Citrus Sinensis ID: 029806


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MAIDGVESPCPPCQSPSHFSQPRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTCLAAGTSFSDIILLVL
cccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEcccccccHHHHHHccccccccccccEEEEEc
cccccccccccccccccccccccEEEEEEccHHcHHHHHHHHHHHEEEcccccccEEEEEccHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEccHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHHcccHHHEEHEcc
maidgvespcppcqspshfsqprhFYVAVDRLQFKMETLVELLHLVVagrrpglpmivccssrdELDAVCSAVSNLADISFSSLHSDLAETERTLILEEFRHTAMKWNQKvteqsgdesetgkdehkshmIVVTDAclpllssgesaiSARVLINyelptkkeTYIRRMTTCLAAGTSFSDIILLVL
MAIDGVESPCPPCQSPSHFSQPRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLILEEFRHTAMKwnqkvteqsgdesetgkdehkshMIVVTDACLPLLSSGESAISARVLINyelptkketYIRRMTTclaagtsfsdiILLVL
MAIDGVESPCPPCQSPSHFSQPRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTCLAAGTSFSDIILLVL
**********************RHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLILEEFRHTAMKW**********************MIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTCLAAGTSFSDIILLV*
*********************PRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLILEEFRHTAMKWNQKV*************EHKSHMIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTCLAAGTSFSDIILLVL
******************FSQPRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLILEEFRHTAMKWN******************KSHMIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTCLAAGTSFSDIILLVL
*********************PRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLILEEFRHTAMKWNQKVTE************HKSHMIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTCLAAGTSFSDIILLVL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIDGVESPCPPCQSPSHFSQPRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTCLAAGTSFSDIILLVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
O02494405 Eukaryotic initiation fac yes no 0.609 0.281 0.265 2e-09
Q2HFP1397 ATP-dependent RNA helicas N/A no 0.593 0.279 0.270 5e-09
P0CQ70401 ATP-dependent RNA helicas yes no 0.593 0.276 0.277 8e-09
P0CQ71401 ATP-dependent RNA helicas N/A no 0.593 0.276 0.277 8e-09
Q7RV88397 ATP-dependent RNA helicas N/A no 0.593 0.279 0.263 9e-09
Q0CXD0396 ATP-dependent RNA helicas N/A no 0.593 0.280 0.256 9e-09
A4QVP2396 ATP-dependent RNA helicas N/A no 0.593 0.280 0.263 9e-09
Q2UPY3421 ATP-dependent RNA helicas yes no 0.593 0.263 0.256 1e-08
A1CJT5398 ATP-dependent RNA helicas N/A no 0.593 0.278 0.256 1e-08
A1D7N3398 ATP-dependent RNA helicas N/A no 0.593 0.278 0.256 2e-08
>sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 Back     alignment and function desciption
 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 71/147 (48%), Gaps = 33/147 (22%)

Query: 23  RHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFS 82
           R FYV V++ ++KM+TL++L   +       +  I+ C++R  +D +   +    D + S
Sbjct: 245 RQFYVGVEKDEWKMDTLIDLYETLTI-----VQAIIYCNTRRRVDQLTKQMRE-RDFTCS 298

Query: 83  SLHSDLAETERTLILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLS 142
           S+H D+ + +R +I+ +FR  +                       S +++ TD    LL+
Sbjct: 299 SMHGDMDQKDREVIMRQFRSGS-----------------------SRVLITTD----LLA 331

Query: 143 SGESAISARVLINYELPTKKETYIRRM 169
            G       ++INY+LP   ETYI R+
Sbjct: 332 RGIDVQQVSLVINYDLPVSPETYIHRI 358




ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Cryptosporidium parvum (taxid: 5807)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q2HFP1|IF4A_CHAGB ATP-dependent RNA helicase eIF4A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF1 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ70|IF4A_CRYNJ ATP-dependent RNA helicase eIF4A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIF1 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ71|IF4A_CRYNB ATP-dependent RNA helicase eIF4A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIF1 PE=3 SV=1 Back     alignment and function description
>sp|Q7RV88|IF4A_NEUCR ATP-dependent RNA helicase eIF4A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-1 PE=3 SV=2 Back     alignment and function description
>sp|Q0CXD0|IF4A_ASPTN ATP-dependent RNA helicase eIF4A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tif1 PE=3 SV=2 Back     alignment and function description
>sp|A4QVP2|IF4A_MAGO7 ATP-dependent RNA helicase eIF4A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF1 PE=3 SV=1 Back     alignment and function description
>sp|Q2UPY3|IF4A_ASPOR ATP-dependent RNA helicase eIF4A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tif1 PE=3 SV=1 Back     alignment and function description
>sp|A1CJT5|IF4A_ASPCL ATP-dependent RNA helicase eIF4A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tif1 PE=3 SV=1 Back     alignment and function description
>sp|A1D7N3|IF4A_NEOFI ATP-dependent RNA helicase eIF4A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tif1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
255565156207 conserved hypothetical protein [Ricinus 0.802 0.724 0.771 3e-61
225438690210 PREDICTED: eukaryotic initiation factor 0.919 0.819 0.702 1e-57
449448326233 PREDICTED: ATP-dependent RNA helicase eI 0.925 0.742 0.708 2e-57
449448328211 PREDICTED: ATP-dependent RNA helicase eI 0.925 0.819 0.708 3e-57
449448332208 PREDICTED: ATP-dependent RNA helicase eI 0.951 0.855 0.691 3e-57
334187233258 uncharacterized protein [Arabidopsis tha 0.919 0.666 0.644 3e-53
18419954212 uncharacterized protein [Arabidopsis tha 0.919 0.811 0.644 3e-53
297798174212 hypothetical protein ARALYDRAFT_912642 [ 0.962 0.849 0.610 6e-52
356496882209 PREDICTED: eukaryotic initiation factor 0.909 0.813 0.590 2e-50
224094352231 predicted protein [Populus trichocarpa] 0.871 0.705 0.587 7e-48
>gi|255565156|ref|XP_002523570.1| conserved hypothetical protein [Ricinus communis] gi|223537132|gb|EEF38765.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 130/153 (84%), Gaps = 3/153 (1%)

Query: 23  RHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFS 82
           RHFYVAVDRL FKMETLVELL   VAGRR GLPM+VCCSSRDELDAVCS VSNL  ISF+
Sbjct: 20  RHFYVAVDRLHFKMETLVELLG--VAGRRSGLPMVVCCSSRDELDAVCSVVSNLPYISFA 77

Query: 83  SLHSDLAETERTLILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLS 142
           SL+SDLAE ERT +LE+FR   M+WNQ +T QSG++ E  K E KSHMIVVTD CLPLL+
Sbjct: 78  SLYSDLAEAERTSVLEKFRQVTMRWNQNITAQSGNKDEIEK-EDKSHMIVVTDTCLPLLA 136

Query: 143 SGESAISARVLINYELPTKKETYIRRMTTCLAA 175
           SGES ISARVLINYELPTKKETY RRM++CLAA
Sbjct: 137 SGESPISARVLINYELPTKKETYARRMSSCLAA 169




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438690|ref|XP_002277554.1| PREDICTED: eukaryotic initiation factor 4A [Vitis vinifera] gi|296082429|emb|CBI21434.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449448326|ref|XP_004141917.1| PREDICTED: ATP-dependent RNA helicase eIF4A-like isoform 1 [Cucumis sativus] gi|449530827|ref|XP_004172393.1| PREDICTED: ATP-dependent RNA helicase eIF4A-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448328|ref|XP_004141918.1| PREDICTED: ATP-dependent RNA helicase eIF4A-like isoform 2 [Cucumis sativus] gi|449448330|ref|XP_004141919.1| PREDICTED: ATP-dependent RNA helicase eIF4A-like isoform 3 [Cucumis sativus] gi|449530829|ref|XP_004172394.1| PREDICTED: ATP-dependent RNA helicase eIF4A-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448332|ref|XP_004141920.1| PREDICTED: ATP-dependent RNA helicase eIF4A-like isoform 4 [Cucumis sativus] gi|449530831|ref|XP_004172395.1| PREDICTED: ATP-dependent RNA helicase eIF4A-like isoform 3 [Cucumis sativus] Back     alignment and taxonomy information
>gi|334187233|ref|NP_001190941.1| uncharacterized protein [Arabidopsis thaliana] gi|332661337|gb|AEE86737.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18419954|ref|NP_568013.1| uncharacterized protein [Arabidopsis thaliana] gi|11762152|gb|AAG40354.1|AF325002_1 AT4g37020 [Arabidopsis thaliana] gi|110736928|dbj|BAF00421.1| hypothetical protein [Arabidopsis thaliana] gi|332661336|gb|AEE86736.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297798174|ref|XP_002866971.1| hypothetical protein ARALYDRAFT_912642 [Arabidopsis lyrata subsp. lyrata] gi|297312807|gb|EFH43230.1| hypothetical protein ARALYDRAFT_912642 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356496882|ref|XP_003517294.1| PREDICTED: eukaryotic initiation factor 4A-like [Glycine max] Back     alignment and taxonomy information
>gi|224094352|ref|XP_002310146.1| predicted protein [Populus trichocarpa] gi|222853049|gb|EEE90596.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
UNIPROTKB|A4QVP2396 TIF1 "ATP-dependent RNA helica 0.390 0.184 0.278 1.4e-07
ASPGD|ASPL0000037981398 AN2932 [Emericella nidulans (t 0.390 0.183 0.265 2.5e-07
UNIPROTKB|Q9NZE6312 EIF4A2 "BM-010" [Homo sapiens 0.390 0.233 0.265 1.9e-06
UNIPROTKB|F1LP27312 Eif4a2 "Eukaryotic initiation 0.390 0.233 0.265 1.9e-06
ZFIN|ZDB-GENE-031030-2406 eif4a1a "eukaryotic translatio 0.390 0.179 0.265 2.3e-06
UNIPROTKB|I3LLD5401 I3LLD5 "Uncharacterized protei 0.390 0.182 0.265 3e-06
UNIPROTKB|Q3SZ54406 EIF4A1 "Eukaryotic initiation 0.390 0.179 0.265 3.1e-06
UNIPROTKB|F1P895406 EIF4A1 "Uncharacterized protei 0.390 0.179 0.265 3.1e-06
UNIPROTKB|J9NY67406 EIF4A1 "Uncharacterized protei 0.390 0.179 0.265 3.1e-06
UNIPROTKB|P60842406 EIF4A1 "Eukaryotic initiation 0.390 0.179 0.265 3.1e-06
UNIPROTKB|A4QVP2 TIF1 "ATP-dependent RNA helicase eIF4A" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
 Score = 109 (43.4 bits), Expect = 1.4e-07, Sum P(2) = 1.4e-07
 Identities = 22/79 (27%), Positives = 49/79 (62%)

Query:    23 RHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFS 82
             + FY+AV++ ++K++TL +L   V   +      ++ C++R ++D +   ++   D + S
Sbjct:   237 KQFYIAVEKEEWKLDTLSDLYETVTITQA-----VIFCNTRRKVDWLTDKLT-ARDFTVS 290

Query:    83 SLHSDLAETERTLILEEFR 101
             ++H D+ + +R LI++EFR
Sbjct:   291 AMHGDMDQAQRDLIMKEFR 309


GO:0005575 "cellular_component" evidence=ND
GO:0043581 "mycelium development" evidence=IEP
ASPGD|ASPL0000037981 AN2932 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZE6 EIF4A2 "BM-010" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LP27 Eif4a2 "Eukaryotic initiation factor 4A-II" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031030-2 eif4a1a "eukaryotic translation initiation factor 4A, isoform 1A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLD5 I3LLD5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ54 EIF4A1 "Eukaryotic initiation factor 4A-I" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P895 EIF4A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NY67 EIF4A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P60842 EIF4A1 "Eukaryotic initiation factor 4A-I" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT4G37020
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biological_process unknown; LOCATED IN- cellular_component unknown; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 13 growth stages; Has 1219 Blast hits to 1219 proteins in 256 species- Archae - 0; Bacteria - 99; Metazoa - 480; Fungi - 272; Plants - 177; Viruses - 1; Other Eukaryotes - 190 (source- NCBI BLink). (212 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
ATCEN2
ATCEN2 (CENTRIN2); calcium ion binding; CENTRIN2 (ATCEN2); FUNCTIONS IN- calcium ion binding; I [...] (169 aa)
       0.677
RAD4
RAD4; damaged DNA binding; RAD4; FUNCTIONS IN- damaged DNA binding; INVOLVED IN- nucleotide-exc [...] (865 aa)
       0.599
CEN2
caltractin, putative / centrin, putative; CENTRIN 2 (CEN2); FUNCTIONS IN- calcium ion binding; [...] (171 aa)
       0.599
ACD2
ACD2 (ACCELERATED CELL DEATH 2); red chlorophyll catabolite reductase; Mutants have spontaneous [...] (319 aa)
       0.599
AT5G07660
structural maintenance of chromosomes (SMC) family protein; structural maintenance of chromosom [...] (1058 aa)
       0.534
MIM
MIM (hypersensitive to MMS, irradiation and MMC); ATP binding; Encodes a protein closely relate [...] (1057 aa)
       0.409

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-14
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-07
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-05
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 5e-04
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
 Score = 70.2 bits (172), Expect = 1e-14
 Identities = 40/147 (27%), Positives = 70/147 (47%), Gaps = 33/147 (22%)

Query: 23  RHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFS 82
           R FYVAV++ ++K +TL +L   +   +      I+ C++R ++D +   +    D + S
Sbjct: 242 RQFYVAVEKEEWKFDTLCDLYETLTITQ-----AIIYCNTRRKVDYLTKKMHE-RDFTVS 295

Query: 83  SLHSDLAETERTLILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLS 142
            +H D+ + +R LI+ EFR             SG           + +++ TD    LL+
Sbjct: 296 CMHGDMDQKDRDLIMREFR-------------SG----------STRVLITTD----LLA 328

Query: 143 SGESAISARVLINYELPTKKETYIRRM 169
            G       ++INY+LP   E YI R+
Sbjct: 329 RGIDVQQVSLVINYDLPASPENYIHRI 355


Length = 401

>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.97
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.96
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.96
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.95
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.95
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.94
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.94
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.94
PTZ00110545 helicase; Provisional 99.94
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.93
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 99.93
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.93
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.93
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.93
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.93
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.92
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 99.92
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.92
PTZ00424401 helicase 45; Provisional 99.92
KOG0346 569 consensus RNA helicase [RNA processing and modific 99.92
KOG0327397 consensus Translation initiation factor 4F, helica 99.91
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.91
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 99.91
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.91
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.9
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.9
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.9
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 99.89
KOG0347 731 consensus RNA helicase [RNA processing and modific 99.89
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.88
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.88
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.88
PRK04914 956 ATP-dependent helicase HepA; Validated 99.86
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 99.86
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.86
KOG4284 980 consensus DEAD box protein [Transcription] 99.86
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.85
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.84
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.84
PRK13767 876 ATP-dependent helicase; Provisional 99.83
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.83
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.82
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.82
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.82
PRK10689 1147 transcription-repair coupling factor; Provisional 99.81
PRK13766 773 Hef nuclease; Provisional 99.81
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.81
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.8
PRK05298652 excinuclease ABC subunit B; Provisional 99.8
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.78
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.78
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.78
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.78
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.78
PHA02653 675 RNA helicase NPH-II; Provisional 99.78
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.77
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.76
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.76
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.75
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.73
PRK02362 737 ski2-like helicase; Provisional 99.72
KOG0354 746 consensus DEAD-box like helicase [General function 99.72
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.71
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 99.71
PHA02558501 uvsW UvsW helicase; Provisional 99.71
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.7
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.7
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.68
PRK09401 1176 reverse gyrase; Reviewed 99.68
smart0049082 HELICc helicase superfamily c-terminal domain. 99.67
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.67
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.65
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.63
PRK00254 720 ski2-like helicase; Provisional 99.63
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.61
PRK14701 1638 reverse gyrase; Provisional 99.59
PRK01172 674 ski2-like helicase; Provisional 99.57
COG1202 830 Superfamily II helicase, archaea-specific [General 99.54
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.51
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.51
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.47
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.47
PRK09694 878 helicase Cas3; Provisional 99.47
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.44
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.43
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.41
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.32
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.28
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.26
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.26
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.25
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.23
PRK05580 679 primosome assembly protein PriA; Validated 99.18
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.18
COG1205 851 Distinct helicase family with a unique C-terminal 99.12
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.11
COG1204 766 Superfamily II helicase [General function predicti 98.92
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.8
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.76
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.7
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.66
KOG0387 923 consensus Transcription-coupled repair protein CSB 98.65
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 98.63
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.61
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 98.6
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 98.58
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.52
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 98.5
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 98.44
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 98.41
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.4
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 98.38
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 98.33
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 98.33
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.32
KOG1002791 consensus Nucleotide excision repair protein RAD16 98.3
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.29
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 98.27
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.26
KOG1123 776 consensus RNA polymerase II transcription initiati 98.25
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.22
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 98.15
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 98.11
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 98.1
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.04
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.03
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.01
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.98
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 97.96
COG4096 875 HsdR Type I site-specific restriction-modification 97.93
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 97.86
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.82
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.65
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.64
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.57
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.54
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 97.49
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.49
CHL00122 870 secA preprotein translocase subunit SecA; Validate 97.48
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 97.38
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 97.34
COG4889 1518 Predicted helicase [General function prediction on 97.25
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 97.18
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.1
KOG4439901 consensus RNA polymerase II transcription terminat 97.09
COG1198 730 PriA Primosomal protein N' (replication factor Y) 96.88
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.67
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 96.6
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 96.46
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 96.35
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 96.3
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 96.14
PRK05580 679 primosome assembly protein PriA; Validated 96.07
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.02
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.98
PRK14873 665 primosome assembly protein PriA; Provisional 95.95
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.39
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 95.28
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 95.12
PF13871 278 Helicase_C_4: Helicase_C-like 95.11
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 94.85
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 94.56
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 94.43
COG1198 730 PriA Primosomal protein N' (replication factor Y) 94.4
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 93.82
KOG1001674 consensus Helicase-like transcription factor HLTF/ 93.35
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 93.04
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 93.01
PRK10689 1147 transcription-repair coupling factor; Provisional 92.93
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 92.18
smart00491142 HELICc2 helicase superfamily c-terminal domain. 91.78
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 91.14
PRK14701 1638 reverse gyrase; Provisional 90.9
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 90.8
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 90.18
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 89.36
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 89.28
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 88.23
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 88.2
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 87.89
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 87.39
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 87.11
KOG2340698 consensus Uncharacterized conserved protein [Funct 86.61
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 86.51
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 86.31
KOG0347 731 consensus RNA helicase [RNA processing and modific 86.01
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 85.67
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 85.39
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 84.68
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 84.38
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 84.19
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 84.09
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 84.08
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 83.96
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 83.15
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 82.99
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 82.31
KOG0330 476 consensus ATP-dependent RNA helicase [RNA processi 82.25
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 82.19
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 81.84
PRK13766 773 Hef nuclease; Provisional 81.51
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 81.5
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 81.37
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 81.34
PF11496297 HDA2-3: Class II histone deacetylase complex subun 81.01
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 80.96
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 80.9
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 80.88
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 80.44
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=100.00  E-value=6.9e-33  Score=227.88  Aligned_cols=133  Identities=25%  Similarity=0.516  Sum_probs=125.2

Q ss_pred             CCCCceEEEEccCcchHHHHHHHHHHHHhcCCCCCCcEEEEeCChhhHHHHHHHHHccCCceEEEEeccCCHHHHHHHHH
Q 029806           19 FSQPRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLILE   98 (187)
Q Consensus        19 ~~~i~~~~~~~~~~~~Kl~~L~~ll~~~~~~~~~~~k~IVF~~~~~~~~~l~~~L~~~~~i~~~~lhg~~~~~eR~~~l~   98 (187)
                      .++|.|||+.++.++.|+++|++|...+..     .+++|||||++.++||.+.++..++ .+..+||+|+++||..+++
T Consensus       237 lEgIKqf~v~ve~EewKfdtLcdLYd~LtI-----tQavIFcnTk~kVdwLtekm~~~nf-tVssmHGDm~qkERd~im~  310 (400)
T KOG0328|consen  237 LEGIKQFFVAVEKEEWKFDTLCDLYDTLTI-----TQAVIFCNTKRKVDWLTEKMREANF-TVSSMHGDMEQKERDKIMN  310 (400)
T ss_pred             hhhhhhheeeechhhhhHhHHHHHhhhheh-----heEEEEecccchhhHHHHHHHhhCc-eeeeccCCcchhHHHHHHH
Confidence            467999999999999999999999998554     8999999999999999999999985 9999999999999999999


Q ss_pred             HHhcccccccccccccCCCCCcCCCCCCceeEEEEecCCCCcCcCCCCCCCCCEEEEecCCCChhHHHHhhhhc--cCCC
Q 029806           99 EFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTC--LAAG  176 (187)
Q Consensus        99 ~Fr~~~~~~~~~~~~~~~~~~~~~~~~~~~~iLv~Td~~~~~~~rGlDi~~v~~VI~yd~P~~~~~y~~R~GR~--~r~~  176 (187)
                      +||.|                       +.++|++||+    .+||+|+|.|++|||||+|.+.+.|+|||||.  .|+.
T Consensus       311 dFRsg-----------------------~SrvLitTDV----waRGiDv~qVslviNYDLP~nre~YIHRIGRSGRFGRk  363 (400)
T KOG0328|consen  311 DFRSG-----------------------KSRVLITTDV----WARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRK  363 (400)
T ss_pred             HhhcC-----------------------CceEEEEech----hhccCCcceeEEEEecCCCccHHHHhhhhccccccCCc
Confidence            99999                       4999999999    99999999999999999999999999999998  5567


Q ss_pred             CeEEEEEE
Q 029806          177 TSFSDIIL  184 (187)
Q Consensus       177 g~~i~~v~  184 (187)
                      |++++||.
T Consensus       364 GvainFVk  371 (400)
T KOG0328|consen  364 GVAINFVK  371 (400)
T ss_pred             ceEEEEec
Confidence            99999985



>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 9e-09
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 1e-08
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-08
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-08
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 3e-08
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 3e-08
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 3e-08
2hyi_C413 Structure Of The Human Exon Junction Complex With A 3e-08
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-07
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 3e-07
1fuu_A394 Yeast Initiation Factor 4a Length = 394 4e-07
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure

Iteration: 1

Score = 56.6 bits (135), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 38/144 (26%), Positives = 71/144 (49%), Gaps = 33/144 (22%) Query: 23 RHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFS 82 R FY+ V+R ++K++TL +L + + ++ ++R ++D + + + D + S Sbjct: 255 RQFYINVEREEWKLDTLCDLYETLTITQ-----AVIFINTRRKVDWLTEKM-HARDFTVS 308 Query: 83 SLHSDLAETERTLILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLS 142 ++H D+ + ER +I+ EFR SG S +++ TD LL+ Sbjct: 309 AMHGDMDQKERDVIMREFR-------------SG----------SSRVLITTD----LLA 341 Query: 143 SGESAISARVLINYELPTKKETYI 166 G ++INY+LPT +E YI Sbjct: 342 RGIDVQQVSLVINYDLPTNRENYI 365
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 3e-11
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-09
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-09
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 2e-08
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 5e-08
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 6e-08
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 5e-07
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 2e-06
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 4e-06
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 4e-06
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 7e-06
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 8e-06
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 3e-05
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 5e-05
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 4e-04
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 5e-04
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
 Score = 58.0 bits (141), Expect = 3e-11
 Identities = 40/148 (27%), Positives = 72/148 (48%), Gaps = 37/148 (25%)

Query: 23  RHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFS 82
           + FYV V+  ++K E L +L   +   +      ++ C++R +++ + + + N    + S
Sbjct: 5   KQFYVNVEEEEYKYECLTDLYDSISVTQ-----AVIFCNTRRKVEELTTKLRND-KFTVS 58

Query: 83  SLHSDLAETERTLILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLS 142
           +++SDL + ER  I++EFR             SG           S +++ TD    LL+
Sbjct: 59  AIYSDLPQQERDTIMKEFR-------------SG----------SSRILISTD----LLA 91

Query: 143 SG--ESAISARVLINYELPTKKETYIRR 168
            G     +S  ++INY+LP  KE YI R
Sbjct: 92  RGIDVQQVS--LVINYDLPANKENYIHR 117


>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.97
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.97
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.97
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.96
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.96
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.96
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.96
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.95
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.9
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.94
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.92
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.92
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.91
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.91
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.91
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.91
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.91
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.91
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.9
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.9
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.89
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.89
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.88
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.88
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.87
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.87
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.87
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.86
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.86
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.85
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.85
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.85
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.85
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.84
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.84
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.84
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.84
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.83
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.82
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.8
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.8
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.79
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.78
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.78
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.77
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.77
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.77
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.76
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.76
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.76
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.76
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.75
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.75
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.75
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.74
3h1t_A590 Type I site-specific restriction-modification syst 99.74
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.74
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.73
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.73
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.73
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.72
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.72
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.72
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.72
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.71
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.68
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.67
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.46
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.45
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.3
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.45
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.68
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 97.49
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.11
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 95.74
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 95.56
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 94.53
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 92.07
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 90.96
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 90.94
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 90.9
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 90.54
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 90.36
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 89.9
2jtq_A85 Phage shock protein E; solution structure rhodanes 89.72
2l82_A162 Designed protein OR32; structural genomics, northe 88.91
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 88.32
3foj_A100 Uncharacterized protein; protein SSP1007, structur 88.29
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 87.99
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 87.76
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 87.47
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 87.34
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 87.02
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 86.81
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 86.22
1tq1_A129 AT5G66040, senescence-associated family protein; C 86.03
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 85.54
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 85.35
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 83.29
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 82.43
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 82.25
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 82.24
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 82.12
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 82.1
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 81.46
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 80.88
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 80.28
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 80.14
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
Probab=99.97  E-value=6.9e-30  Score=195.71  Aligned_cols=134  Identities=20%  Similarity=0.371  Sum_probs=121.0

Q ss_pred             CCCCCCCceEEEEccCcchHHHHHHHHHHHHhcCCCCCCcEEEEeCChhhHHHHHHHHHccCCceEEEEeccCCHHHHHH
Q 029806           16 PSHFSQPRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTL   95 (187)
Q Consensus        16 ~~~~~~i~~~~~~~~~~~~Kl~~L~~ll~~~~~~~~~~~k~IVF~~~~~~~~~l~~~L~~~~~i~~~~lhg~~~~~eR~~   95 (187)
                      ...+.+|.|+|+.++..+ |+..|.++++.     .+..++||||+++..++.+++.|...| +.+..+||+|+..+|..
T Consensus         4 ~~~~~~i~~~~~~~~~~~-K~~~L~~ll~~-----~~~~~~lVF~~~~~~~~~l~~~L~~~~-~~~~~~hg~~~~~~r~~   76 (163)
T 2hjv_A            4 GLTTRNIEHAVIQVREEN-KFSLLKDVLMT-----ENPDSCIIFCRTKEHVNQLTDELDDLG-YPCDKIHGGMIQEDRFD   76 (163)
T ss_dssp             --CCCCEEEEEEECCGGG-HHHHHHHHHHH-----HCCSSEEEECSSHHHHHHHHHHHHHTT-CCEEEECTTSCHHHHHH
T ss_pred             ccCcccceEEEEECChHH-HHHHHHHHHHh-----cCCCcEEEEECCHHHHHHHHHHHHHcC-CcEEEEeCCCCHHHHHH
Confidence            355678999999999887 99999999988     345799999999999999999999988 69999999999999999


Q ss_pred             HHHHHhcccccccccccccCCCCCcCCCCCCceeEEEEecCCCCcCcCCCCCCCCCEEEEecCCCChhHHHHhhhhccCC
Q 029806           96 ILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTCLAA  175 (187)
Q Consensus        96 ~l~~Fr~~~~~~~~~~~~~~~~~~~~~~~~~~~~iLv~Td~~~~~~~rGlDi~~v~~VI~yd~P~~~~~y~~R~GR~~r~  175 (187)
                      ++++|+.|.                       .++||+|++    +++|+|+|++++||+||+|+++.+|+||+||++|.
T Consensus        77 ~~~~f~~g~-----------------------~~vlv~T~~----~~~Gld~~~~~~Vi~~~~p~~~~~~~qr~GR~~R~  129 (163)
T 2hjv_A           77 VMNEFKRGE-----------------------YRYLVATDV----AARGIDIENISLVINYDLPLEKESYVHRTGRTGRA  129 (163)
T ss_dssp             HHHHHHTTS-----------------------CSEEEECGG----GTTTCCCSCCSEEEESSCCSSHHHHHHHTTTSSCT
T ss_pred             HHHHHHcCC-----------------------CeEEEECCh----hhcCCchhcCCEEEEeCCCCCHHHHHHhccccCcC
Confidence            999999984                       999999999    99999999999999999999999999999999776


Q ss_pred             C--CeEEEEE
Q 029806          176 G--TSFSDII  183 (187)
Q Consensus       176 ~--g~~i~~v  183 (187)
                      +  |.+++|+
T Consensus       130 g~~g~~~~~~  139 (163)
T 2hjv_A          130 GNKGKAISFV  139 (163)
T ss_dssp             TCCEEEEEEE
T ss_pred             CCCceEEEEe
Confidence            5  5555554



>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 6e-06
d1gkub2 248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 2e-04
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 42.2 bits (98), Expect = 6e-06
 Identities = 37/163 (22%), Positives = 68/163 (41%), Gaps = 33/163 (20%)

Query: 23  RHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFS 82
           + FYV V+  ++K E L +L              ++ C++R +++ + + + N    + S
Sbjct: 2   KQFYVNVEEEEYKYECLTDLYD-----SISVTQAVIFCNTRRKVEELTTKLRND-KFTVS 55

Query: 83  SLHSDLAETERTLILEEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLS 142
           +++SDL + ER  I++EFR                          S +++ TD      +
Sbjct: 56  AIYSDLPQQERDTIMKEFRS-----------------------GSSRILISTDLL----A 88

Query: 143 SGESAISARVLINYELPTKKETYIRRMTTCLAAGTSFSDIILL 185
            G       ++INY+LP  KE YI R+      G     I  +
Sbjct: 89  RGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFV 131


>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 100.0
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.98
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.97
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.95
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.94
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.92
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.89
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.85
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.84
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.82
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.81
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.76
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.73
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.65
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.64
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.5
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.45
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.09
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.09
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.89
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.33
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.1
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 91.68
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 90.5
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 90.49
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 89.03
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 86.92
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 86.87
d1em8a_147 DNA polymerase III chi subunit {Escherichia coli [ 86.47
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 84.92
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 83.35
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 82.31
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 81.94
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 80.36
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5e-34  Score=219.52  Aligned_cols=134  Identities=26%  Similarity=0.488  Sum_probs=123.5

Q ss_pred             CCCCCceEEEEccCcchHHHHHHHHHHHHhcCCCCCCcEEEEeCChhhHHHHHHHHHccCCceEEEEeccCCHHHHHHHH
Q 029806           18 HFSQPRHFYVAVDRLQFKMETLVELLHLVVAGRRPGLPMIVCCSSRDELDAVCSAVSNLADISFSSLHSDLAETERTLIL   97 (187)
Q Consensus        18 ~~~~i~~~~~~~~~~~~Kl~~L~~ll~~~~~~~~~~~k~IVF~~~~~~~~~l~~~L~~~~~i~~~~lhg~~~~~eR~~~l   97 (187)
                      +..+|+|+|+.|++++.|++.|.++++.     .+..++||||+++..++.++..|...| +.+..+||+|+.++|..++
T Consensus         4 tl~~i~q~~v~v~~~~~K~~~L~~ll~~-----~~~~k~iiF~~~~~~~~~~~~~l~~~~-~~~~~~~~~~~~~~r~~~~   77 (168)
T d2j0sa2           4 TLEGIKQFFVAVEREEWKFDTLCDLYDT-----LTITQAVIFCNTKRKVDWLTEKMREAN-FTVSSMHGDMPQKERESIM   77 (168)
T ss_dssp             SCTTEEEEEEEESSTTHHHHHHHHHHHH-----HTSSEEEEECSSHHHHHHHHHHHHHTT-CCCEEECTTSCHHHHHHHH
T ss_pred             CCCCcEEEEEEecChHHHHHHHHHHHHh-----CCCCceEEEeeeHHHHHHHHHHhhhcc-cchhhhhhhhhHHHHHHHH
Confidence            4589999999999987899999999988     345799999999999999999999998 6999999999999999999


Q ss_pred             HHHhcccccccccccccCCCCCcCCCCCCceeEEEEecCCCCcCcCCCCCCCCCEEEEecCCCChhHHHHhhhhccCC--
Q 029806           98 EEFRHTAMKWNQKVTEQSGDESETGKDEHKSHMIVVTDACLPLLSSGESAISARVLINYELPTKKETYIRRMTTCLAA--  175 (187)
Q Consensus        98 ~~Fr~~~~~~~~~~~~~~~~~~~~~~~~~~~~iLv~Td~~~~~~~rGlDi~~v~~VI~yd~P~~~~~y~~R~GR~~r~--  175 (187)
                      +.|+.|+                       .++|||||+    ++||+|+|+|++|||||+|++.++|+||+||+||.  
T Consensus        78 ~~fk~g~-----------------------~~iLv~Td~----~~rGiDi~~v~~VIn~d~P~~~~~yihR~GR~gR~g~  130 (168)
T d2j0sa2          78 KEFRSGA-----------------------SRVLISTDV----WARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGR  130 (168)
T ss_dssp             HHHHHTS-----------------------SCEEEECGG----GSSSCCCTTEEEEEESSCCSSHHHHHHHHTTSSGGGC
T ss_pred             HHHhcCC-----------------------ccEEeccch----hcccccccCcceEEEecCCcCHHHHHhhhccccccCC
Confidence            9999995                       999999999    99999999999999999999999999999999555  


Q ss_pred             CCeEEEEEE
Q 029806          176 GTSFSDIIL  184 (187)
Q Consensus       176 ~g~~i~~v~  184 (187)
                      .|.+++|+.
T Consensus       131 ~G~~i~~~~  139 (168)
T d2j0sa2         131 KGVAINFVK  139 (168)
T ss_dssp             CEEEEEEEE
T ss_pred             CcEEEEEEC
Confidence            477777764



>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1em8a_ c.128.1.1 (A:) DNA polymerase III chi subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure