Citrus Sinensis ID: 029791

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19

MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITGIVN

cccEEEEEEccccHHHHHHHHHHccccEEEEEEccccccHHHHHHHcccccccccccccEEEEEcccEEEEccEEEEEEEEccccccccccccccEEEEcccccccHHHHHHHHcccccEEEEccccccccEEEEEcccccccccccEEEEccHHHccHHHHHHEEcccccccccccccHHccccccc

cccEEEEEEcccHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHcccccccccccEEEEcEccEEEEccEEEEEEccccHHHccHHHHcccEEEEcccccccHHHHHHHHcccccEEEEccccccccEccccccHHHccccccEEEcccHHHHHHHHHHHHHHHHHcEEEEEEEEEEccccccc

mgkvkigingFGRIGRLVARVILqrddvelvavndpfittdYMTYMFKYdsvhgqwkhhelkvkddktllfgekpvtvfgvrnpeeipwaetgAEYVVestgvftdkDKAAAHLKGGAKKVIisapskdapmfvvgvneneykpelnivsnascttnclaPLAKVIHDKFGIVEGLMTTVHSITGIVN

mgkvkigingfgrigRLVARVilqrddvelvavndpFITTDYMTYMFKYDSVHGQWKHHElkvkddktllfgekpvtvfgvrnpeeipwaeTGAEYVVESTGVFTDKDKAAAHLKGGAKKViisapskdaPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITGIVN

MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTdkdkaaahlkggakkVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITGIVN

***VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITGI**

*GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITGI**

MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITGIVN

*GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSIT****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITGIVN

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		188	2.2.26 [Sep-21-2011]
P34783		360	Glyceraldehyde-3-phosphat	N/A	no	0.984	0.513	0.924	4e-99
P26518		341	Glyceraldehyde-3-phosphat	N/A	no	0.968	0.533	0.939	4e-98
Q9FX54		338	Glyceraldehyde-3-phosphat	yes	no	0.973	0.541	0.901	2e-97
P25858		338	Glyceraldehyde-3-phosphat	yes	no	0.973	0.541	0.896	5e-97
P26520		337	Glyceraldehyde-3-phosphat	N/A	no	0.984	0.548	0.891	6e-97
P04796		338	Glyceraldehyde-3-phosphat	N/A	no	0.973	0.541	0.901	2e-96
Q7FAH2		337	Glyceraldehyde-3-phosphat	yes	no	0.984	0.548	0.891	3e-96
P34921		338	Glyceraldehyde-3-phosphat	N/A	no	0.984	0.547	0.897	2e-95
P25861		337	Glyceraldehyde-3-phosphat	N/A	no	0.984	0.548	0.897	3e-95
Q42671		337	Glyceraldehyde-3-phosphat	N/A	no	0.984	0.548	0.881	5e-95

>sp\|P34783\|G3P_ATRNU Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1	Back alignment and function desciption

 Score =  360 bits (923), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%)

Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE 60
           M KVKIGINGFGRIGRLVARVILQ DD ELVA+NDPFITTDYMTYMFKYDSVHGQWKHHE
Sbjct: 1   MAKVKIGINGFGRIGRLVARVILQSDDCELVAINDPFITTDYMTYMFKYDSVHGQWKHHE 60

Query: 61  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK 120
           LKVKD+KTLLFGE+PVTVFG RNPEEIPW +TGA+YVVESTGVFTDKDKAAAHLKGGAKK
Sbjct: 61  LKVKDEKTLLFGERPVTVFGNRNPEEIPWGQTGADYVVESTGVFTDKDKAAAHLKGGAKK 120

Query: 121 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 180
           VIISAPSKDAPMFVVGVNE+EYK ELNIVSNASCTTNCLAPLAKVI+DKFGIVEGLMTTV
Sbjct: 121 VIISAPSKDAPMFVVGVNEHEYKSELNIVSNASCTTNCLAPLAKVINDKFGIVEGLMTTV 180

Query: 181 HSITG 185
           HSIT 
Sbjct: 181 HSITA 185

Atriplex nummularia (taxid: 3553)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2

>sp\|P26518\|G3PC_MAGLI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1	Back alignment and function description

>sp\|Q9FX54\|G3PC2_ARATH Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Arabidopsis thaliana GN=GAPC2 PE=1 SV=1	Back alignment and function description

>sp\|P25858\|G3PC1_ARATH Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Arabidopsis thaliana GN=GAPC1 PE=1 SV=2	Back alignment and function description

>sp\|P26520\|G3PC_PETHY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1	Back alignment and function description

>sp\|P04796\|G3PC_SINAL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2	Back alignment and function description

>sp\|Q7FAH2\|G3PC2_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC2 PE=1 SV=1	Back alignment and function description

>sp\|P34921\|G3PC_DIACA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1	Back alignment and function description

>sp\|P25861\|G3PC_ANTMA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1	Back alignment and function description

>sp\|Q42671\|G3PC_CRAPL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		188
211906518		336	glyceraldehyde-3-phosphate dehydrogenase	0.984	0.550	0.935	8e-99
386278568		277	glyceraldehyde-3-phosphate dehydrogenase	0.978	0.664	0.940	1e-98
359491599		337	PREDICTED: glyceraldehyde-3-phosphate de	0.984	0.548	0.929	2e-98
211906470		340	glyceraldehyde-3-phosphate dehydrogenase	0.984	0.544	0.918	3e-98
257815169		337	NAD-dependent glyceraldehyde 3-P dehydro	0.984	0.548	0.908	6e-98
255540341		337	glyceraldehyde 3-phosphate dehydrogenase	0.984	0.548	0.913	7e-98
418731090		337	glyceraldehyde 3-phosphate dehydrogenase	0.984	0.548	0.924	1e-97
224119602		338	predicted protein [Populus trichocarpa]	0.978	0.544	0.918	1e-97
462141		360	RecName: Full=Glyceraldehyde-3-phosphate	0.984	0.513	0.924	2e-97
4539543		337	glyceraldehyde-3-phosphate dehydrogenase	0.984	0.548	0.918	3e-97

>gi\|211906518\|gb\|ACJ11752.1\| glyceraldehyde-3-phosphate dehydrogenase C subunit [Gossypium hirsutum]	Back alignment and taxonomy information

 Score =  364 bits (935), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 173/185 (93%), Positives = 179/185 (96%)

Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE 60
           MGK+KIGINGFGRIGRLVARV LQ DD+ELVAVNDPFITT+YMTYMFKYDSVHGQWKHHE
Sbjct: 1   MGKIKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTEYMTYMFKYDSVHGQWKHHE 60

Query: 61  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK 120
           LKVKD KTLLFGEKPVTVFG+RNPEEIPWAE GAEYVVESTGVFTDKDKAAAHLKGGAKK
Sbjct: 61  LKVKDSKTLLFGEKPVTVFGIRNPEEIPWAEAGAEYVVESTGVFTDKDKAAAHLKGGAKK 120

Query: 121 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 180
           VIISAPSKDAPMFVVGVNE EYKP+LNIVSNASCTTNCLAPLAKVI+DKFGIVEGLMTTV
Sbjct: 121 VIISAPSKDAPMFVVGVNEKEYKPDLNIVSNASCTTNCLAPLAKVINDKFGIVEGLMTTV 180

Query: 181 HSITG 185
           HSIT 
Sbjct: 181 HSITA 185

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|386278568\|gb\|AFJ04516.1\| glyceraldehyde-3-phosphate dehydrogenase, partial [Vernicia fordii]	Back alignment and taxonomy information

>gi\|359491599\|ref\|XP_002263145.2\| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Vitis vinifera]	Back alignment and taxonomy information

>gi\|211906470\|gb\|ACJ11728.1\| glyceraldehyde-3-phosphate dehydrogenase [Gossypium hirsutum]	Back alignment and taxonomy information

>gi\|257815169\|gb\|ACV69976.1\| NAD-dependent glyceraldehyde 3-P dehydrogenase [Solanum chacoense]	Back alignment and taxonomy information

>gi\|255540341\|ref\|XP_002511235.1\| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] gi\|223550350\|gb\|EEF51837.1\| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|418731090\|gb\|AFX67011.1\| glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum]	Back alignment and taxonomy information

>gi\|224119602\|ref\|XP_002318114.1\| predicted protein [Populus trichocarpa] gi\|118482565\|gb\|ABK93203.1\| unknown [Populus trichocarpa] gi\|222858787\|gb\|EEE96334.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|462141\|sp\|P34783.1\|G3P_ATRNU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH gi\|409575\|gb\|AAA03442.1\| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia] gi\|414607\|emb\|CAA53269.1\| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia]	Back alignment and taxonomy information

>gi\|4539543\|emb\|CAB39974.1\| glyceraldehyde-3-phosphate dehydrogenase [Nicotiana tabacum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		188
TAIR\|locus:2010007		338	GAPC2 "glyceraldehyde-3-phosph	0.968	0.538	0.824	9.7e-80
TAIR\|locus:2103085		338	GAPC1 "glyceraldehyde-3-phosph	0.968	0.538	0.818	2.6e-79
TAIR\|locus:2206435		422	GAPCP-1 "glyceraldehyde-3-phos	0.968	0.431	0.633	9.3e-59
TAIR\|locus:2032810		420	GAPCP-2 "glyceraldehyde-3-phos	0.968	0.433	0.644	1.2e-58
UNIPROTKB\|Q5RAB4		335	GAPDH "Glyceraldehyde-3-phosph	0.968	0.543	0.614	2.5e-56
CGD\|CAL0005657		335	TDH3 [Candida albicans (taxid:	0.952	0.534	0.624	4.2e-56
UNIPROTKB\|P04406		335	GAPDH "Glyceraldehyde-3-phosph	0.968	0.543	0.603	4.2e-56
UNIPROTKB\|Q5ADM7		335	TDH3 "Glyceraldehyde-3-phospha	0.952	0.534	0.624	4.2e-56
UNIPROTKB\|Q9N2D5		333	GAPDH "Glyceraldehyde-3-phosph	0.952	0.537	0.607	9.9e-55
RGD\|2661		333	Gapdh "glyceraldehyde-3-phosph	0.952	0.537	0.607	1.3e-54

TAIR\|locus:2010007 GAPC2 "glyceraldehyde-3-phosphate dehydrogenase C2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 801 (287.0 bits), Expect = 9.7e-80, P = 9.7e-80
 Identities = 150/182 (82%), Positives = 164/182 (90%)

Query:     3 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELK 62
             K++IGINGFGRIGRLVARV+LQRDDVELVAVNDPFITT+YMTYMFKYDSVHGQWKHHELK
Sbjct:     5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK 64

Query:    63 VKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVI 122
             VKDDKTLLFGEKPVTVFG+RNPE+IPW E GA++VVESTGVFT               V+
Sbjct:    65 VKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV 124

Query:   123 ISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHS 182
             ISAPSKDAPMFVVGVNE+EYK +L+IVSNASCTTNCLAPLAKVI+D+FGIVEGLMTTVHS
Sbjct:   125 ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHS 184

Query:   183 IT 184
             IT
Sbjct:   185 IT 186

GO:0005737 "cytoplasm" evidence=ISM

GO:0006006 "glucose metabolic process" evidence=IEA

GO:0006096 "glycolysis" evidence=ISS;RCA;TAS

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0005739 "mitochondrion" evidence=IDA

GO:0006979 "response to oxidative stress" evidence=IDA

GO:0005634 "nucleus" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005730 "nucleolus" evidence=IDA

GO:0005829 "cytosol" evidence=IDA;TAS

GO:0006094 "gluconeogenesis" evidence=RCA;TAS

GO:0005618 "cell wall" evidence=IDA

GO:0046686 "response to cadmium ion" evidence=IEP;RCA

GO:0042742 "defense response to bacterium" evidence=IEP

GO:0016020 "membrane" evidence=IDA

GO:0004365 "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity" evidence=IDA

GO:0005507 "copper ion binding" evidence=IDA

GO:0008270 "zinc ion binding" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=RCA

GO:0006098 "pentose-phosphate shunt" evidence=RCA

GO:0006833 "water transport" evidence=RCA

GO:0006972 "hyperosmotic response" evidence=RCA

GO:0007010 "cytoskeleton organization" evidence=RCA

GO:0007030 "Golgi organization" evidence=RCA

GO:0009266 "response to temperature stimulus" evidence=RCA

GO:0009651 "response to salt stress" evidence=RCA

GO:0010498 "proteasomal protein catabolic process" evidence=RCA

GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA

GO:0019761 "glucosinolate biosynthetic process" evidence=RCA

GO:0051049 "regulation of transport" evidence=RCA

TAIR\|locus:2103085 GAPC1 "glyceraldehyde-3-phosphate dehydrogenase C subunit 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5RAB4 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

CGD\|CAL0005657 TDH3 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

UNIPROTKB\|P04406 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ADM7 TDH3 "Glyceraldehyde-3-phosphate dehydrogenase" [Candida albicans SC5314 (taxid:237561)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9N2D5 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Felis catus (taxid:9685)]	Back alignment and assigned GO terms

RGD\|2661 Gapdh "glyceraldehyde-3-phosphate dehydrogenase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q7FAH2	G3PC2_ORYSJ	1, ., 2, ., 1, ., 1, 2	0.8918	0.9840	0.5489	yes	no
P04796	G3PC_SINAL	1, ., 2, ., 1, ., 1, 2	0.9016	0.9734	0.5414	N/A	no
P26518	G3PC_MAGLI	1, ., 2, ., 1, ., 1, 2	0.9395	0.9680	0.5337	N/A	no
P34783	G3P_ATRNU	1, ., 2, ., 1, ., 1, 2	0.9243	0.9840	0.5138	N/A	no
Q9FX54	G3PC2_ARATH	1, ., 2, ., 1, ., 1, 2	0.9016	0.9734	0.5414	yes	no
P09094	G3PC_TOBAC	1, ., 2, ., 1, ., 1, 2	0.9022	0.9255	0.5337	N/A	no
P25858	G3PC1_ARATH	1, ., 2, ., 1, ., 1, 2	0.8961	0.9734	0.5414	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	1.2.1.12	0.946
3rd Layer	1.2.1	0.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_Genewise1_v1.C_LG_XII1463	SubName- Full=Putative uncharacterized protein; (338 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	grail3.0154005402	phosphoglycerate kinase (EC-2.7.7.2 2.7.2.3) (402 aa)	•		•	•	•	0.956
	eugene3.00080776	RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (402 aa)	•		•	•	•	0.956
	estExt_fgenesh4_pm.C_LG_VIII0335	phosphoglycerate kinase (481 aa)	•		•	•	•	0.946
	estExt_fgenesh4_pm.C_LG_X0655	phosphoglycerate kinase (481 aa)	•		•	•	•	0.945
	estExt_Genewise1_v1.C_LG_IV0988	hypothetical protein (256 aa)	•	•		•	•	0.929
	grail3.0049021504	RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (254 aa)	•	•		•	•	0.928
	estExt_fgenesh4_pg.C_LG_I1744	triose-phosphate isomerase (EC-5.3.1.1) (255 aa)	•	•		•	•	0.927
	estExt_Genewise1_v1.C_LG_X2172	RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (256 aa)	•	•		•	•	0.927
	eugene3.00091331	RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (264 aa)	•	•		•	•	0.923
	estExt_Genewise1_v1.C_LG_IX1362	RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (315 aa)	•	•		•	•	0.913

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		188
PLN02358		338	PLN02358, PLN02358, glyceraldehyde-3-phosphate deh	1e-120
PLN02272		421	PLN02272, PLN02272, glyceraldehyde-3-phosphate deh	1e-109
PTZ00023		337	PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh	6e-89
COG0057		335	COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog	2e-87
TIGR01534		326	TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh	1e-85
pfam00044		148	pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh	4e-74
smart00846		149	smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de	8e-73
PRK07729		343	PRK07729, PRK07729, glyceraldehyde-3-phosphate deh	2e-63
PLN02237		442	PLN02237, PLN02237, glyceraldehyde-3-phosphate deh	3e-60
PTZ00434		361	PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho	4e-59
PRK07403		337	PRK07403, PRK07403, glyceraldehyde-3-phosphate deh	3e-58
PRK15425		331	PRK15425, gapA, glyceraldehyde-3-phosphate dehydro	1e-57
PLN03096		395	PLN03096, PLN03096, glyceraldehyde-3-phosphate deh	2e-57
PRK08955		334	PRK08955, PRK08955, glyceraldehyde-3-phosphate deh	4e-50
PRK13535		336	PRK13535, PRK13535, erythrose 4-phosphate dehydrog	1e-48
TIGR01532		325	TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de	5e-43
PRK08289		477	PRK08289, PRK08289, glyceraldehyde-3-phosphate deh	7e-34
PTZ00353		342	PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph	4e-31
pfam02800		157	pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh	9e-11
COG0136		334	COG0136, Asd, Aspartate-semialdehyde dehydrogenase	3e-05
TIGR01296		338	TIGR01296, asd_B, aspartate-semialdehyde dehydroge	3e-05
PRK04207		341	PRK04207, PRK04207, glyceraldehyde-3-phosphate deh	1e-04
pfam01113		122	pfam01113, DapB_N, Dihydrodipicolinate reductase,	1e-04
PRK00048		257	PRK00048, PRK00048, dihydrodipicolinate reductase;	8e-04
COG0289		266	COG0289, DapB, Dihydrodipicolinate reductase [Amin	0.001

>gnl\|CDD\|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase	Back alignment and domain information

 Score =  344 bits (883), Expect = e-120
 Identities = 165/183 (90%), Positives = 179/183 (97%)

Query: 3   KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELK 62
           K++IGINGFGRIGRLVARV+LQRDDVELVAVNDPFITT+YMTYMFKYDSVHGQWKHHELK
Sbjct: 5   KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK 64

Query: 63  VKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVI 122
           VKDDKTLLFGEKPVTVFG+RNPE+IPW E GA++VVESTGVFTDKDKAAAHLKGGAKKV+
Sbjct: 65  VKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV 124

Query: 123 ISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHS 182
           ISAPSKDAPMFVVGVNE+EYK +L+IVSNASCTTNCLAPLAKVI+D+FGIVEGLMTTVHS
Sbjct: 125 ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHS 184

Query: 183 ITG 185
           IT 
Sbjct: 185 ITA 187

Length = 338

>gnl\|CDD\|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I	Back alignment and domain information

>gnl\|CDD\|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain	Back alignment and domain information

>gnl\|CDD\|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain	Back alignment and domain information

>gnl\|CDD\|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B	Back alignment and domain information

>gnl\|CDD\|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional	Back alignment and domain information

>gnl\|CDD\|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional	Back alignment and domain information

>gnl\|CDD\|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|223214 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233347 TIGR01296, asd_B, aspartate-semialdehyde dehydrogenase (peptidoglycan organisms)	Back alignment and domain information

>gnl\|CDD\|179786 PRK04207, PRK04207, glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|216304 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus	Back alignment and domain information

>gnl\|CDD\|234595 PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|223366 COG0289, DapB, Dihydrodipicolinate reductase [Amino acid transport and metabolism]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		188
PTZ00434		361	cytosolic glyceraldehyde 3-phosphate dehydrogenase	100.0
PTZ00023		337	glyceraldehyde-3-phosphate dehydrogenase; Provisio	100.0
PRK15425		331	gapA glyceraldehyde-3-phosphate dehydrogenase A; P	100.0
PLN02237		442	glyceraldehyde-3-phosphate dehydrogenase B	100.0
PTZ00353		342	glycosomal glyceraldehyde-3-phosphate dehydrogenas	100.0
COG0057		335	GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt	100.0
PLN02272		421	glyceraldehyde-3-phosphate dehydrogenase	100.0
PRK07403		337	glyceraldehyde-3-phosphate dehydrogenase; Reviewed	100.0
PRK07729		343	glyceraldehyde-3-phosphate dehydrogenase; Validate	100.0
PLN02358		338	glyceraldehyde-3-phosphate dehydrogenase	100.0
PLN03096		395	glyceraldehyde-3-phosphate dehydrogenase A; Provis	100.0
TIGR01534		327	GAPDH-I glyceraldehyde-3-phosphate dehydrogenase,	100.0
PRK08289		477	glyceraldehyde-3-phosphate dehydrogenase; Reviewed	100.0
PRK13535		336	erythrose 4-phosphate dehydrogenase; Provisional	100.0
PRK08955		334	glyceraldehyde-3-phosphate dehydrogenase; Validate	100.0
TIGR01532		325	E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas	100.0
PF00044		151	Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase,	100.0
smart00846		149	Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase,	100.0
KOG0657		285	consensus Glyceraldehyde 3-phosphate dehydrogenase	100.0
TIGR01546		333	GAPDH-II_archae glyceraldehyde-3-phosphate dehydro	100.0
PRK04207		341	glyceraldehyde-3-phosphate dehydrogenase; Provisio	100.0
PRK06901		322	aspartate-semialdehyde dehydrogenase; Provisional	99.95
COG0136		334	Asd Aspartate-semialdehyde dehydrogenase [Amino ac	99.92
PRK14874		334	aspartate-semialdehyde dehydrogenase; Provisional	99.92
TIGR01745		366	asd_gamma aspartate-semialdehyde dehydrogenase, ga	99.91
TIGR01296		339	asd_B aspartate-semialdehyde dehydrogenase (peptid	99.91
PRK06728		347	aspartate-semialdehyde dehydrogenase; Provisional	99.88
PRK08040		336	putative semialdehyde dehydrogenase; Provisional	99.87
PRK06598		369	aspartate-semialdehyde dehydrogenase; Reviewed	99.86
PRK08664		349	aspartate-semialdehyde dehydrogenase; Reviewed	99.84
PRK05671		336	aspartate-semialdehyde dehydrogenase; Reviewed	99.83
TIGR00978		341	asd_EA aspartate-semialdehyde dehydrogenase (non-p	99.82
PLN02383		344	aspartate semialdehyde dehydrogenase	99.8
PRK00436		343	argC N-acetyl-gamma-glutamyl-phosphate reductase;	99.75
PRK08300		302	acetaldehyde dehydrogenase; Validated	99.71
TIGR01850		346	argC N-acetyl-gamma-glutamyl-phosphate reductase,	99.68
KOG4777		361	consensus Aspartate-semialdehyde dehydrogenase [Am	99.66
PRK11863		313	N-acetyl-gamma-glutamyl-phosphate reductase; Provi	99.66
PLN02968		381	Probable N-acetyl-gamma-glutamyl-phosphate reducta	99.62
TIGR01851		310	argC_other N-acetyl-gamma-glutamyl-phosphate reduc	99.57
TIGR03215		285	ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati	99.56
PF01118		121	Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi	99.09
COG0002		349	ArgC Acetylglutamate semialdehyde dehydrogenase [A	98.6
smart00859		122	Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin	98.48
TIGR01921		324	DAP-DH diaminopimelate dehydrogenase. This model r	98.38
PRK13303		265	L-aspartate dehydrogenase; Provisional	98.32
PRK13302		271	putative L-aspartate dehydrogenase; Provisional	98.24
TIGR00036		266	dapB dihydrodipicolinate reductase.	98.23
PRK13301		267	putative L-aspartate dehydrogenase; Provisional	98.23
PRK06270		341	homoserine dehydrogenase; Provisional	97.96
COG1712		255	Predicted dinucleotide-utilizing enzyme [General f	97.94
PF01113		124	DapB_N: Dihydrodipicolinate reductase, N-terminus;	97.94
PRK13304		265	L-aspartate dehydrogenase; Reviewed	97.93
PRK00048		257	dihydrodipicolinate reductase; Provisional	97.89
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	97.86
PRK06349		426	homoserine dehydrogenase; Provisional	97.84
PRK11579		346	putative oxidoreductase; Provisional	97.8
COG0289		266	DapB Dihydrodipicolinate reductase [Amino acid tra	97.53
COG0673		342	MviM Predicted dehydrogenases and related proteins	97.4
PRK06392		326	homoserine dehydrogenase; Provisional	97.3
PRK06813		346	homoserine dehydrogenase; Validated	97.3
PRK08374		336	homoserine dehydrogenase; Provisional	97.21
PRK10206		344	putative oxidoreductase; Provisional	97.18
COG4091		438	Predicted homoserine dehydrogenase [Amino acid tra	97.11
COG4569		310	MhpF Acetaldehyde dehydrogenase (acetylating) [Sec	97.09
COG0460		333	ThrA Homoserine dehydrogenase [Amino acid transpor	97.06
PLN02775		286	Probable dihydrodipicolinate reductase	96.94
PF03447		117	NAD_binding_3: Homoserine dehydrogenase, NAD bindi	96.92
PRK05447		385	1-deoxy-D-xylulose 5-phosphate reductoisomerase; P	96.8
cd05211		217	NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of	96.75
cd01076		227	NAD_bind_1_Glu_DH NAD(P) binding domain of glutama	96.75
PLN02700		377	homoserine dehydrogenase family protein	96.67
PRK05472		213	redox-sensing transcriptional repressor Rex; Provi	96.55
COG2344		211	AT-rich DNA-binding protein [General function pred	96.38
PLN02819		1042	lysine-ketoglutarate reductase/saccharopine dehydr	96.01
PF02629		96	CoA_binding: CoA binding domain; InterPro: IPR0037	95.99
PRK09414		445	glutamate dehydrogenase; Provisional	95.97
TIGR02130		275	dapB_plant dihydrodipicolinate reductase. This nar	95.82
PLN02477		410	glutamate dehydrogenase	95.74
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	95.71
COG0569		225	TrkA K+ transport systems, NAD-binding component [	95.65
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	95.41
cd05313		254	NAD_bind_2_Glu_DH NAD(P) binding domain of glutama	95.28
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	95.28
TIGR03736		244	PRTRC_ThiF PRTRC system ThiF family protein. A nov	95.18
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	95.17
PTZ00079		454	NADP-specific glutamate dehydrogenase; Provisional	95.1
TIGR01761		343	thiaz-red thiazolinyl imide reductase. This reduct	95.09
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	94.91
KOG2741		351	consensus Dimeric dihydrodiol dehydrogenase [Carbo	94.89
PF03435		386	Saccharop_dh: Saccharopine dehydrogenase ; InterPr	94.87
COG1063		350	Tdh Threonine dehydrogenase and related Zn-depende	94.85
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	94.82
PRK09466		810	metL bifunctional aspartate kinase II/homoserine d	94.8
PRK09436		819	thrA bifunctional aspartokinase I/homoserine dehyd	94.77
PTZ00117		319	malate dehydrogenase; Provisional	94.66
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	94.58
PRK07634		245	pyrroline-5-carboxylate reductase; Reviewed	94.33
PLN02696		454	1-deoxy-D-xylulose-5-phosphate reductoisomerase	94.33
PRK08507		275	prephenate dehydrogenase; Validated	94.27
PTZ00082		321	L-lactate dehydrogenase; Provisional	93.93
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	93.81
PRK08410		311	2-hydroxyacid dehydrogenase; Provisional	93.74
PF05368		233	NmrA: NmrA-like family; InterPro: IPR008030 NmrA i	93.71
PRK14030		445	glutamate dehydrogenase; Provisional	93.71
CHL00194		317	ycf39 Ycf39; Provisional	93.57
PRK06487		317	glycerate dehydrogenase; Provisional	93.56
PRK11880		267	pyrroline-5-carboxylate reductase; Reviewed	93.4
COG0111		324	SerA Phosphoglycerate dehydrogenase and related de	93.34
PRK06932		314	glycerate dehydrogenase; Provisional	93.26
cd08230		355	glucose_DH Glucose dehydrogenase. Glucose dehydrog	93.19
PF13380		116	CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5	93.1
PRK07574		385	formate dehydrogenase; Provisional	92.86
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	92.85
PLN02928		347	oxidoreductase family protein	92.84
COG0287		279	TyrA Prephenate dehydrogenase [Amino acid transpor	92.82
PLN02256		304	arogenate dehydrogenase	92.79
TIGR01202		308	bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl	92.75
PRK06436		303	glycerate dehydrogenase; Provisional	92.64
PRK13243		333	glyoxylate reductase; Reviewed	92.6
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	92.54
PRK11790		409	D-3-phosphoglycerate dehydrogenase; Provisional	92.45
PRK14031		444	glutamate dehydrogenase; Provisional	92.31
PRK06223		307	malate dehydrogenase; Reviewed	92.29
PRK13403		335	ketol-acid reductoisomerase; Provisional	92.27
PRK15409		323	bifunctional glyoxylate/hydroxypyruvate reductase	92.24
PRK12480		330	D-lactate dehydrogenase; Provisional	92.22
COG1052		324	LdhA Lactate dehydrogenase and related dehydrogena	92.1
cd00755		231	YgdL_like Family of activating enzymes (E1) of ubi	92.07
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	91.95
PF00056		141	Ldh_1_N: lactate/malate dehydrogenase, NAD binding	91.89
PLN02306		386	hydroxypyruvate reductase	91.83
PRK15469		312	ghrA bifunctional glyoxylate/hydroxypyruvate reduc	91.73
PRK15438		378	erythronate-4-phosphate dehydrogenase PdxB; Provis	91.53
PLN03139		386	formate dehydrogenase; Provisional	91.42
PRK08605		332	D-lactate dehydrogenase; Validated	91.34
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	91.18
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	91.16
PRK08618		325	ornithine cyclodeaminase; Validated	91.13
PLN00016		378	RNA-binding protein; Provisional	90.88
cd05293		312	LDH_1 A subgroup of L-lactate dehydrogenases. L-la	90.78
PRK07679		279	pyrroline-5-carboxylate reductase; Reviewed	90.63
PLN02602		350	lactate dehydrogenase	90.59
TIGR01915		219	npdG NADPH-dependent F420 reductase. This model re	90.52
PRK06476		258	pyrroline-5-carboxylate reductase; Reviewed	90.42
KOG0455		364	consensus Homoserine dehydrogenase [Amino acid tra	90.29
PRK07417		279	arogenate dehydrogenase; Reviewed	90.18
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	90.14
PLN02712		667	arogenate dehydrogenase	90.14
PLN02688		266	pyrroline-5-carboxylate reductase	90.07
PRK00257		381	erythronate-4-phosphate dehydrogenase; Validated	89.88
PLN02712		667	arogenate dehydrogenase	89.49
TIGR01327		525	PGDH D-3-phosphoglycerate dehydrogenase. This mode	89.39
PRK09880		343	L-idonate 5-dehydrogenase; Provisional	89.39
cd01338		322	MDH_choloroplast_like Chloroplast-like malate dehy	89.37
cd05294		309	LDH-like_MDH_nadp A lactate dehydrogenases-like st	89.27
PRK13581		526	D-3-phosphoglycerate dehydrogenase; Provisional	89.06
PRK09599		301	6-phosphogluconate dehydrogenase-like protein; Rev	88.95
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	88.9
PRK05442		326	malate dehydrogenase; Provisional	88.69
cd00757		228	ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1	88.5
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	88.49
PTZ00431		260	pyrroline carboxylate reductase; Provisional	88.38
COG0334		411	GdhA Glutamate dehydrogenase/leucine dehydrogenase	88.31
PRK12491		272	pyrroline-5-carboxylate reductase; Reviewed	88.3
PRK12490		299	6-phosphogluconate dehydrogenase-like protein; Rev	88.19
COG2910		211	Putative NADH-flavin reductase [General function p	87.92
COG0039		313	Mdh Malate/lactate dehydrogenases [Energy producti	87.8
TIGR03366		280	HpnZ_proposed putative phosphonate catabolism asso	87.75
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	87.73
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	87.6
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	87.59
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	87.58
PRK15116		268	sulfur acceptor protein CsdL; Provisional	87.5
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	87.47
PLN02545		295	3-hydroxybutyryl-CoA dehydrogenase	87.32
TIGR03649		285	ergot_EASG ergot alkaloid biosynthesis protein, AF	87.31
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	87.26
COG0345		266	ProC Pyrroline-5-carboxylate reductase [Amino acid	87.26
COG0771		448	MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas	87.13
PRK05479		330	ketol-acid reductoisomerase; Provisional	86.99
COG3804		350	Uncharacterized conserved protein related to dihyd	86.9
cd05290		307	LDH_3 A subgroup of L-lactate dehydrogenases. L-la	86.87
KOG0069		336	consensus Glyoxylate/hydroxypyruvate reductase (D-	86.85
PRK06046		326	alanine dehydrogenase; Validated	86.84
KOG1502		327	consensus Flavonol reductase/cinnamoyl-CoA reducta	86.6
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	86.59
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	86.53
PRK11154		708	fadJ multifunctional fatty acid oxidation complex	86.52
TIGR00465		314	ilvC ketol-acid reductoisomerase. This is the seco	86.37
PRK08818		370	prephenate dehydrogenase; Provisional	86.15
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	86.01
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	85.97
cd08237		341	ribitol-5-phosphate_DH ribitol-5-phosphate dehydro	85.96
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	85.62
PLN02662		322	cinnamyl-alcohol dehydrogenase family protein	85.61
PF00208		244	ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val	85.52
PRK15059		292	tartronate semialdehyde reductase; Provisional	85.52
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	85.51
PRK15461		296	NADH-dependent gamma-hydroxybutyrate dehydrogenase	85.17
PRK06928		277	pyrroline-5-carboxylate reductase; Reviewed	85.04
TIGR02440		699	FadJ fatty oxidation complex, alpha subunit FadJ.	84.99
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	84.95
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	84.9
PRK07680		273	late competence protein ComER; Validated	84.87
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	84.49
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	84.41
COG1062		366	AdhC Zn-dependent alcohol dehydrogenases, class II	84.35
PRK14619		308	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	84.34
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	84.34
cd01486		307	Apg7 Apg7 is an E1-like protein, that activates tw	84.07
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	83.88
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	83.72
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	83.71
COG1023		300	Gnd Predicted 6-phosphogluconate dehydrogenase [Ca	83.49
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	83.38
PF02670		129	DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re	83.31
PTZ00075		476	Adenosylhomocysteinase; Provisional	83.04
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	82.95
TIGR01019		286	sucCoAalpha succinyl-CoA synthetase, alpha subunit	82.83
KOG0068		406	consensus D-3-phosphoglycerate dehydrogenase, D-is	82.66
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	82.54
cd08298		329	CAD2 Cinnamyl alcohol dehydrogenases (CAD). These	82.31
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	82.28
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	82.17
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	82.17
cd08239		339	THR_DH_like L-threonine dehydrogenase (TDH)-like.	82.08
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	82.05
PRK00683		418	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	81.99
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	81.86
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	81.71
TIGR02441		737	fa_ox_alpha_mit fatty acid oxidation complex, alph	81.0
cd08242		319	MDR_like Medium chain dehydrogenases/reductase (MD	80.78
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	80.72
COG2085		211	Predicted dinucleotide-binding enzymes [General fu	80.52
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	80.44
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	80.24
KOG0024		354	consensus Sorbitol dehydrogenase [Secondary metabo	80.2
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	80.17

>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional	Back alignment and domain information

Probab=100.00  E-value=2.6e-71  Score=480.07  Aligned_cols=187  Identities=50%  Similarity=0.875  Sum_probs=176.0

Q ss_pred             CCccEEEEEccChHHHHHHHHHHcC----CCceEEEEecCCCchhhhhhhhhcccccCcCCCcceEEe-------CCCee
Q 029791            1 MGKVKIGINGFGRIGRLVARVILQR----DDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVK-------DDKTL   69 (188)
Q Consensus         1 m~~~kvgI~G~GriGr~~~r~~~~~----~~~~ivaInd~~~~~~~~~~l~~yDS~~g~~~~~~v~~~-------~~~~l   69 (188)
                      ||++||||||||||||.++|+++++    +++|+|||||++.++++++|||||||+||+|+ ++++.+       +++.|
T Consensus         1 ~m~ikVgINGFGRIGR~v~R~~~~~~~~~~~ievVAINd~~~~~~~~ayLlkyDS~hG~~~-~~v~~~~~~~~~~~~~~l   79 (361)
T PTZ00434          1 MAPIKVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNAEYFAYQMKYDTVHGRPK-YTVETTKSSPSVKTDDVL   79 (361)
T ss_pred             CCceEEEEECcChHHHHHHHHHHHcccCCCCeEEEEEeCCCCChhheeeeeeeecCCCCcC-CceeecccccccccCCEE
Confidence            6778999999999999999998864    57999999998889999999999999999999 899872       34479


Q ss_pred             EECCEEEEEE-eecCCCCCCcccCCccEEEeecCcccCHHhHHHHHhCCCcEEEEeCCCCC-CCeEEeecCccCCCC-CC
Q 029791           70 LFGEKPVTVF-GVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKD-APMFVVGVNENEYKP-EL  146 (188)
Q Consensus        70 ~i~g~~i~v~-~~~~p~~~~w~~~~vdiV~e~tg~~~~~~~~~~h~~~Gakkviis~ps~d-~p~~V~gvN~~~~~~-~~  146 (188)
                      .+||++|.++ +++||+++||+++|+|||+||||.|++++.++.|+++||||||||+|++| .||||+|||++.|++ .+
T Consensus        80 ~ing~~I~~~~~~~dP~~ipW~~~gvD~ViE~TG~f~t~~~a~~Hl~~GAKkViiSAP~~d~~~t~V~GVN~~~y~~~~~  159 (361)
T PTZ00434         80 VVNGHRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTEH  159 (361)
T ss_pred             EECCEEEEEEEecCChhhCchhhcCCCEEEeCceeeccHHHHhhhhhcCCCEEEECCCCCCCCceEEEcCChHHcCcccC
Confidence            9999999986 99999999999999999999999999999999999999999999999887 689999999999997 57


Q ss_pred             ceEEcCChhhHhHHHHHHHH-HhhcCceEEEEEEEeeccCCCC
Q 029791          147 NIVSNASCTTNCLAPLAKVI-HDKFGIVEGLMTTVHSITGIVN  188 (188)
Q Consensus       147 ~iis~~sCtT~~lap~l~~l-~~~~gI~~~~~ttiha~t~~q~  188 (188)
                      +||||+|||||||||++|+| |++|||++++|||+||||++|+
T Consensus       160 ~IiSnASCTTNcLAP~~kvL~~~~fGI~~g~mTTVHayT~~Q~  202 (361)
T PTZ00434        160 HVVSNASCTTNCLAPIVHVLTKEGFGIETGLMTTIHSYTATQK  202 (361)
T ss_pred             cEEECCChHHHhhHHHHHHhhcCCcceEEEEEEEEecccCCcc
Confidence            89999999999999999999 7999999999999999999996

>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional	Back alignment and domain information

>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B	Back alignment and domain information

>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02272 glyceraldehyde-3-phosphate dehydrogenase	Back alignment and domain information

>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>PLN02358 glyceraldehyde-3-phosphate dehydrogenase	Back alignment and domain information

>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional	Back alignment and domain information

>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I	Back alignment and domain information

>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase	Back alignment and domain information

>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate	Back alignment and domain information

>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain	Back alignment and domain information

>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II	Back alignment and domain information

>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial	Back alignment and domain information

>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms)	Back alignment and domain information

>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PRK08040 putative semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms)	Back alignment and domain information

>PLN02383 aspartate semialdehyde dehydrogenase	Back alignment and domain information

>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated	Back alignment and domain information

>PRK08300 acetaldehyde dehydrogenase; Validated	Back alignment and domain information

>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form	Back alignment and domain information

>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional	Back alignment and domain information

>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase	Back alignment and domain information

>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form	Back alignment and domain information

>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating)	Back alignment and domain information

>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate	Back alignment and domain information

>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain	Back alignment and domain information

>TIGR01921 DAP-DH diaminopimelate dehydrogenase	Back alignment and domain information

>PRK13303 L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK13302 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>TIGR00036 dapB dihydrodipicolinate reductase	Back alignment and domain information

>PRK13301 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK06270 homoserine dehydrogenase; Provisional	Back alignment and domain information

>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]	Back alignment and domain information

>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]	Back alignment and domain information

>PRK13304 L-aspartate dehydrogenase; Reviewed	Back alignment and domain information

>PRK00048 dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>PRK06349 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PRK11579 putative oxidoreductase; Provisional	Back alignment and domain information

>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]	Back alignment and domain information

>PRK06392 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PRK06813 homoserine dehydrogenase; Validated	Back alignment and domain information

>PRK08374 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PRK10206 putative oxidoreductase; Provisional	Back alignment and domain information

>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02775 Probable dihydrodipicolinate reductase	Back alignment and domain information

>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway	Back alignment and domain information

>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional	Back alignment and domain information

>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1	Back alignment and domain information

>PLN02700 homoserine dehydrogenase family protein	Back alignment and domain information

>PRK05472 redox-sensing transcriptional repressor Rex; Provisional	Back alignment and domain information

>COG2344 AT-rich DNA-binding protein [General function prediction only]	Back alignment and domain information

>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase	Back alignment and domain information

>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases	Back alignment and domain information

>PRK09414 glutamate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02130 dapB_plant dihydrodipicolinate reductase	Back alignment and domain information

>PLN02477 glutamate dehydrogenase	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01761 thiaz-red thiazolinyl imide reductase	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase	Back alignment and domain information

>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional	Back alignment and domain information

>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional	Back alignment and domain information

>PTZ00117 malate dehydrogenase; Provisional	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK07634 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase	Back alignment and domain information

>PRK08507 prephenate dehydrogenase; Validated	Back alignment and domain information

>PTZ00082 L-lactate dehydrogenase; Provisional	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>PRK08410 2-hydroxyacid dehydrogenase; Provisional	Back alignment and domain information

>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA	Back alignment and domain information

>PRK14030 glutamate dehydrogenase; Provisional	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PRK06487 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK11880 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06932 glycerate dehydrogenase; Provisional	Back alignment and domain information

>cd08230 glucose_DH Glucose dehydrogenase	Back alignment and domain information

>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A	Back alignment and domain information

>PRK07574 formate dehydrogenase; Provisional	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>PLN02928 oxidoreductase family protein	Back alignment and domain information

>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase	Back alignment and domain information

>PRK06436 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK13243 glyoxylate reductase; Reviewed	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK14031 glutamate dehydrogenase; Provisional	Back alignment and domain information

>PRK06223 malate dehydrogenase; Reviewed	Back alignment and domain information

>PRK13403 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional	Back alignment and domain information

>PRK12480 D-lactate dehydrogenase; Provisional	Back alignment and domain information

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>PLN02306 hydroxypyruvate reductase	Back alignment and domain information

>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional	Back alignment and domain information

>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional	Back alignment and domain information

>PLN03139 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK08605 D-lactate dehydrogenase; Validated	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>PRK08618 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PLN00016 RNA-binding protein; Provisional	Back alignment and domain information

>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK07679 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PLN02602 lactate dehydrogenase	Back alignment and domain information

>TIGR01915 npdG NADPH-dependent F420 reductase	Back alignment and domain information

>PRK06476 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>KOG0455 consensus Homoserine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>PLN02688 pyrroline-5-carboxylate reductase	Back alignment and domain information

>PRK00257 erythronate-4-phosphate dehydrogenase; Validated	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase	Back alignment and domain information

>PRK09880 L-idonate 5-dehydrogenase; Provisional	Back alignment and domain information

>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases	Back alignment and domain information

>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity	Back alignment and domain information

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>PRK05442 malate dehydrogenase; Provisional	Back alignment and domain information

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>PTZ00431 pyrroline carboxylate reductase; Provisional	Back alignment and domain information

>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12491 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>COG2910 Putative NADH-flavin reductase [General function prediction only]	Back alignment and domain information

>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion]	Back alignment and domain information

>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PLN02545 3-hydroxybutyryl-CoA dehydrogenase	Back alignment and domain information

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK05479 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown]	Back alignment and domain information

>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion]	Back alignment and domain information

>PRK06046 alanine dehydrogenase; Validated	Back alignment and domain information

>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms]	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>TIGR00465 ilvC ketol-acid reductoisomerase	Back alignment and domain information

>PRK08818 prephenate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PLN02662 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related	Back alignment and domain information

>PRK15059 tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK06928 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PRK07680 late competence protein ComER; Validated	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]	Back alignment and domain information

>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms []	Back alignment and domain information

>PTZ00075 Adenosylhomocysteinase; Provisional	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit	Back alignment and domain information

>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial	Back alignment and domain information

>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		188
3e5r_O		337	Crystal Structure And Functional Analysis Of Glycer		1e-84
3e6a_O		336	Crystal Structure And Functional Analysis Of Glycer		7e-84
1znq_O		338	Crsytal Structure Of Human Liver Gapdh Length = 338		9e-61
1u8f_O		335	Crystal Structure Of Human Placental Glyceraldehyde		1e-60
3gpd_R		334	Twinning In Crystals Of Human Skeletal Muscle D-Gly		9e-58
1j0x_O		332	Crystal Structure Of The Rabbit Muscle Glyceraldehy		2e-56
1ihx_A		333	Crystal Structure Of Two D-Glyceraldehyde-3-Phospha		5e-56
3sth_A		361	Crystal Structure Of Glyceraldehyde-3-Phosphate Deh		8e-56
1szj_G		333	Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr		9e-56
1gpd_G		334	Studies Of Asymmetry In The Three-Dimensional Struc		7e-55
4gpd_1		333	The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho		7e-55
3h9e_B		346	Crystal Structure Of Human Sperm-Specific Glycerald		2e-54
1dss_G		333	Structure Of Active-Site Carboxymethylated D-Glycer		2e-54
3cps_A		354	Crystal Structure Of Cryptosporidium Parvum Glycera		5e-54
1vsu_A		359	Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate		6e-54
4iq8_A		340	Crystal Structure Of Glyceraldehyde-3-phosphate Deh		1e-53
3pym_A		332	Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res		1e-53
2i5p_O		342	Crystal Structure Of Glyceraldehyde-3-Phosphate Deh		2e-53
3cif_A		359	Crystal Structure Of C153s Mutant Glyceraldehyde 3-		9e-53
2vyn_D		334	Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet		5e-51
1ywg_O		337	The Structure Of Glyceraldehyde-3-Phosphate Dehydro		1e-50
2b4r_O		345	Crystal Structure Of Glyceraldehyde-3-Phosphate Deh		2e-50
1gae_O		330	Comparison Of The Structures Of Wild Type And A N31		5e-45
1s7c_A		331	Crystal Structure Of Mes Buffer Bound Form Of Glyce		6e-45
1gad_O		330	Comparison Of The Structures Of Wild Type And A N31		6e-45
2vyn_A		331	Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet		9e-44
1gd1_O		334	Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr		9e-42
3dbv_O		334	Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit		3e-41
1dbv_O		334	Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit		7e-41
1npt_O		334	Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit		1e-40
1nq5_O		334	Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit		1e-40
2x0n_A		359	Structure Of Glycosomal Glyceraldehyde-3-Phosphate		2e-40
2ep7_A		342	Structural Study Of Project Id Aq_1065 From Aquifex		4e-39
1dc4_A		330	Structural Analysis Of Glyceraldehyde 3-Phosphate D		2e-38
1hdg_O		332	The Crystal Structure Of Holo-glyceraldehyde-3-phos		4e-38
1k3t_A		359	Structure Of Glycosomal Glyceraldehyde-3-Phosphate		1e-37
2pkq_O		368	Crystal Structure Of The Photosynthetic A2b2-Glycer		4e-37
3doc_A		335	Crystal Structure Of Trka Glyceraldehyde-3-Phosphat		8e-37
3dmt_C		359	Structure Of Glycosomal Glyceraldehyde-3-Phosphate		3e-36
1gyp_A		358	Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph		3e-35
1a7k_A		360	Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase		4e-35
3l0d_A		356	Crystal Structure Of Glyceraldehyde-3-phosphate Deh		2e-34
3hja_A		356	Crystal Structure Of Glyceraldehyde-3-Phosphate Deh		3e-34
1rm3_O		337	Crystal Structure Of Mutant T33a Of Photosynthetic		5e-34
1rm5_O		337	Crystal Structure Of Mutant S188a Of Photosynthetic		6e-34
1nbo_O		337	The Dual Coenzyme Specificity Of Photosynthetic Gly		6e-34
2pkr_O		365	Crystal Structure Of (A+cte)4 Chimeric Form Of Phot		8e-34
1cer_O		331	Determinants Of Enzyme Thermostability Observed In		2e-33
1jn0_O		335	Crystal Structure Of The Non-Regulatory A4 Isoform		3e-33
3k2b_A		337	Crystal Structure Of Photosynthetic A4 Isoform Glyc		3e-33
4dib_A		345	The Crystal Structure Of Glyceraldehyde-3-Phosphate		4e-33
3b1j_A		339	Crystal Structure Of Dehydrogenese Length = 339		5e-33
2d2i_A		380	Crystal Structure Of Nadp-Dependent Glyceraldehyde-		7e-33
1vc2_A		331	Crystal Structure Of Glyceraldehyde 3-Phosphate Deh		1e-32
3gnq_A		344	Crystal Structure Of Glyceraldehyde-3-Phosphate Deh		3e-32
2g82_O		331	High Resolution Structures Of Thermus Aquaticus Gly		4e-32
3vaz_P		344	Crystal Structure Of Staphylococcal Gapdh1 In A Hex		3e-31
3lvf_P		338	Crystal Structure Of Holo Glyceraldehyde-3-Phosphat		3e-31
3lc7_O		339	Crystal Structure Of Apo Glyceraldehyde-3-Phosphate		3e-31
3k73_Q		336	Crystal Structure Of Phosphate Bound Holo Glycerald		3e-31
3lc1_P		336	Crystal Structure Of H178n Mutant Of Glyceraldehyde		2e-30
3hq4_R		336	Crystal Structure Of C151s Mutant Of Glyceraldehyde		5e-30
3k9q_Q		336	Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde		7e-30
3ksd_Q		336	Crystal Structure Of C151s+h178n Mutant Of Glyceral		3e-29
2x5j_O		339	Crystal Structure Of The Apoform Of The D-Erythrose		6e-28
2xf8_A		338	Structure Of The D-Erythrose-4-Phosphate Dehydrogen		6e-28
1obf_O		335	The Crystal Structure Of Glyceraldehyde 3-Phosphate		2e-26
2x5k_O		339	Structure Of An Active Site Mutant Of The D-Erythro		1e-25

>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337