Citrus Sinensis ID: 029826


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MEGPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIPNDDSLRQRHDPAVGDILQKVESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELVDPHRSLPLVIRARVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLCFLHVAALYRAVLYNRHGGA
ccccccccccccccccccccEEccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ccccccccccccEHcccccccEcccccHHHHHHHHHHHHccccccccccccHHccEEEcccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
megppcgdvcsvchgnfnvpcqancshwfcgnCIMLVWdhgstlqacrcplcrrritllipnddslrqrhdpavgDILQKVEsynrifggpttanglfQRIQDLPFLLRRLVRELvdphrslplVIRARVYIAMIFSAVyifspidiiPEALLGIVGLLDDLLIALLCFLHVAALYRAVLYNRHGGA
MEGPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLlipnddslrqrhDPAVGDILQKVESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELvdphrslplvIRARVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLCFLHVAALYRAVLYNRHGGA
MEGPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIPNDDSLRQRHDPAVGDILQKVESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELVDPHRSLPLVIRARVYIAMIFSAVYIFSPIDIIPEallgivgllddlliallCFLHVAALYRAVLYNRHGGA
*****CGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIPNDDSLRQRHDPAVGDILQKVESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELVDPHRSLPLVIRARVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLCFLHVAALYRAVLYN*****
**GPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIP*****************QKVESYNRIFGG*TT**GLFQRIQDLPFLLRRLVRELVDPHRSLPLVIRARVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLCFLHVAALYRAVLYNR****
MEGPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIPNDDSLRQRHDPAVGDILQKVESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELVDPHRSLPLVIRARVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLCFLHVAALYRAVLYNRHGGA
******GDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIPNDDSLRQRHDPAVGDILQKVESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELVDPHRSLPLVIRARVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLCFLHVAALYRAVLYNRH***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiii
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIPNDDSLRQRHDPAVGDILQKVESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELVDPHRSLPLVIRARVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLCFLHVAALYRAVLYNRHGGA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
F1MK05259 E3 ubiquitin-protein liga yes no 0.903 0.652 0.373 1e-28
Q28DS3257 E3 ubiquitin-protein liga yes no 0.903 0.657 0.371 5e-28
Q8CBG9286 E3 ubiquitin-protein liga yes no 0.903 0.590 0.373 2e-27
Q96K19258 E3 ubiquitin-protein liga yes no 0.903 0.655 0.367 5e-27
Q7SZN2266 E3 ubiquitin-protein liga yes no 0.930 0.654 0.357 9e-27
Q5PPX5257 E3 ubiquitin-protein liga N/A no 0.903 0.657 0.394 2e-23
>sp|F1MK05|RN170_BOVIN E3 ubiquitin-protein ligase RNF170 OS=Bos taurus GN=RNF170 PE=3 SV=2 Back     alignment and function desciption
 Score =  125 bits (315), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 97/174 (55%), Gaps = 5/174 (2%)

Query: 10  CSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIPNDDSLRQR 69
           C +C    ++P + NC H FCG CI+  W +GS L A  CP+CR+ +TLL+P      Q 
Sbjct: 88  CPICLHQASLPVETNCGHLFCGTCIVAYWRYGSWLGAISCPICRQTVTLLLPVFGENDQS 147

Query: 70  HDPAVGDILQKVESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELVDPHRSLPLVIRAR 129
            D  V  + Q +  YNR F G      + +RI DLP LLR   RE+      L  + R R
Sbjct: 148 QD--VVSLHQDISDYNRRFSG--QPRSIMERIMDLPTLLRHAFREMFSVG-GLFWMFRIR 202

Query: 130 VYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLCFLHVAALYRAVLYNR 183
           + + ++ +  Y+ SP+D +PEAL GI+G LDD  +  L  ++++ +YR V+  R
Sbjct: 203 IILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQR 256




E3 ubiquitin-protein ligase. Plays an essential role in stimulus-induced inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) ubiquitination and degradation via the endoplasmic reticulum-associated degradation (ERAD) pathway. Also involved in ITPR1 turnover in resting cells.
Bos taurus (taxid: 9913)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q28DS3|RN170_XENTR E3 ubiquitin-protein ligase RNF170 OS=Xenopus tropicalis GN=rnf170 PE=2 SV=1 Back     alignment and function description
>sp|Q8CBG9|RN170_MOUSE E3 ubiquitin-protein ligase RNF170 OS=Mus musculus GN=Rnf170 PE=1 SV=1 Back     alignment and function description
>sp|Q96K19|RN170_HUMAN E3 ubiquitin-protein ligase RNF170 OS=Homo sapiens GN=RNF170 PE=1 SV=2 Back     alignment and function description
>sp|Q7SZN2|RN170_DANRE E3 ubiquitin-protein ligase RNF170 OS=Danio rerio GN=rnf170 PE=2 SV=1 Back     alignment and function description
>sp|Q5PPX5|RN170_XENLA E3 ubiquitin-protein ligase RNF170 OS=Xenopus laevis GN=rnf170 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
351727639186 uncharacterized protein LOC100306204 [Gl 0.978 0.983 0.695 5e-73
224146326185 predicted protein [Populus trichocarpa] 0.989 1.0 0.711 4e-67
388493190188 unknown [Lotus japonicus] 0.983 0.978 0.689 8e-67
449441207185 PREDICTED: E3 ubiquitin-protein ligase R 0.989 1.0 0.684 8e-67
224135683185 predicted protein [Populus trichocarpa] 0.989 1.0 0.705 3e-66
18410010185 C3HC4-type RING finger protein [Arabidop 0.989 1.0 0.705 2e-65
357455561192 RING finger protein [Medicago truncatula 0.973 0.947 0.617 4e-62
225460374186 PREDICTED: RING finger protein 170 [Viti 0.978 0.983 0.681 7e-61
21554064185 unknown [Arabidopsis thaliana] 0.989 1.0 0.700 9e-61
18395127185 C3HC4-type RING finger protein [Arabidop 0.989 1.0 0.695 2e-60
>gi|351727639|ref|NP_001235376.1| uncharacterized protein LOC100306204 [Glycine max] gi|255627857|gb|ACU14273.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 130/187 (69%), Positives = 157/187 (83%), Gaps = 4/187 (2%)

Query: 2   EGPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIP 61
            GPP  D+CSVCHGNF++PCQANCSHWFCGNCIMLVW HGS   +C+CPLCRR I+LL+P
Sbjct: 3   SGPPANDLCSVCHGNFHIPCQANCSHWFCGNCIMLVWQHGSVGCSCKCPLCRRAISLLVP 62

Query: 62  NDDSLRQRHDPAVGDILQKVESYNRIFGG-PTTANGLFQRIQDLPFLLRRLVRELVDPHR 120
            ++SLRQ+ DP V  IL K+ +YNR FGG PTT   L+QR++DLPFLL RL+RE + PHR
Sbjct: 63  TEESLRQQQDPEVSQILSKIHAYNRFFGGQPTT---LYQRLRDLPFLLHRLLREFLHPHR 119

Query: 121 SLPLVIRARVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLCFLHVAALYRAVL 180
           SLPL+IRARV++ MI S +Y+FSPIDIIPE +LG+VG LDDLLI L+CFLHVAALYR+VL
Sbjct: 120 SLPLLIRARVFVVMIASVIYLFSPIDIIPEGILGVVGFLDDLLIVLICFLHVAALYRSVL 179

Query: 181 YNRHGGA 187
           Y RHGG+
Sbjct: 180 YLRHGGS 186




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224146326|ref|XP_002325966.1| predicted protein [Populus trichocarpa] gi|222862841|gb|EEF00348.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388493190|gb|AFK34661.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449441207|ref|XP_004138374.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224135683|ref|XP_002327279.1| predicted protein [Populus trichocarpa] gi|222835649|gb|EEE74084.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18410010|ref|NP_565037.1| C3HC4-type RING finger protein [Arabidopsis thaliana] gi|13878189|gb|AAK44172.1|AF370357_1 unknown protein [Arabidopsis thaliana] gi|16323398|gb|AAL15193.1| unknown protein [Arabidopsis thaliana] gi|21536916|gb|AAM61248.1| unknown [Arabidopsis thaliana] gi|332197164|gb|AEE35285.1| C3HC4-type RING finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357455561|ref|XP_003598061.1| RING finger protein [Medicago truncatula] gi|355487109|gb|AES68312.1| RING finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225460374|ref|XP_002264470.1| PREDICTED: RING finger protein 170 [Vitis vinifera] gi|296089528|emb|CBI39347.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|21554064|gb|AAM63145.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18395127|ref|NP_564172.1| C3HC4-type RING finger protein [Arabidopsis thaliana] gi|110740529|dbj|BAE98370.1| hypothetical protein [Arabidopsis thaliana] gi|332192128|gb|AEE30249.1| C3HC4-type RING finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
TAIR|locus:505006218185 AT1G72175 [Arabidopsis thalian 0.989 1.0 0.636 6.7e-65
TAIR|locus:2118919262 AT4G33940 [Arabidopsis thalian 0.919 0.656 0.357 5.4e-31
UNIPROTKB|F1NKI3287 RNF170 "Uncharacterized protei 0.893 0.581 0.327 1.1e-23
UNIPROTKB|F1MK05259 RNF170 "E3 ubiquitin-protein l 0.903 0.652 0.321 3.8e-23
MGI|MGI:1924983286 Rnf170 "ring finger protein 17 0.903 0.590 0.321 7e-22
ZFIN|ZDB-GENE-040426-2572266 rnf170 "ring finger protein 17 0.930 0.654 0.313 9e-22
UNIPROTKB|Q96K19258 RNF170 "E3 ubiquitin-protein l 0.903 0.655 0.316 1.9e-21
UNIPROTKB|E2RGZ9639 RNF170 "Uncharacterized protei 0.903 0.264 0.316 2.9e-21
UNIPROTKB|F1NCS0138 F1NCS0 "Uncharacterized protei 0.422 0.572 0.358 5.6e-13
WB|WBGene00012606283 Y38F1A.2 [Caenorhabditis elega 0.732 0.484 0.255 2.7e-11
TAIR|locus:505006218 AT1G72175 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 661 (237.7 bits), Expect = 6.7e-65, P = 6.7e-65
 Identities = 119/187 (63%), Positives = 145/187 (77%)

Query:     1 MEGPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLI 60
             M  PP  D+CS+CH +F  PCQANCSHWFCGNCIMLVW HGSTLQ C+CPLCRR I+LL+
Sbjct:     1 MNSPPENDLCSICHSHFTAPCQANCSHWFCGNCIMLVWRHGSTLQPCKCPLCRRHISLLV 60

Query:    61 PNDDSLRQRHDPAVGDILQKVESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELVDPHR 120
             P++D++R R+D  V ++L  +E+YNR+FGG +++  L QR+QDLPFLLRRL+RE++DP R
Sbjct:    61 PSEDTIRDRNDATVKEVLGNLETYNRLFGGRSSS--LVQRMQDLPFLLRRLLREMMDPQR 118

Query:   121 SLPLVIRARVYIAMIFSAVYIFSPIDIIPEXXXXXXXXXXXXXXXXXCFLHVAALYRAVL 180
             +LPLVIRARVYIAMI SAVYI SPIDIIPE                 CFLHVAALYR+VL
Sbjct:   119 TLPLVIRARVYIAMILSAVYIISPIDIIPEGVLGVVGLLDDLLIALICFLHVAALYRSVL 178

Query:   181 YNRHGGA 187
             Y RH G+
Sbjct:   179 YFRHAGS 185




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2118919 AT4G33940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKI3 RNF170 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MK05 RNF170 "E3 ubiquitin-protein ligase RNF170" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1924983 Rnf170 "ring finger protein 170" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2572 rnf170 "ring finger protein 170" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96K19 RNF170 "E3 ubiquitin-protein ligase RNF170" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGZ9 RNF170 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCS0 F1NCS0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00012606 Y38F1A.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_XIX1941
hypothetical protein (186 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
pfam0680340 pfam06803, DUF1232, Protein of unknown function (D 3e-06
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-06
COG3339116 COG3339, COG3339, Uncharacterized conserved protei 2e-05
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 3e-05
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 7e-05
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 9e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-04
COG5152259 COG5152, COG5152, Uncharacterized conserved protei 8e-04
>gnl|CDD|203520 pfam06803, DUF1232, Protein of unknown function (DUF1232) Back     alignment and domain information
 Score = 42.0 bits (100), Expect = 3e-06
 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 129 RVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDDLLIALLC 168
           +  + ++ + +Y  SPID+IP+  + ++G LDD  +  L 
Sbjct: 2   KAKLLILAALLYFVSPIDLIPD-FIPVLGYLDDAAVLALA 40


This family represents a conserved region of approximately 60 residues within a number of hypothetical bacterial and archaeal proteins of unknown function. Length = 40

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|225876 COG3339, COG3339, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 99.86
COG3339116 Uncharacterized conserved protein [Function unknow 99.64
PF0680340 DUF1232: Protein of unknown function (DUF1232); In 99.6
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.56
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.38
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.29
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.29
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.26
PHA02929238 N1R/p28-like protein; Provisional 99.24
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.23
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.23
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 99.22
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.2
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.17
PHA02926242 zinc finger-like protein; Provisional 99.17
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.16
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.16
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.12
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.11
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.98
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.96
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.94
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.92
PF1463444 zf-RING_5: zinc-RING finger domain 98.92
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.84
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.8
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.74
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.67
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.56
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.49
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.46
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.44
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 98.41
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.39
KOG2660 331 consensus Locus-specific chromosome binding protei 98.38
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.32
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.32
COG5152259 Uncharacterized conserved protein, contains RING a 98.3
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 98.3
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.22
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.21
KOG1002791 consensus Nucleotide excision repair protein RAD16 98.18
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 98.12
COG5222427 Uncharacterized conserved protein, contains RING Z 98.0
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.96
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.95
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.79
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.52
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.49
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.38
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.38
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.35
KOG4367 699 consensus Predicted Zn-finger protein [Function un 97.31
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.1
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 97.02
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.99
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 96.95
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 96.8
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.8
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.73
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.68
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.67
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.63
KOG1001674 consensus Helicase-like transcription factor HLTF/ 96.63
PHA03096284 p28-like protein; Provisional 96.58
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 96.53
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.44
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.2
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 96.18
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.09
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 95.8
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.8
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.56
KOG4739233 consensus Uncharacterized protein involved in syna 95.54
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.44
PF04641260 Rtf2: Rtf2 RING-finger 95.29
KOG3002299 consensus Zn finger protein [General function pred 95.19
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 95.04
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 94.54
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.5
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 94.44
KOG1941518 consensus Acetylcholine receptor-associated protei 94.15
PF10272358 Tmpp129: Putative transmembrane protein precursor; 93.65
PHA02825162 LAP/PHD finger-like protein; Provisional 93.35
KOG02981394 consensus DEAD box-containing helicase-like transc 93.1
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 92.14
KOG3039303 consensus Uncharacterized conserved protein [Funct 92.1
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 91.81
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 91.76
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 91.67
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 91.19
COG5109396 Uncharacterized conserved protein, contains RING Z 90.93
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 90.79
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 90.73
COG5175 480 MOT2 Transcriptional repressor [Transcription] 90.25
KOG3899381 consensus Uncharacterized conserved protein [Funct 90.24
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 88.96
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 88.57
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 88.28
PHA02862156 5L protein; Provisional 87.45
KOG4445368 consensus Uncharacterized conserved protein, conta 85.71
KOG3053293 consensus Uncharacterized conserved protein [Funct 85.39
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 84.61
KOG0825 1134 consensus PHD Zn-finger protein [General function 84.13
KOG1940276 consensus Zn-finger protein [General function pred 83.69
KOG460491 consensus Uncharacterized conserved protein [Funct 81.24
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 80.22
PLN02189 1040 cellulose synthase 80.09
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.86  E-value=3.6e-22  Score=166.45  Aligned_cols=174  Identities=27%  Similarity=0.504  Sum_probs=146.5

Q ss_pred             CcccccccccccCcEEccCCCcccHHHHHHHHHhCCCCCCCCCccccccccc--ccCCCcccccCCCcchhhHHHhH---
Q 029826            7 GDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITL--LIPNDDSLRQRHDPAVGDILQKV---   81 (187)
Q Consensus         7 ~~~C~iC~~~~~~pv~~~C~H~fC~~Ci~~~~~~~~~~~~~~Cp~Cr~~~~~--~~~~~~~~~~~~~~~~~~v~~~i---   81 (187)
                      +..||||++....|+.++|||.||..||.++|..+...+...||+||..++.  +.|..+....+.++  .+...+.   
T Consensus       186 ~~~CPICL~~~~~p~~t~CGHiFC~~CiLqy~~~s~~~~~~~CPiC~s~I~~kdl~pv~~e~~qkke~--l~~~~~~ng~  263 (513)
T KOG2164|consen  186 DMQCPICLEPPSVPVRTNCGHIFCGPCILQYWNYSAIKGPCSCPICRSTITLKDLLPVFIEDDQKKEE--LKLHQDPNGI  263 (513)
T ss_pred             CCcCCcccCCCCcccccccCceeeHHHHHHHHhhhcccCCccCCchhhhccccceeeeeeccccccHH--HHHHhcccCC
Confidence            7899999999999999999999999999999999877788899999999987  77877644422222  2222222   


Q ss_pred             HHhhhhhCCCCCCCccchhhcchhHHHHHHHHhhcCCCCchhHHHHHHHHHHHHHHHHhhhcccccCcchhhhHHHHHHH
Q 029826           82 ESYNRIFGGPTTANGLFQRIQDLPFLLRRLVRELVDPHRSLPLVIRARVYIAMIFSAVYIFSPIDIIPEALLGIVGLLDD  161 (187)
Q Consensus        82 ~~y~~~~s~~~~~~~~~~~l~~~p~ll~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~~~P~D~iPd~~~~~~G~~DD  161 (187)
                      ..|++.|++.. ++.+.+++.+++.+++.+++.++.. ..+..+...+.....++..+|+..|.+.+|+.+.|.+|++||
T Consensus       264 ~~~~r~F~~d~-~r~~p~fl~dl~~~a~~~i~~~~~~-~~l~i~~~~~i~~v~i~~~~~~~~~~~~~~q~~~~~is~lde  341 (513)
T KOG2164|consen  264 PDYNRRFSGDP-ARFVPDFLMDLPTYARINIRNMFNN-HILTIVDQVCIAAVFICQYLSFLLPRRMVPQAIKGRISFLDE  341 (513)
T ss_pred             CccccceecCc-ccccHHHHHhHHHHHHHHHHHhhcc-cceeehhhHhHHHHHHHHHhcccchhhhcchhhcCccCchhh
Confidence            27889998875 4788999999999999999997764 366777778888899999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhh
Q 029826          162 LLIALLCFLHVAALYRAVLYNRH  184 (187)
Q Consensus       162 ~~v~~~~~~~~~~~~~~~~~~r~  184 (187)
                      ..+-..++...++.+++|...|-
T Consensus       342 ~~~~~l~ls~~s~~dne~n~s~~  364 (513)
T KOG2164|consen  342 CTNDQLILSEMSRIDNEYNASRG  364 (513)
T ss_pred             hcchhhhhhhhhhhhhhhhhhhc
Confidence            99999999999999998776653



>COG3339 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06803 DUF1232: Protein of unknown function (DUF1232); InterPro: IPR010652 This family represents a conserved region of approximately 60 residues within a number of hypothetical bacterial and archaeal proteins of unknown function Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4604 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 6e-11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-10
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-09
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-09
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-08
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-08
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 3e-08
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-07
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-07
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-07
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 3e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 4e-07
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 5e-07
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 6e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 6e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-06
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-06
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 2e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 2e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 3e-06
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 4e-06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 4e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 4e-06
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 5e-06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 5e-06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 6e-06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-05
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-05
2ect_A78 Ring finger protein 126; metal binding protein, st 6e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 6e-05
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 2e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 6e-04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 8e-04
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 57.0 bits (137), Expect = 6e-11
 Identities = 15/53 (28%), Positives = 20/53 (37%), Gaps = 5/53 (9%)

Query: 10  CSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRITLLIPN 62
           C +C   F      NC+H FC  CI              CP+CR+ I     +
Sbjct: 67  CIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIE-----CPICRKDIKSKTYS 114


>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.62
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.59
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.57
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.55
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.55
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.54
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.53
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.53
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.53
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.51
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.51
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.51
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.5
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.49
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.48
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.48
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.48
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.47
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.46
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.46
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.46
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.46
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.45
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.44
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.43
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.42
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.42
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.42
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.42
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.42
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.42
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.41
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.4
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.4
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.39
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.39
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.38
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.38
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.37
2ect_A78 Ring finger protein 126; metal binding protein, st 99.36
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.36
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.35
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.35
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.35
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.34
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.34
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.33
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.3
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.29
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.28
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.27
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.23
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.22
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.21
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.18
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.16
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.14
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.14
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.11
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.05
2ea5_A68 Cell growth regulator with ring finger domain prot 99.04
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.04
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.0
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.93
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.82
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.72
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.45
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.37
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.13
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.09
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 97.35
3nw0_A238 Non-structural maintenance of chromosomes element 96.58
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 96.03
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 95.64
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 91.46
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 91.32
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 90.56
1wil_A89 KIAA1045 protein; ring finger domain, structural g 88.92
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 84.25
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 83.62
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 83.2
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
Probab=99.62  E-value=6.8e-16  Score=100.12  Aligned_cols=53  Identities=15%  Similarity=0.179  Sum_probs=47.2

Q ss_pred             CCCCCCCcccccccccccCcEEccCCCcccHHHHHHHHHhCCCCCCCCCcccccccc
Q 029826            1 MEGPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRIT   57 (187)
Q Consensus         1 ~~~~~~~~~C~iC~~~~~~pv~~~C~H~fC~~Ci~~~~~~~~~~~~~~Cp~Cr~~~~   57 (187)
                      ++..++++.|+||++.+.+|+.++|||+||..|+.+|+..+.    ..||.||+++.
T Consensus         2 ~~~~~~~~~C~IC~~~~~~Pv~~~CgH~fc~~Ci~~~~~~~~----~~CP~C~~~~~   54 (78)
T 1t1h_A            2 SPEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGH----KTCPKSQETLL   54 (78)
T ss_dssp             CCCCSSSSSCTTTSCCCSSEEEETTTEEEEHHHHHHHHTTTC----CBCTTTCCBCS
T ss_pred             CcCCcccCCCCCccccccCCEEcCCCCeecHHHHHHHHHHCc----CCCCCCcCCCC
Confidence            456789999999999999999999999999999999997633    39999999884



>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-07
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 6e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 4e-06
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 6e-05
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 7e-05
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 1e-04
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-04
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.002
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 0.003
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.0 bits (106), Expect = 2e-07
 Identities = 12/50 (24%), Positives = 17/50 (34%), Gaps = 4/50 (8%)

Query: 8  DVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRIT 57
           +C +C  N        C H  C +C+    +         CP CR  I 
Sbjct: 24 QLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQ----GCPFCRCEIK 69


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.6
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.58
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.58
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.55
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.52
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.46
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.45
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.43
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.4
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.39
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.39
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.35
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.25
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.07
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.91
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.7
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 96.09
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 91.98
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 88.77
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 83.24
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 82.98
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 80.64
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.60  E-value=5.6e-16  Score=99.59  Aligned_cols=51  Identities=14%  Similarity=0.062  Sum_probs=45.8

Q ss_pred             CCCCCcccccccccccCcEEccCCCcccHHHHHHHHHhCCCCCCCCCcccccccc
Q 029826            3 GPPCGDVCSVCHGNFNVPCQANCSHWFCGNCIMLVWDHGSTLQACRCPLCRRRIT   57 (187)
Q Consensus         3 ~~~~~~~C~iC~~~~~~pv~~~C~H~fC~~Ci~~~~~~~~~~~~~~Cp~Cr~~~~   57 (187)
                      ..++++.||||++++.+|++++|||+||..||.+|+...+.    .||.||++++
T Consensus         3 eiP~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~~~~~----~cP~c~~~l~   53 (80)
T d2c2la2           3 DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGH----FNPVTRSPLT   53 (80)
T ss_dssp             CCCSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHHHTCS----SCTTTCCCCC
T ss_pred             CCCccccCcCcCchhhhhcccCCcCeecHHHHHHHHhcCCc----cCCCcccccc
Confidence            45789999999999999999999999999999999987543    8999999874



>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure