetical protein ARALYDRAFT_490753 [ 0.677 0.592 0.728 5e-49
224081186185 predicted protein [Populus trichocarpa] 0.640 0.654 0.760 7e-49
18420509217 putative FKBP-type peptidyl-prolyl cis-t 0.677 0.589 0.728 8e-49
351721116221 uncharacterized protein LOC100500547 [Gl 0.687 0.588 0.725 1e-48
449451467211 PREDICTED: peptidyl-prolyl cis-trans iso 0.650 0.582 0.766 4e-48
334187334177 putative FKBP-type peptidyl-prolyl cis-t 0.629 0.672 0.747 7e-48
449504843163 PREDICTED: peptidyl-prolyl cis-trans iso 0.645 0.748 0.772 8e-48
>gi|225438635|ref|XP_002281281.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 4, chloroplastic [Vitis vinifera] gi|296082462|emb|CBI21467.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 101/145 (69%), Positives = 115/145 (79%), Gaps = 8/145 (5%)

Query: 27  QAHNTKQQQQQLSFDP--------KKRFFEVGIGLLASSVIALTPLEADATRIEYYATTA 78
           Q   T   +  LSF P        K+   +VGIGLLA+SV+AL+PLEA ATRIEYYAT  
Sbjct: 14  QTLQTHHPKPSLSFKPIANCISSTKRPVLDVGIGLLAASVVALSPLEATATRIEYYATVG 73

Query: 79  DPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRI 138
           +P CE +FA+SGLGYCD+A GSG EAP+GELINVHYTARFADG +FDSSYKRARPLTMRI
Sbjct: 74  EPNCELNFAKSGLGYCDVAVGSGEEAPFGELINVHYTARFADGTVFDSSYKRARPLTMRI 133

Query: 139 GVGKVIKGLDQGILGGDGVPPMHVG 163
           G GK+IKGLDQGILGG+GVPPM VG
Sbjct: 134 GAGKLIKGLDQGILGGEGVPPMLVG 158

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|354464679|gb|AER26535.1| fk506-binding protein [Carica papaya] Back     alignment and taxonomy information
>gi|118489786|gb|ABK96693.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|297802080|ref|XP_002868924.1| hypothetical protein ARALYDRAFT_490753 [Arabidopsis lyrata subsp. lyrata] gi|297314760|gb|EFH45183.1| hypothetical protein ARALYDRAFT_490753 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224081186|ref|XP_002306326.1| predicted protein [Populus trichocarpa] gi|222855775|gb|EEE93322.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18420509|ref|NP_568067.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 4 [Arabidopsis thaliana] gi|75202771|sp|Q9SCY3.1|FK162_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic; Short=PPIase FKBP16-2; AltName: Full=FK506-binding protein 16-2; Short=AtFKBP16-2; AltName: Full=Immunophilin FKBP16-2; AltName: Full=Photosynthetic NDH subcomplex L 4; AltName: Full=Rotamase; Flags: Precursor gi|6686798|emb|CAB64721.1| FKBP like protein [Arabidopsis thaliana] gi|332661707|gb|AEE87107.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|351721116|ref|NP_001235919.1| uncharacterized protein LOC100500547 [Glycine max] gi|255630603|gb|ACU15661.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449451467|ref|XP_004143483.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|334187334|ref|NP_001190971.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 4 [Arabidopsis thaliana] gi|332661708|gb|AEE87108.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449504843|ref|XP_004162310.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2135287217 PnsL4 "AT4G39710" [Arabidopsis 0.677 0.589 0.728 9.8e-48
UNIPROTKB|Q6Z8J5230 P0431B06.35 "Peptidyl-prolyl c 0.640 0.526 0.578 1.2e-35
UNIPROTKB|Q653Z1218 OSJNBb0065C04.47 "Peptidyl-pro 0.539 0.467 0.495 1.1e-23
TAIR|locus:2171958208 FKBP13 "AT5G45680" [Arabidopsi 0.539 0.490 0.514 2.9e-23
UNIPROTKB|A8J3L4194 FKB16-2a "Peptidyl-prolyl cis- 0.407 0.396 0.493 1.4e-16
UNIPROTKB|A8J3L3175 FKB16-5 "Peptidyl-prolyl cis-t 0.407 0.44 0.467 1.4e-14
UNIPROTKB|A9WGZ8 237 Caur_0860 "Peptidyl-prolyl cis 0.391 0.312 0.439 2.4e-12
UNIPROTKB|P73037201 ytfC "Peptidyl-prolyl cis-tran 0.396 0.373 0.453 3.1e-12
UNIPROTKB|A6V153113 PSPA7_1404 "Peptidyl-prolyl ci 0.312 0.522 0.491 1.2e-10
UNIPROTKB|Q74AS7156 GSU2274 "Peptidyl-prolyl cis-t 0.338 0.410 0.453 1.2e-10
TAIR|locus:2135287 PnsL4 "AT4G39710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 499 (180.7 bits), Expect = 9.8e-48, P = 9.8e-48
 Identities = 94/129 (72%), Positives = 110/129 (85%)

Query:    43 KKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGV 102
             KKR F VG+G LASS+++LTPL+ADATRI+YYAT  DP CE+S+A+SGLG+CD+  G G 
Sbjct:    48 KKRVFGVGLGFLASSILSLTPLDADATRIDYYATVGDPLCEYSYAKSGLGFCDLDVGFGD 107

Query:   103 EAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHV 162
             EAP G L+N+HYTARFADG +FDSSYKRARPLTMRIGVGKVI+GLDQGILGG+GVPPM V
Sbjct:   108 EAPRGVLVNIHYTARFADGTLFDSSYKRARPLTMRIGVGKVIRGLDQGILGGEGVPPMRV 167

Query:   163 G-TWKTQTP 170
             G   K Q P
Sbjct:   168 GGKRKLQIP 176
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005576 "extracellular region" evidence=ISM
GO:0006457 "protein folding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0031679 "NADH dehydrogenase (plastoquinone) activity" evidence=IMP
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0010598 "NAD(P)H dehydrogenase complex (plastoquinone)" evidence=IDA
UNIPROTKB|Q6Z8J5 P0431B06.35 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q653Z1 OSJNBb0065C04.47 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2171958 FKBP13 "AT5G45680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A8J3L4 FKB16-2a "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|A8J3L3 FKB16-5 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|A9WGZ8 Caur_0860 "Peptidyl-prolyl cis-trans isomerase" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] Back     alignment and assigned GO terms
UNIPROTKB|P73037 ytfC "Peptidyl-prolyl cis-trans isomerase" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
UNIPROTKB|A6V153 PSPA7_1404 "Peptidyl-prolyl cis-trans isomerase" [Pseudomonas aeruginosa PA7 (taxid:381754)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AS7 GSU2274 "Peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SCY3FK162_ARATH5, ., 2, ., 1, ., 80.72860.67720.5898yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.766
4th Layer5.2.1.80.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 1e-16
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 3e-15
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 2e-12
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 8e-05
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 7e-04
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score = 71.1 bits (175), Expect = 1e-16
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 6/57 (10%)

Query: 107 GELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVG 163
           G+ + VHYT +  DG +FDSS  R +P    +G G+VI G D+G+LG      M VG
Sbjct: 8   GDTVTVHYTGKLEDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLG------MKVG 58

Length = 94
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.94
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.93
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.9
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.88
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.85
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.83
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.83
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.71
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.64
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.54
PRK10737 196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.46
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.12
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 98.57
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.56
PRK01490 435 tig trigger factor; Provisional 98.43
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.39
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 97.91
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information 
Probab=99.94  E-value=1.8e-26  Score=182.66  Aligned_cols=142  Identities=17%  Similarity=0.218  Sum_probs=122.8

Q ss_pred             cccccccccCCCCchhHHHHHHHHHHHhhhcCccchhhhhhHhhhhcCCCCCCeeecCCCcEEEEEec--CCCCCCCCCC
Q 029686           31 TKQQQQQLSFDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIAS--GSGVEAPYGE  108 (189)
Q Consensus        31 ~c~~~~~~~~~~rr~~~~~~~~~la~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~Gl~y~~~~~--G~G~~~~~gd  108 (189)
                      +|+.||+     |||+...+.+++..++.++..+.+.++........+++...+.++++|++|.++++  |+|..|+.||
T Consensus        16 ~c~~~~~-----~~pv~~~~~~~~~~s~~rnk~l~~~e~~~I~~~i~~~~~~~~~~t~sGl~Y~v~~~~~g~g~~p~~gd   90 (177)
T TIGR03516        16 GCKTPEA-----RRPISRSSGTTIKLSAERNKKLIAAEEAAIKRIISADSIVKYETSQNGFWYYYNQKDTGEGTTPEFGD   90 (177)
T ss_pred             hcCCCCC-----CCCcCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCceECCCccEEEEEEecCCCCCcCCCCC
Confidence            4776766     88888888889999999987776665554444444556788999999999999977  6667799999


Q ss_pred             EEEEEEEEEecCCcEEeccccCCccEEEEeCCCChhHHHHHHHcCCCCCCCccCCce-EEEecCCCCCCCCCCCCce
Q 029686          109 LINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGTW-KTQTPDSTRVSIRARTCRM  184 (189)
Q Consensus       109 ~V~v~y~~~~~~G~~~~ss~~~g~p~~f~lG~~~~i~G~~~~l~g~~~~~~mk~Ge~-~v~iP~~layG~~g~~~~i  184 (189)
                      .|.+||++++.||++|+++++. .|+.|.+|.+++++||+++|.+      |++||+ +|+||+++|||++|.++.|
T Consensus        91 ~V~v~Y~~~~~dG~v~~ss~~~-~P~~f~vg~~~vi~Gl~e~L~~------Mk~Ge~~~~~iP~~~AYG~~g~~~~I  160 (177)
T TIGR03516        91 LVTFEYDIRALDGDVIYSEEEL-GPQTYKVDQQDLFSGLRDGLKL------MKEGETATFLFPSHKAYGYYGDQNKI  160 (177)
T ss_pred             EEEEEEEEEeCCCCEEEeCCCC-CCEEEEeCCcchhHHHHHHHcC------CCCCCEEEEEECHHHcCCCCCCCCCc
Confidence            9999999999999999999875 5999999999999999999999      999999 9999999999999988776

Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldI is a FKBP-type peptidyl-prolyl cis-trans isomerase (pfam00254) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockout of this gene abolishes the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. This family is only found in Bacteroidetes containing the suite of genes proposed to confer the gliding motility phenotype.
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 4e-24
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 3e-11
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-11
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-11
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-11
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 4e-11
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-11
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 6e-11
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 7e-11
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-10
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 5e-09
2pbc_A102 Fk506-Binding Protein 2 Length = 102 7e-09
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 2e-07
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 2e-07
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 1e-06
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 1e-06
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-06
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-06
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 5e-06
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 5e-06
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 5e-06
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 5e-06
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 6e-06
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 7e-06
3o5d_A 264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 7e-06
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 7e-06
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 7e-06
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 9e-06
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 3e-05
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 5e-05
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 1e-04
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 1e-04
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-04
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 1e-04
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 2e-04
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-04
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 2e-04
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-04
1q1c_A 280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 2e-04
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 2e-04
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 3e-04
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 4e-04
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 6e-04
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 7e-04
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure 
Iteration: 1

 Score =  107 bits (267), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 1/103 (0%)
Query: 82  CEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVG 141
           CEFS + SGL +CD   G G EA  G+LI  HY  +  +G +FDSSY R +PLT RIGVG
Sbjct: 5   CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVG 64
Query: 142 KVIKGLDQGILGGDGVPPMHVGTWKT-QTPDSTRVSIRARTCR 183
           +VIKG DQGILG DG+PPM  G  +T + P       R   C+
Sbjct: 65  EVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCK 107
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 1e-32
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 3e-22
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 9e-22
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 2e-21
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-21
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 7e-21
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 1e-20
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 2e-20
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-20
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 7e-20
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 9e-20
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 5e-12
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-09
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 1e-19
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 4e-19
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 8e-06
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 8e-19
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 7e-18
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 7e-18
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 8e-18
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-17
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-06
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-16
1fd9_A213 Protein (macrophage infectivity potentiator prote; 7e-15
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 7e-15
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 3e-14
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 6e-14
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 6e-14
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 3e-12
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 6e-12
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-11
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 5e-09
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 1e-08
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 2e-08
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 5e-08
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 6e-07
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 8e-07
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 1e-05
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
 Score =  112 bits (283), Expect = 1e-32
 Identities = 49/83 (59%), Positives = 58/83 (69%)

Query: 81  PCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGV 140
            CEFS + SGL +CD   G G EA  G+LI  HY  +  +G +FDSSY R +PLT RIGV
Sbjct: 4   SCEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGV 63

Query: 141 GKVIKGLDQGILGGDGVPPMHVG 163
           G+VIKG DQGILG DG+PPM  G
Sbjct: 64  GEVIKGWDQGILGSDGIPPMLTG 86
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 1e-12
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 1e-07
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 8e-07
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 1e-06
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 2e-06
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 2e-06
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-05
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 2e-05
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 8e-04
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP13
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 60.3 bits (145), Expect = 1e-12
 Identities = 50/88 (56%), Positives = 60/88 (68%)

Query: 82  CEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVG 141
           CEFS + SGL +CD   G G EA  G+LI  HY  +  +G +FDSSY R +PLT RIGVG
Sbjct: 1   CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVG 60

Query: 142 KVIKGLDQGILGGDGVPPMHVGTWKTQT 169
           +VIKG DQGILG DG+PPM  G  +T  
Sbjct: 61  EVIKGWDQGILGSDGIPPMLTGGKRTLR 88
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.89
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.89
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.89
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.85
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.84
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.83
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.82
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.82
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.82
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.64
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.58
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.55
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.05
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.34
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.29
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Peptidyl-prolyl cis-trans isomerase FkpA
species: Escherichia coli [TaxId: 562]

Probab=99.89  E-value=2e-23  Score=150.62  Aligned_cols=96  Identities=25%  Similarity=0.397  Sum_probs=89.2

Q ss_pred             CCCCCEEECCCCCEEEEEECCCCCCCCCCCEEEEEEEEEECCCCEEECCCCCCCCEEEEECCCCHHHHHHHHHCCCCCCC
Q ss_conf             99998166699738999855988878999979999999962991896455688268999489871688999772999999
Q 029686           79 DPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVP  158 (189)
Q Consensus        79 ~~~~~~~~~~sG~~y~~~~~G~G~~~~~gd~V~v~y~~~~~~G~~~~ss~~~g~p~~~~iG~~~~i~Gl~~~l~g~~~l~  158 (189)
                      .....+..+++|++|+++++|+|+.|..||.|.|||++++.||++|++++.++.|+.|.+  +++|+||+++|.+     
T Consensus        97 ~~~~~v~~~~sGl~y~v~~~G~G~~p~~gd~v~v~y~g~l~dG~~fd~s~~~~~p~~~~~--~~vi~g~~e~l~~-----  169 (210)
T d1q6ha_          97 AKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRL--DGVIPGWTEGLKN-----  169 (210)
T ss_dssp             HHSTTEEECTTSCEEEEEECCSSCCCCTTCEEEEEEEEEETTSCEEEEGGGGTSCEEEEG--GGSCHHHHHHGGG-----
T ss_pred             CCCCCEEECCCCEEEEEEECCCCCCCCCCCEEEEEEEEEECCCCEEEECCCCCCCCEECC--CCCCHHHHHHHHH-----
T ss_conf             245735982583599985078887777884699999999768979863234898431016--7635368898754-----


Q ss_pred             CCCCCCE-EEEECCCCCCCCCCCCC
Q ss_conf             8557955-99966999899889999
Q 029686          159 PMHVGTW-KTQTPDSTRVSIRARTC  182 (189)
Q Consensus       159 lmk~Ge~-~v~iP~~layG~~g~~~  182 (189)
                       |++|++ +++|||++|||+.|.+.
T Consensus       170 -m~~G~k~~~~iP~~laYG~~g~~~  193 (210)
T d1q6ha_         170 -IKKGGKIKLVIPPELAYGKAGVPG  193 (210)
T ss_dssp             -SCTTCEEEEEECGGGTTTTTCBTT
T ss_pred             -CCCCCEEEEEECHHHCCCCCCCCC
T ss_conf             -558988999999898808789999
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure