Citrus Sinensis ID: 029849

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MAVAMVLSYHHVSGYVNPNKSSLRARWGQRCSVIRCCNGRAGERASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRSSWKGPPRPEALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQYGDSDQNIE
ccEEEEEEEccccccccccccccccccccccccEEEEEcccccccccccccHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEccccccccc
ccEEEEEEEcccccccccccHHHHHHccccccEEEEEcccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEccEEccHHHHHHHccccEEEEcccccEEEEEEccccHHHcc
MAVAMVLSYHHvsgyvnpnksslrarwgqrcsvirccngrageraskkkNYYELLGVSVEANGQEIKEAYRKLQKkyhpdiagqkgheHTLLLNEAYKVLMRGdlrkdydasigqmrfhfgtnasagfsrsswkgpprpealfvdenacigcrecvhhasntfvmdeatGCARvkvqygdsdqnie
MAVAMVLSYHHVSGYVNPNKSSLRARWGQRCSVIRccngrageraskkknyyELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRSSWKGPPRPEALFVDENACIGCRECVHHASNTFVMDEATGCARVKVqygdsdqnie
MAVAMVLSYHHVSGYVNPNKSSLRARWGQRCSVIRCCNGRAGERASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRSSWKGPPRPEALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQYGDSDQNIE
***AMVLSYHHVSGYVNPNKSSLRARWGQRCSVIRCCNGRAGERASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHFGTNASAGF***********EALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQY********
**********************************************KKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQ***************SSWKGPPRPEALFVDENACIGCRECVHHASNTFVMDEATGCARVKV**********
MAVAMVLSYHHVSGYVNPNKSSLRARWGQRCSVIRCCNGRAGERASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHFGTNA**********GPPRPEALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQYGDSDQNIE
*AVAMVLSYHHVSGYVNPNKSSLRARWGQRCSVIRCCNGRA**RASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRSSWKGPPRPEALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQYGDSD****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVAMVLSYHHVSGYVNPNKSSLRARWGQRCSVIRCCNGRAGERASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRSSWKGPPRPEALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQYGDSDQNIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
Q6MT07 372 Chaperone protein DnaJ OS yes no 0.403 0.201 0.494 9e-13
P71500 372 Chaperone protein DnaJ OS yes no 0.440 0.220 0.464 4e-12
B9DNJ9 377 Chaperone protein DnaJ OS yes no 0.338 0.167 0.531 9e-11
B8CXL0 375 Chaperone protein DnaJ OS yes no 0.430 0.213 0.441 1e-10
Q8G6C6 381 Chaperone protein DnaJ OS yes no 0.344 0.167 0.5 2e-10
Q2YT48 379 Chaperone protein DnaJ OS yes no 0.338 0.166 0.5 3e-10
Q6GGC1 379 Chaperone protein DnaJ OS yes no 0.338 0.166 0.5 3e-10
P63972 379 Chaperone protein DnaJ OS yes no 0.338 0.166 0.5 3e-10
A8Z4B8 379 Chaperone protein DnaJ OS yes no 0.338 0.166 0.5 3e-10
Q6G8Y8 379 Chaperone protein DnaJ OS yes no 0.338 0.166 0.5 3e-10
>sp|Q6MT07|DNAJ_MYCMS Chaperone protein DnaJ OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=dnaJ PE=3 SV=1 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 12/87 (13%)

Query: 47  KKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDI-AGQKGHEHTLLLNEAYKVLMRGDL 105
           KKK+YYE+LGVS  A+ QEI++AYRKL K+YHPD+      H+  + +NEA  VL+  D 
Sbjct: 2   KKKDYYEVLGVSKTASEQEIRQAYRKLAKQYHPDLNKSPDAHDKMVEINEAADVLLDKDK 61

Query: 106 RKDYDASIGQMRFHFGTNA---SAGFS 129
           RK YD         FG NA   S+GFS
Sbjct: 62  RKQYD--------QFGHNAFDGSSGFS 80
Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Mycoplasma mycoides subsp. mycoides SC (strain PG1) (taxid: 272632)
>sp|P71500|DNAJ_MYCCT Chaperone protein DnaJ OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=dnaJ PE=3 SV=2 Back     alignment and function description
>sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q8G6C6|DNAJ_BIFLO Chaperone protein DnaJ OS=Bifidobacterium longum (strain NCC 2705) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q2YT48|DNAJ_STAAB Chaperone protein DnaJ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q6GGC1|DNAJ_STAAR Chaperone protein DnaJ OS=Staphylococcus aureus (strain MRSA252) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
388513049 301 unknown [Lotus japonicus] 0.919 0.568 0.657 1e-62
359494012 302 PREDICTED: uncharacterized protein LOC10 0.946 0.582 0.639 1e-61
356571315276 PREDICTED: uncharacterized protein LOC10 0.865 0.583 0.683 2e-60
224055541 299 predicted protein [Populus trichocarpa] 0.967 0.602 0.616 5e-60
255567365 301 heat shock protein binding protein, puta 0.962 0.594 0.592 5e-57
449450080 301 PREDICTED: uncharacterized protein LOC10 0.973 0.601 0.595 4e-54
359494021284 PREDICTED: uncharacterized protein LOC10 0.913 0.598 0.564 3e-49
148909157 460 unknown [Picea sitchensis] 0.720 0.291 0.654 3e-48
326515996 303 predicted protein [Hordeum vulgare subsp 0.817 0.501 0.569 1e-42
413944067193 hypothetical protein ZEAMMB73_534756 [Ze 0.860 0.829 0.545 5e-42
>gi|388513049|gb|AFK44586.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 115/175 (65%), Positives = 137/175 (78%), Gaps = 4/175 (2%)

Query: 12  VSGYVNPNKSSLRARWGQRCSVIRCCNGRAGERASKKKNYYELLGVSVEANGQEIKEAYR 71
           V G++N N    R    Q  +V+RCCN R+ E+   + NYYELLGVSV+++  +IKEAYR
Sbjct: 20  VHGHMNFNSPMSR----QNVTVVRCCNRRSWEKPRAQNNYYELLGVSVDSDTHQIKEAYR 75

Query: 72  KLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRS 131
           KLQKKYHPDI GQKGHE+TL+LN+AY+VLM  D R+ YD SIGQMR  FG N SA    S
Sbjct: 76  KLQKKYHPDIVGQKGHEYTLMLNKAYEVLMTEDRRRKYDESIGQMRLRFGENNSAPLGYS 135

Query: 132 SWKGPPRPEALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQYGDSDQNIE 186
           +W GP RP+ALFVDENACIGCREC+HHAS+TF+MDEA GCARVKVQYGD D+NIE
Sbjct: 136 TWNGPLRPQALFVDENACIGCRECLHHASHTFIMDEAVGCARVKVQYGDIDKNIE 190

Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359494012|ref|XP_003634709.1| PREDICTED: uncharacterized protein LOC100854700 [Vitis vinifera] gi|297735977|emb|CBI23951.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356571315|ref|XP_003553824.1| PREDICTED: uncharacterized protein LOC100776887 [Glycine max] Back     alignment and taxonomy information
>gi|224055541|ref|XP_002298530.1| predicted protein [Populus trichocarpa] gi|222845788|gb|EEE83335.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255567365|ref|XP_002524662.1| heat shock protein binding protein, putative [Ricinus communis] gi|223536023|gb|EEF37681.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449450080|ref|XP_004142792.1| PREDICTED: uncharacterized protein LOC101222804 [Cucumis sativus] gi|449483772|ref|XP_004156687.1| PREDICTED: uncharacterized LOC101222804 [Cucumis sativus] Back     alignment and taxonomy information
>gi|359494021|ref|XP_003634711.1| PREDICTED: uncharacterized protein LOC100855066 [Vitis vinifera] gi|297735976|emb|CBI23950.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|148909157|gb|ABR17679.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|326515996|dbj|BAJ88021.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|413944067|gb|AFW76716.1| hypothetical protein ZEAMMB73_534756 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
TAIR|locus:2166968 465 AT5G23240 [Arabidopsis thalian 0.795 0.318 0.364 6.9e-21
TAIR|locus:2052426 344 AT2G42750 [Arabidopsis thalian 0.666 0.360 0.340 5.2e-12
UNIPROTKB|F1NNE0 393 DNAJA3 "Uncharacterized protei 0.521 0.246 0.446 7.4e-12
UNIPROTKB|J9P8P4 453 DNAJA3 "Uncharacterized protei 0.494 0.203 0.45 1.3e-11
UNIPROTKB|Q96EY1 480 DNAJA3 "DnaJ homolog subfamily 0.494 0.191 0.45 1.4e-11
UNIPROTKB|A1A4J9 453 DNAJA3 "DnaJ (Hsp40) homolog, 0.494 0.203 0.44 2.7e-11
UNIPROTKB|Q83CJ2 313 cbpA "Curved DNA-binding prote 0.473 0.281 0.395 3.9e-11
TIGR_CMR|CBU_1123 313 CBU_1123 "curved DNA-binding p 0.473 0.281 0.395 3.9e-11
UNIPROTKB|I3LLG4 476 DNAJA3 "Uncharacterized protei 0.494 0.193 0.43 4.9e-11
UNIPROTKB|Q47XI7 378 dnaJ "Chaperone protein DnaJ" 0.424 0.208 0.439 5.1e-11
TAIR|locus:2166968 AT5G23240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 251 (93.4 bits), Expect = 6.9e-21, P = 6.9e-21
 Identities = 55/151 (36%), Positives = 81/151 (53%)

Query:    37 CNGRAGERASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEA 96
             C   +   +    + Y+LLG+   ++  +IK AYR LQK+ HPDIAG  GH+  ++LNEA
Sbjct:    37 CRATSSSSSITDFDLYDLLGIDRSSDKSQIKSAYRALQKRCHPDIAGDPGHDMAIILNEA 96

Query:    97 YKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRSSWKGPPRPE-ALFVDENACIGCREC 155
             Y++L     R+ YD    ++    G      +S   W GP   + A FVDE  C+GC +C
Sbjct:    97 YQLLSDPISRQAYDKEQAKLEELRGYTGKPIYS--VWCGPETEQRAAFVDEVKCVGCLKC 154

Query:   156 VHHASNTFVMDEATGCARVKVQYGDSDQNIE 186
                A  TF ++ A G ARV  Q+ D +  I+
Sbjct:   155 ALCAEKTFAIETAYGRARVVAQWADPESKIK 185
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2052426 AT2G42750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNE0 DNAJA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P8P4 DNAJA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96EY1 DNAJA3 "DnaJ homolog subfamily A member 3, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4J9 DNAJA3 "DnaJ (Hsp40) homolog, subfamily A, member 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q83CJ2 cbpA "Curved DNA-binding protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1123 CBU_1123 "curved DNA-binding protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLG4 DNAJA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q47XI7 dnaJ "Chaperone protein DnaJ" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
pfam0022663 pfam00226, DnaJ, DnaJ domain 3e-19
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 8e-18
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 3e-17
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 5e-16
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-15
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-15
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-15
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 4e-15
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 1e-14
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-14
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-14
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 6e-14
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 8e-14
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 3e-13
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 3e-13
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 4e-13
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 8e-13
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 9e-13
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-12
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 4e-12
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 7e-12
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 9e-12
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 6e-11
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 6e-11
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-10
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 5e-10
pfam1345960 pfam13459, Fer4_15, 4Fe-4S single cluster domain 7e-10
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 8e-10
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 9e-10
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-09
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-09
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 4e-09
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-08
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 1e-08
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-08
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-08
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 1e-07
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 3e-07
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 3e-06
pfam1337058 pfam13370, Fer4_13, 4Fe-4S single cluster domain 6e-06
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-05
PRK05014171 PRK05014, hscB, co-chaperone HscB; Provisional 8e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 0.001
TIGR00714155 TIGR00714, hscB, Fe-S protein assembly co-chaperon 0.001
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 0.002
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 0.002
TIGR01944165 TIGR01944, rnfB, electron transport complex, RnfAB 0.004
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 76.8 bits (190), Expect = 3e-19
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 50  NYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTL--LLNEAYKVLMRGDLRK 107
           +YYE+LGV  +A+ +EIK+AYRKL  KYHPD              +NEAY+VL   + R 
Sbjct: 1   DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60

Query: 108 DYD 110
            YD
Sbjct: 61  IYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|222145 pfam13459, Fer4_15, 4Fe-4S single cluster domain Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|222081 pfam13370, Fer4_13, 4Fe-4S single cluster domain Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|179914 PRK05014, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|233648 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.93
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.86
PRK14288 369 chaperone protein DnaJ; Provisional 99.84
PRK14296 372 chaperone protein DnaJ; Provisional 99.83
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
PRK14279 392 chaperone protein DnaJ; Provisional 99.81
PRK14286 372 chaperone protein DnaJ; Provisional 99.81
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.81
PRK14282 369 chaperone protein DnaJ; Provisional 99.8
PRK14287 371 chaperone protein DnaJ; Provisional 99.8
PRK14283 378 chaperone protein DnaJ; Provisional 99.79
PRK14299 291 chaperone protein DnaJ; Provisional 99.79
PRK14276 380 chaperone protein DnaJ; Provisional 99.79
PRK14291 382 chaperone protein DnaJ; Provisional 99.79
PRK14277 386 chaperone protein DnaJ; Provisional 99.78
PRK14298 377 chaperone protein DnaJ; Provisional 99.78
PRK14280 376 chaperone protein DnaJ; Provisional 99.78
PRK14294 366 chaperone protein DnaJ; Provisional 99.78
PRK14295 389 chaperone protein DnaJ; Provisional 99.78
PRK14297 380 chaperone protein DnaJ; Provisional 99.78
PRK14285 365 chaperone protein DnaJ; Provisional 99.78
PRK14301 373 chaperone protein DnaJ; Provisional 99.77
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.77
PRK14278 378 chaperone protein DnaJ; Provisional 99.77
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PRK10767 371 chaperone protein DnaJ; Provisional 99.76
PRK14284 391 chaperone protein DnaJ; Provisional 99.76
PRK14281 397 chaperone protein DnaJ; Provisional 99.75
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
PRK14289 386 chaperone protein DnaJ; Provisional 99.74
PRK14290 365 chaperone protein DnaJ; Provisional 99.73
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.73
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.73
PRK14300 372 chaperone protein DnaJ; Provisional 99.73
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
PRK14292 371 chaperone protein DnaJ; Provisional 99.72
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
PRK14293 374 chaperone protein DnaJ; Provisional 99.72
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.71
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.68
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.67
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.65
PHA03102153 Small T antigen; Reviewed 99.63
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.62
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.59
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.58
PRK05014171 hscB co-chaperone HscB; Provisional 99.58
PRK01356166 hscB co-chaperone HscB; Provisional 99.57
PRK00294173 hscB co-chaperone HscB; Provisional 99.55
PRK03578176 hscB co-chaperone HscB; Provisional 99.52
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.47
PTZ00100116 DnaJ chaperone protein; Provisional 99.45
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.33
PHA02624 647 large T antigen; Provisional 99.29
PRK01773173 hscB co-chaperone HscB; Provisional 99.24
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.19
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.12
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.99
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.94
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.57
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.49
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.46
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 98.01
PF1345965 Fer4_15: 4Fe-4S single cluster domain 97.1
PF1337058 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 97.0
KOG0431453 consensus Auxilin-like protein and related protein 96.79
COG114168 Fer Ferredoxin [Energy production and conversion] 96.79
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.73
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.35
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 96.01
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 93.24
PF1344662 RPT: A repeated domain in UCH-protein 90.29
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 89.44
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 88.5
KOG0724 335 consensus Zuotin and related molecular chaperones 88.29
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 83.43
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.93  E-value=2e-26  Score=199.92  Aligned_cols=72  Identities=46%  Similarity=0.643  Sum_probs=66.5

Q ss_pred             CCccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCC-C-ccHHHHHHHHHHHHHcCCchhhHHHHhhccccc
Q 029849           46 SKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAG-Q-KGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMR  117 (186)
Q Consensus        46 ~~~~d~Y~iLgv~~~as~~eIk~ayr~~~~~~HPDk~~-~-~~~~~f~~i~~AY~vL~d~~~R~~YD~~~~~~~  117 (186)
                      +...|||+||||+++||.+|||+|||+||++||||+|+ + .|+++|++|++||+||+||++|++||+++....
T Consensus         1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~   74 (371)
T COG0484           1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGF   74 (371)
T ss_pred             CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCcccc
Confidence            35689999999999999999999999999999999999 3 588999999999999999999999999986543

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13459 Fer4_15: 4Fe-4S single cluster domain Back     alignment and domain information
>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1141 Fer Ferredoxin [Energy production and conversion] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 7e-09
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-08
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 1e-07
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-07
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 5e-07
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 7e-07
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-07
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 9e-07
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 1e-06
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 1e-06
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 3e-06
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 3e-06
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 4e-06
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 6e-06
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 3e-05
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 3e-05
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 8e-05
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 8e-05
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 1e-04
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 8e-04
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure 
Iteration: 1

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
Query: 49  KNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEH--TLLLNEAYKVLMRGDLR 106
           +N+Y LLGVS  A+ +EI++A++KL  K HPD      + H   L +N AY+VL   DLR
Sbjct: 21  QNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLR 80
Query: 107 KDYD 110
           K YD
Sbjct: 81  KKYD 84
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 6e-19
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 9e-19
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-18
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 2e-17
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 3e-17
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 3e-17
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 3e-17
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 4e-17
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 7e-17
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 9e-17
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-16
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 1e-16
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 2e-16
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-16
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-16
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 2e-16
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-16
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 6e-16
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 8e-16
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 8e-16
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-15
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-15
1dax_A64 Ferredoxin I; electron transport, electron-transfe 2e-15
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 3e-15
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-15
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 3e-15
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-13
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 2e-13
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-13
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 4e-13
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 6e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-11
2guz_A71 Mitochondrial import inner membrane translocase su 5e-10
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 2e-09
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 4e-07
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 7e-06
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 1e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 3e-04
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
 Score = 78.8 bits (194), Expect = 6e-19
 Identities = 25/119 (21%), Positives = 41/119 (34%), Gaps = 6/119 (5%)

Query: 46  SKKKNYYELLGVSVEA--NGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRG 103
            +     +LLG+   A  N   +++AY K  K++HPD  G    E    +N  YK +  G
Sbjct: 8   EESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGD--EEKMKKMNTLYKKMEDG 65

Query: 104 DLRKDYDA--SIGQMRFHFGTNASAGFSRSSWKGPPRPEALFVDENACIGCRECVHHAS 160
                             F ++ + G      K  P           C+ C   + H +
Sbjct: 66  VKYAHQPDFGGFWDATEVFASSLNPGVDAIYCKQWPECVKKMSTNCICLLCLLRMKHEN 124
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Length = 59 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Length = 64 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Length = 58 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Length = 60 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Length = 66 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.88
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.87
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.86
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.86
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.86
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.86
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.86
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.86
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.86
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.86
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.85
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.85
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.84
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.83
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.83
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.82
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.81
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.8
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.77
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.76
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.75
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.74
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.74
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.73
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.73
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.73
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.71
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.7
2guz_A71 Mitochondrial import inner membrane translocase su 99.68
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.67
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.66
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.65
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.59
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.14
2guz_B65 Mitochondrial import inner membrane translocase su 99.05
1dax_A64 Ferredoxin I; electron transport, electron-transfe 93.75
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 93.64
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 92.43
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 91.3
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 90.58
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 88.87
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 87.49
1yop_A83 KTI11P; zinc finger, metal binding protein; NMR {S 81.66
2jr7_A89 DPH3 homolog; DESR1, CSL zinc finger, metal bindin 81.25
1wge_A83 Hypothetical protein 2610018L09RIK; diphthamide,CS 81.12
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=1.3e-23  Score=162.37  Aligned_cols=120  Identities=23%  Similarity=0.337  Sum_probs=89.6

Q ss_pred             CCCccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCc--------cHHHHHHHHHHHHHcCCchhhHHHHhhcccc
Q 029849           45 ASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQK--------GHEHTLLLNEAYKVLMRGDLRKDYDASIGQM  116 (186)
Q Consensus        45 ~~~~~d~Y~iLgv~~~as~~eIk~ayr~~~~~~HPDk~~~~--------~~~~f~~i~~AY~vL~d~~~R~~YD~~~~~~  116 (186)
                      .+...|||+||||+++++.++||+|||++++++|||+++..        +.+.|++|++||++|+||.+|+.||..+...
T Consensus         6 ~~~~~~~y~iLgv~~~a~~~eIk~aYr~l~~~~HPDk~~~~~~~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~Yd~~~~~~   85 (155)
T 2l6l_A            6 QMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCED   85 (155)
T ss_dssp             CCCCSHHHHHHTCCTTCCHHHHHHHHHHHHHHHSCCCCCCCCTTHHHHHHHHHHHHHHHHHHHSSSHHHHCHHHHHHHHH
T ss_pred             cCCCCChhHhcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCCchhHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHcchh
Confidence            45567999999999999999999999999999999998754        3578999999999999999999999887532


Q ss_pred             cccCCCC---------CCCCCCCCCCCCCCCCCcccc---ccc---ccccCCcccccCcceEE
Q 029849          117 RFHFGTN---------ASAGFSRSSWKGPPRPEALFV---DEN---ACIGCRECVHHASNTFV  164 (186)
Q Consensus       117 ~~~~~~~---------~~~~~~~~~~~~~~~~~~~~~---~e~---~~igC~~C~~~~~~~F~  164 (186)
                      ....+..         .........|..+|+++..|.   ++.   ..++|..|+.+..+.|.
T Consensus        86 ~~~~~~~~~~~~~~~~m~~~e~~~~f~~~CrCG~~f~i~~~~l~~~~~v~C~sCSl~~~v~~~  148 (155)
T 2l6l_A           86 DLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHY  148 (155)
T ss_dssp             HHHTTCSSSEEEETTTSEEETTTTEEEEECSSSCEEEEETTHHHHCCEEECSSSSCEEEEECC
T ss_pred             hccccccccceeeHHHhccccCCcEEEEcCCCCCeEEecHHHhCCCCEEECCCCceEEEEEEc
Confidence            2111100         000112234556677776664   111   57899999998887775
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A Back     alignment and structure
>2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-12
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-12
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 9e-12
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 3e-11
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-11
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 4e-10
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 7e-10
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 1e-08
d1iqza_81 d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyt 5e-08
d1fxda_58 d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [T 9e-06
d1fxra_64 d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacte 2e-04
d1sj1a_66 d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus 0.001
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 59.3 bits (143), Expect = 1e-12
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 44  RASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYH--------PDIAGQKGHEHTLLLNE 95
             + KK++Y +LG    AN  ++K+ Y+KL   YH        P    ++  +  + +++
Sbjct: 11  EQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQ 70

Query: 96  AYKVLMRGDLRKDYDA 111
           A+K+L   + +K YD 
Sbjct: 71  AWKILGNEETKKKYDL 86
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Length = 81 Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Length = 58 Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Length = 64 Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Length = 66 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.89
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.85
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.82
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.76
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.75
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.64
d1fxra_64 Ferredoxin I {Sulfate-reducing bacteria (Desulfovi 97.72
d1iqza_81 Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 97.1
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 96.5
d1sj1a_66 Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI 96.09
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 95.84
d1ywsa182 Diphthamide biosynthesis protein 3, DPH3 {Baker's 87.76
d1wgea170 DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus 87.45
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.89  E-value=1e-23  Score=143.09  Aligned_cols=68  Identities=40%  Similarity=0.636  Sum_probs=62.1

Q ss_pred             ccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCC--ccHHHHHHHHHHHHHcCCchhhHHHHhhccc
Q 029849           48 KKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQ--KGHEHTLLLNEAYKVLMRGDLRKDYDASIGQ  115 (186)
Q Consensus        48 ~~d~Y~iLgv~~~as~~eIk~ayr~~~~~~HPDk~~~--~~~~~f~~i~~AY~vL~d~~~R~~YD~~~~~  115 (186)
                      .+|||+||||+++||.++||+|||++++++|||+++.  .+.+.|.+|++||+||+||.+|..||.++..
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~   71 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA   71 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence            4699999999999999999999999999999999874  3567899999999999999999999988543
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure