Citrus Sinensis ID: 029863


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MATVLECVAVPRASASSVFSSPAKLSSSSINSISGRRKFAEFKGLKVRPVRSFGSVSQGSSSSFRLRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHcccccEEccccHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHcccccccEEEEEEccEEEEEEEccccHHHHHHHHHHHc
cccHHHHEEccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccEEEEcHHHHHccEEcccccHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEEcccHHHHHHHHHHHc
MATVLECVAvprasassvfsspaklssssinsISGRRKFaefkglkvrpvrsfgsvsqgssssfrlRRGAQIVCEAQetavevpavtdatwqslvldsgspvlvefwapwcgpcrmihpIIDELSKQYvgklkcykvntdespsiatrygirsiptvmifkngekkdtvigavpkstlTTSIEKFL
MATVLEcvavprasassvfsspaklssssinsisgrrkfaefkglkvrpvrsfgsvsqgssssfrlRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCykvntdespsiatrygirsiptvmifkngekkdtvigavpkstlttsiekfl
MATVLECVAVPRasassvfsspaklssssinsisGRRKFAEFKGLKVRPvrsfgsvsqgssssfrLRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL
*****************************************************************LRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAV*************
**TVLECVAVP***********************************************************************VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL
MATVLECVAVPR******************NSISGRRKFAEFKGLKVRPVR***************RRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTL********
*****E**************************************************************GAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATVLECVAVPRASASSVFSSPAKLSSSSINSISGRRKFAEFKGLKVRPVRSFGSVSQGSSSSFRLRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
Q9SEU6193 Thioredoxin M4, chloropla yes no 0.973 0.937 0.556 7e-52
Q9XGS0177 Thioredoxin M-type, chlor N/A no 0.844 0.887 0.586 7e-50
O48737179 Thioredoxin M1, chloropla no no 0.865 0.899 0.562 3e-48
Q6H7E4173 Thioredoxin M1, chloropla yes no 0.741 0.797 0.579 2e-46
Q9SEU8186 Thioredoxin M2, chloropla no no 0.784 0.784 0.563 2e-45
P48384172 Thioredoxin M-type, chlor N/A no 0.747 0.808 0.581 4e-45
Q7X8R5180 Thioredoxin M2, chloropla no no 0.629 0.65 0.663 1e-44
P07591181 Thioredoxin M-type, chlor N/A no 0.758 0.779 0.589 7e-44
Q9ZP20172 Thioredoxin M5, chloropla no no 0.650 0.703 0.636 9e-42
Q9ZP21175 Thioredoxin M-type, chlor N/A no 0.645 0.685 0.608 7e-41
>sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=1 SV=2 Back     alignment and function desciption
 Score =  203 bits (516), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 109/196 (55%), Positives = 138/196 (70%), Gaps = 15/196 (7%)

Query: 1   MATVLECVAVPRASASSVFSSP--AKLSSSSINSISGRRK-----FAEFKGLKVRPVRSF 53
           MA++L+ V V R     VFS P  A +SSSS      RR+     F EF+GLK       
Sbjct: 1   MASLLDSVTVTR-----VFSLPIAASVSSSSAAPSVSRRRISPARFLEFRGLKSSRSLVT 55

Query: 54  GSVSQGSSSSFRLRRGAQIVCEAQET---AVEVPAVTDATWQSLVLDSGSPVLVEFWAPW 110
            S S G++   R+ RG +I CEAQ+T   AVEVP ++D+ WQ+ VL+S  PVLVEFWAPW
Sbjct: 56  QSASLGANRRTRIARGGRIACEAQDTTAAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPW 115

Query: 111 CGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVI 170
           CGPCRMIHPI+D+L+K + GK K YK+NTDESP+ A RYGIRS+PTV+IFK GEKKD++I
Sbjct: 116 CGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKDSII 175

Query: 171 GAVPKSTLTTSIEKFL 186
           GAVP+ TL  +IE+FL
Sbjct: 176 GAVPRETLEKTIERFL 191




Thiol-disulfide oxidoreductase involved in the redox regulation of enzyme of the oxidative pentose phosphate pathway. Under reducing conditions, inhibits the glucose-6-phosphate dehydrogenase.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9XGS0|TRXM_BRANA Thioredoxin M-type, chloroplastic OS=Brassica napus PE=1 SV=1 Back     alignment and function description
>sp|O48737|TRXM1_ARATH Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=1 SV=1 Back     alignment and function description
>sp|Q6H7E4|TRXM1_ORYSJ Thioredoxin M1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0639900 PE=2 SV=1 Back     alignment and function description
>sp|Q9SEU8|TRXM2_ARATH Thioredoxin M2, chloroplastic OS=Arabidopsis thaliana GN=At4g03520 PE=1 SV=2 Back     alignment and function description
>sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|Q7X8R5|TRXM2_ORYSJ Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 Back     alignment and function description
>sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 Back     alignment and function description
>sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 Back     alignment and function description
>sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
359493854188 PREDICTED: thioredoxin M4, chloroplastic 0.983 0.973 0.706 1e-65
154721452187 thioredoxin [Limonium bicolor] 0.940 0.935 0.646 2e-61
418731082182 putative thioredoxin m2 [Solanum tuberos 0.978 1.0 0.645 1e-58
356546877233 PREDICTED: thioredoxin M4, chloroplastic 0.946 0.755 0.630 2e-58
224114952190 thioredoxin m [Populus trichocarpa] gi|2 0.989 0.968 0.619 6e-58
255558409181 thioredoxin m(mitochondrial)-type, putat 0.973 1.0 0.629 1e-57
118488968190 unknown [Populus trichocarpa x Populus d 1.0 0.978 0.626 1e-57
388498220173 unknown [Medicago truncatula] 0.784 0.843 0.711 2e-56
351725393182 uncharacterized protein LOC100526924 [Gl 0.940 0.961 0.621 4e-56
329750617185 mitochondrial thioredoxin [Hevea brasili 0.973 0.978 0.642 5e-56
>gi|359493854|ref|XP_002282265.2| PREDICTED: thioredoxin M4, chloroplastic-like [Vitis vinifera] gi|302143024|emb|CBI20319.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/191 (70%), Positives = 156/191 (81%), Gaps = 8/191 (4%)

Query: 1   MATVLECVAVPRASA--SSVFSSPAKLSSSSINSISGRRKFA---EFKGLKVRPVRSFGS 55
           MATVL+ +AVPR+SA  SS F   A ++SS +  +SGRR  A   EF GLK++P  +  S
Sbjct: 1   MATVLDSLAVPRSSALPSSAF---APIASSPVCFLSGRRGLARLPEFSGLKIQPSLASRS 57

Query: 56  VSQGSSSSFRLRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCR 115
           V+    SS   RR   +VCEAQETAVEVPAV DATWQSLVLD+ +PVLVEFWAPWCGPCR
Sbjct: 58  VAAAGRSSRVGRRVGGVVCEAQETAVEVPAVIDATWQSLVLDADTPVLVEFWAPWCGPCR 117

Query: 116 MIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPK 175
           MIHP+I+EL+KQY GKLKCYKVNTDESPSIATRYGIRSIPTV+IFK+GEKK+ +IGAVPK
Sbjct: 118 MIHPVINELAKQYTGKLKCYKVNTDESPSIATRYGIRSIPTVIIFKSGEKKEAIIGAVPK 177

Query: 176 STLTTSIEKFL 186
           STLTTSIEKFL
Sbjct: 178 STLTTSIEKFL 188




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|154721452|gb|ABS84825.1| thioredoxin [Limonium bicolor] Back     alignment and taxonomy information
>gi|418731082|gb|AFX67008.1| putative thioredoxin m2 [Solanum tuberosum] Back     alignment and taxonomy information
>gi|356546877|ref|XP_003541848.1| PREDICTED: thioredoxin M4, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224114952|ref|XP_002316901.1| thioredoxin m [Populus trichocarpa] gi|222859966|gb|EEE97513.1| thioredoxin m [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558409|ref|XP_002520230.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] gi|223540576|gb|EEF42142.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118488968|gb|ABK96292.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|388498220|gb|AFK37176.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|351725393|ref|NP_001236067.1| uncharacterized protein LOC100526924 [Glycine max] gi|255631161|gb|ACU15946.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|329750617|gb|AEC03324.1| mitochondrial thioredoxin [Hevea brasiliensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
TAIR|locus:2090126193 TRX-M4 "thioredoxin M-type 4" 1.0 0.963 0.492 3.8e-46
TAIR|locus:2128756186 ATHM2 [Arabidopsis thaliana (t 0.801 0.801 0.535 1.1e-41
TAIR|locus:2020813179 THM1 "thioredoxin M-type 1" [A 0.639 0.664 0.644 1.4e-41
UNIPROTKB|Q9ZP20172 TRXM "Thioredoxin M5, chloropl 0.650 0.703 0.636 5.9e-41
UNIPROTKB|P07591181 P07591 "Thioredoxin M-type, ch 0.639 0.657 0.621 4.2e-40
UNIPROTKB|P52231107 trxA "Thioredoxin" [Synechocys 0.553 0.962 0.621 1.7e-34
TIGR_CMR|DET_0661107 DET_0661 "thioredoxin" [Dehalo 0.559 0.971 0.519 1.2e-26
TIGR_CMR|DET_0695107 DET_0695 "thioredoxin" [Dehalo 0.559 0.971 0.519 1.2e-26
TAIR|locus:2053573174 ATHM3 [Arabidopsis thaliana (t 0.543 0.580 0.485 3.2e-26
UNIPROTKB|P0AA25109 trxA "thioredoxin 1" [Escheric 0.5 0.853 0.494 7.8e-23
TAIR|locus:2090126 TRX-M4 "thioredoxin M-type 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 484 (175.4 bits), Expect = 3.8e-46, P = 3.8e-46
 Identities = 94/191 (49%), Positives = 120/191 (62%)

Query:     1 MATVLECVAVPRXXXX--XXXXXXXXXXXXXXXXXXGRRKFAEFKGLKVRPXXXXXXXXX 58
             MA++L+ V V R                           +F EF+GLK            
Sbjct:     1 MASLLDSVTVTRVFSLPIAASVSSSSAAPSVSRRRISPARFLEFRGLKSSRSLVTQSASL 60

Query:    59 XXXXXXXLRRGAQIVCEAQET---AVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCR 115
                    + RG +I CEAQ+T   AVEVP ++D+ WQ+ VL+S  PVLVEFWAPWCGPCR
Sbjct:    61 GANRRTRIARGGRIACEAQDTTAAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCR 120

Query:   116 MIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPK 175
             MIHPI+D+L+K + GK K YK+NTDESP+ A RYGIRS+PTV+IFK GEKKD++IGAVP+
Sbjct:   121 MIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKDSIIGAVPR 180

Query:   176 STLTTSIEKFL 186
              TL  +IE+FL
Sbjct:   181 ETLEKTIERFL 191




GO:0006662 "glycerol ether metabolic process" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IGI
GO:0008047 "enzyme activator activity" evidence=IDA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA;IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0004857 "enzyme inhibitor activity" evidence=IDA
GO:0006109 "regulation of carbohydrate metabolic process" evidence=IDA
GO:0043086 "negative regulation of catalytic activity" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
TAIR|locus:2128756 ATHM2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020813 THM1 "thioredoxin M-type 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ZP20 TRXM "Thioredoxin M5, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P07591 P07591 "Thioredoxin M-type, chloroplastic" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
UNIPROTKB|P52231 trxA "Thioredoxin" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0661 DET_0661 "thioredoxin" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0695 DET_0695 "thioredoxin" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TAIR|locus:2053573 ATHM3 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P0AA25 trxA "thioredoxin 1" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SEU6TRXM4_ARATHNo assigned EC number0.55610.97310.9378yesno
Q9XGS0TRXM_BRANANo assigned EC number0.58640.84400.8870N/Ano
Q6H7E4TRXM1_ORYSJNo assigned EC number0.57960.74190.7976yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
TIGR01068101 TIGR01068, thioredoxin, thioredoxin 6e-50
pfam00085104 pfam00085, Thioredoxin, Thioredoxin 2e-44
cd0294793 cd02947, TRX_family, TRX family; composed of two g 3e-41
PRK10996139 PRK10996, PRK10996, thioredoxin 2; Provisional 2e-33
PRK09381109 PRK09381, trxA, thioredoxin; Provisional 9e-32
COG3118 304 COG3118, COG3118, Thioredoxin domain-containing pr 1e-28
cd02961101 cd02961, PDI_a_family, Protein Disulfide Isomerase 3e-24
COG0526127 COG0526, TrxA, Thiol-disulfide isomerase and thior 6e-24
cd03001103 cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp 1e-20
PTZ0005198 PTZ00051, PTZ00051, thioredoxin; Provisional 2e-20
cd02998105 cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret 1e-19
TIGR01126102 TIGR01126, pdi_dom, protein disulfide-isomerase do 3e-19
cd0295696 cd02956, ybbN, ybbN protein family; ybbN is a hypo 9e-18
cd0298497 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-int 1e-17
cd03004104 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER 7e-17
cd0294997 cd02949, TRX_NTR, TRX domain, novel NADPH thioredo 4e-16
cd02966116 cd02966, TlpA_like_family, TlpA-like family; compo 7e-16
cd03000104 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; 2e-13
cd02995104 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal T 6e-13
cd03002109 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like su 3e-12
pfam13098105 pfam13098, Thioredoxin_2, Thioredoxin-like domain 6e-12
TIGR01130 462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 7e-12
cd03011123 cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, 2e-11
cd0165969 cd01659, TRX_superfamily, Thioredoxin (TRX) superf 3e-11
cd02989113 cd02989, Phd_like_TxnDC9, Phosducin (Phd)-like fam 5e-11
PTZ00102 477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 5e-11
cd02996108 cd02996, PDI_a_ERp44, PDIa family, endoplasmic ret 1e-10
TIGR01130462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 2e-10
cd02950142 cd02950, TxlA, TRX-like protein A (TxlA) family; T 2e-10
cd03005102 cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret 2e-10
PTZ00102477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 1e-09
PTZ00443224 PTZ00443, PTZ00443, Thioredoxin domain-containing 1e-09
pfam1390594 pfam13905, Thioredoxin_8, Thioredoxin-like 4e-09
cd02997104 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; 5e-09
TIGR00385173 TIGR00385, dsbE, periplasmic protein thiol:disulfi 7e-09
cd02994101 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; co 1e-08
cd02962152 cd02962, TMX2, TMX2 family; composed of proteins s 1e-08
cd03010127 cd03010, TlpA_like_DsbE, TlpA-like family, DsbE (a 9e-08
TIGR0041182 TIGR00411, redox_disulf_1, small redox-active disu 4e-07
cd02999100 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmi 5e-07
PHA0212575 PHA02125, PHA02125, thioredoxin-like protein 8e-07
cd02957113 cd02957, Phd_like, Phosducin (Phd)-like family; co 1e-06
PRK03147173 PRK03147, PRK03147, thiol-disulfide oxidoreductase 2e-06
PRK15412185 PRK15412, PRK15412, thiol:disulfide interchange pr 8e-06
cd02948102 cd02948, TRX_NDPK, TRX domain, TRX and NDP-kinase 1e-05
cd02953104 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma 2e-05
pfam1389981 pfam13899, Thioredoxin_7, Thioredoxin-like 3e-05
cd02985103 cd02985, TRX_CDSP32, TRX family, chloroplastic dro 4e-05
cd03003101 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ER 5e-05
cd02992114 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhyd 1e-04
pfam08534142 pfam08534, Redoxin, Redoxin 0.004
>gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin Back     alignment and domain information
 Score =  156 bits (396), Expect = 6e-50
 Identities = 56/101 (55%), Positives = 77/101 (76%)

Query: 86  VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSI 145
           +TDA +   +  S  PVLV+FWAPWCGPC+MI PI++EL+K+Y GK+K  K+N DE+P I
Sbjct: 1   LTDANFDETIASSDKPVLVDFWAPWCGPCKMIAPILEELAKEYEGKVKFVKLNVDENPDI 60

Query: 146 ATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL 186
           A +YGIRSIPT+++FKNG++ D  +GA+PK+ L   I K L
Sbjct: 61  AAKYGIRSIPTLLLFKNGKEVDRSVGALPKAALKQLINKNL 101


Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by This model. Any protein that hits once with a score greater than the second (per domain) trusted cutoff may be taken as thioredoxin [Energy metabolism, Electron transport]. Length = 101

>gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin Back     alignment and domain information
>gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>gnl|CDD|182889 PRK10996, PRK10996, thioredoxin 2; Provisional Back     alignment and domain information
>gnl|CDD|181812 PRK09381, trxA, thioredoxin; Provisional Back     alignment and domain information
>gnl|CDD|225660 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>gnl|CDD|173347 PTZ00051, PTZ00051, thioredoxin; Provisional Back     alignment and domain information
>gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain Back     alignment and domain information
>gnl|CDD|239254 cd02956, ybbN, ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>gnl|CDD|239282 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>gnl|CDD|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>gnl|CDD|239247 cd02949, TRX_NTR, TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>gnl|CDD|239264 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>gnl|CDD|239298 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>gnl|CDD|239293 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>gnl|CDD|239300 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>gnl|CDD|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain Back     alignment and domain information
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
>gnl|CDD|239309 cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>gnl|CDD|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>gnl|CDD|239287 cd02989, Phd_like_TxnDC9, Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|239294 cd02996, PDI_a_ERp44, PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
>gnl|CDD|239248 cd02950, TxlA, TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>gnl|CDD|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|222448 pfam13905, Thioredoxin_8, Thioredoxin-like Back     alignment and domain information
>gnl|CDD|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>gnl|CDD|129481 TIGR00385, dsbE, periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>gnl|CDD|239292 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>gnl|CDD|239260 cd02962, TMX2, TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>gnl|CDD|239308 cd03010, TlpA_like_DsbE, TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>gnl|CDD|129505 TIGR00411, redox_disulf_1, small redox-active disulfide protein 1 Back     alignment and domain information
>gnl|CDD|239297 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>gnl|CDD|133998 PHA02125, PHA02125, thioredoxin-like protein Back     alignment and domain information
>gnl|CDD|239255 cd02957, Phd_like, Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>gnl|CDD|179545 PRK03147, PRK03147, thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|185310 PRK15412, PRK15412, thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>gnl|CDD|239246 cd02948, TRX_NDPK, TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>gnl|CDD|239251 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>gnl|CDD|222442 pfam13899, Thioredoxin_7, Thioredoxin-like Back     alignment and domain information
>gnl|CDD|239283 cd02985, TRX_CDSP32, TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>gnl|CDD|239301 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>gnl|CDD|239290 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>gnl|CDD|219888 pfam08534, Redoxin, Redoxin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 99.97
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 99.93
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.93
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 99.92
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.92
PHA02278103 thioredoxin-like protein 99.92
PRK09381109 trxA thioredoxin; Provisional 99.92
COG3118 304 Thioredoxin domain-containing protein [Posttransla 99.92
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.91
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.91
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.91
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.91
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.9
PRK10996139 thioredoxin 2; Provisional 99.9
KOG0907106 consensus Thioredoxin [Posttranslational modificat 99.9
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 99.9
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 99.89
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.89
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.89
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 99.89
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.89
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 99.88
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 99.88
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.88
PTZ00443224 Thioredoxin domain-containing protein; Provisional 99.88
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 99.87
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 99.87
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 99.87
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 99.87
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.86
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.86
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 99.86
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 99.86
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.86
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 99.85
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 99.85
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 99.84
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.84
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 99.83
PTZ0005198 thioredoxin; Provisional 99.83
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 99.83
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 99.83
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.83
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 99.82
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 99.81
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.81
KOG0908 288 consensus Thioredoxin-like protein [Posttranslatio 99.8
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 99.78
cd0294793 TRX_family TRX family; composed of two groups: Gro 99.78
PTZ00102477 disulphide isomerase; Provisional 99.77
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 99.77
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 99.76
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 99.76
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.76
PLN02309457 5'-adenylylsulfate reductase 99.75
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 99.74
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 99.74
PTZ00102 477 disulphide isomerase; Provisional 99.74
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.72
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 99.72
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 99.71
PTZ00062 204 glutaredoxin; Provisional 99.71
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 99.68
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.68
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 99.68
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 99.67
TIGR02187 215 GlrX_arch Glutaredoxin-like domain protein. This f 99.66
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.66
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.66
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 99.65
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 99.64
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 99.63
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 99.63
PRK00293571 dipZ thiol:disulfide interchange protein precursor 99.63
cd02955124 SSP411 TRX domain, SSP411 protein family; members 99.62
PHA0212575 thioredoxin-like protein 99.62
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.61
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 99.61
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.6
TIGR02740271 TraF-like TraF-like protein. This protein is relat 99.6
KOG4277 468 consensus Uncharacterized conserved protein, conta 99.59
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 99.58
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.58
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.57
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.57
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.55
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.55
KOG0912 375 consensus Thiol-disulfide isomerase and thioredoxi 99.54
PTZ00056199 glutathione peroxidase; Provisional 99.54
PRK13728181 conjugal transfer protein TrbB; Provisional 99.53
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 99.52
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 99.51
cd02967114 mauD Methylamine utilization (mau) D family; mauD 99.51
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 99.5
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 99.5
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 99.5
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 99.49
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 99.49
cd02958114 UAS UAS family; UAS is a domain of unknown functio 99.49
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 99.46
PLN02412167 probable glutathione peroxidase 99.45
PRK10877232 protein disulfide isomerase II DsbC; Provisional 99.44
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 99.43
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 99.41
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 99.39
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 99.39
KOG1731 606 consensus FAD-dependent sulfhydryl oxidase/quiesci 99.35
PTZ00256183 glutathione peroxidase; Provisional 99.34
smart00594122 UAS UAS domain. 99.3
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 99.3
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 99.3
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 99.29
COG4232569 Thiol:disulfide interchange protein [Posttranslati 99.27
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 99.26
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 99.19
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 99.17
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.16
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 99.14
PRK10606183 btuE putative glutathione peroxidase; Provisional 99.13
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 99.13
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 99.12
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.1
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 99.09
COG2143182 Thioredoxin-related protein [Posttranslational mod 99.08
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 99.08
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 99.07
KOG0914265 consensus Thioredoxin-like protein [Posttranslatio 99.07
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 99.06
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 99.02
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 99.02
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 99.02
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 99.02
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 99.02
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 99.01
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 98.98
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 98.98
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 98.95
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 98.95
PF13728215 TraF: F plasmid transfer operon protein 98.9
PRK13190202 putative peroxiredoxin; Provisional 98.89
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 98.84
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 98.82
PRK15000200 peroxidase; Provisional 98.81
KOG1672211 consensus ATP binding protein [Posttranslational m 98.79
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.76
PRK13599215 putative peroxiredoxin; Provisional 98.76
KOG0913 248 consensus Thiol-disulfide isomerase and thioredoxi 98.73
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.72
KOG3414142 consensus Component of the U4/U6.U5 snRNP/mitosis 98.72
PTZ00137261 2-Cys peroxiredoxin; Provisional 98.7
PRK13189222 peroxiredoxin; Provisional 98.69
TIGR02739256 TraF type-F conjugative transfer system pilin asse 98.68
PF07449107 HyaE: Hydrogenase-1 expression protein HyaE; Inter 98.66
PRK13191215 putative peroxiredoxin; Provisional 98.65
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 98.65
PRK1120085 grxA glutaredoxin 1; Provisional 98.64
PRK13703248 conjugal pilus assembly protein TraF; Provisional 98.61
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 98.6
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 98.58
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 98.56
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.55
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 98.54
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 98.51
KOG0911 227 consensus Glutaredoxin-related protein [Posttransl 98.49
KOG3425128 consensus Uncharacterized conserved protein [Funct 98.45
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 98.43
PTZ00253199 tryparedoxin peroxidase; Provisional 98.43
PF01216 383 Calsequestrin: Calsequestrin; InterPro: IPR001393 98.38
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 98.36
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 98.36
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 98.36
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.35
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 98.35
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 98.34
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 98.3
PRK10954207 periplasmic protein disulfide isomerase I; Provisi 98.24
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 98.23
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 98.2
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 98.16
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 98.11
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 98.09
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.06
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 98.02
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 98.02
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 97.95
PRK1032981 glutaredoxin-like protein; Provisional 97.94
PHA03050108 glutaredoxin; Provisional 97.93
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 97.92
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 97.9
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 97.88
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 97.85
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 97.82
COG1331 667 Highly conserved protein containing a thioredoxin 97.82
PF13743176 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C. 97.82
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 97.76
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 97.7
KOG2603 331 consensus Oligosaccharyltransferase, gamma subunit 97.64
KOG3171273 consensus Conserved phosducin-like protein [Signal 97.6
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 97.58
PRK1063883 glutaredoxin 3; Provisional 97.52
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 97.5
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 97.49
COG0386162 BtuE Glutathione peroxidase [Posttranslational mod 97.46
PRK10824115 glutaredoxin-4; Provisional 97.41
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 97.29
PF01323193 DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 97.26
KOG3170240 consensus Conserved phosducin-like protein [Signal 97.25
COG1651244 DsbG Protein-disulfide isomerase [Posttranslationa 96.89
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 96.83
PTZ00062204 glutaredoxin; Provisional 96.82
PF13848 184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 96.82
KOG1752104 consensus Glutaredoxin and related proteins [Postt 96.79
COG2761225 FrnE Predicted dithiol-disulfide isomerase involve 96.78
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 96.3
cd0297494 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit 96.28
KOG2640 319 consensus Thioredoxin [Function unknown] 96.25
COG3019149 Predicted metal-binding protein [General function 96.11
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 95.91
KOG1651171 consensus Glutathione peroxidase [Posttranslationa 95.73
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 95.72
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 95.63
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved i 95.35
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 95.34
cd0297872 KaiB_like KaiB-like family; composed of the circad 95.31
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 95.29
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 95.27
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 95.16
COG3531212 Predicted protein-disulfide isomerase [Posttransla 95.03
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 95.03
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 94.67
TIGR0265487 circ_KaiB circadian clock protein KaiB. Members of 94.58
PRK09301103 circadian clock protein KaiB; Provisional 94.55
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 94.52
cd02990136 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1 94.39
KOG0855211 consensus Alkyl hydroperoxide reductase, thiol spe 93.94
COG454585 Glutaredoxin-related protein [Posttranslational mo 93.94
PF09673113 TrbC_Ftype: Type-F conjugative transfer system pil 93.82
TIGR02742130 TrbC_Ftype type-F conjugative transfer system pili 93.3
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 92.98
PF13778118 DUF4174: Domain of unknown function (DUF4174) 92.53
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 92.05
PF09822 271 ABC_transp_aux: ABC-type uncharacterized transport 91.92
cd03024201 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a D 91.66
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 91.62
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 91.49
KOG2507 506 consensus Ubiquitin regulatory protein UBXD2, cont 90.88
cd03025 193 DsbA_FrnE_like DsbA family, FrnE-like subfamily; c 90.81
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 90.54
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 90.32
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 90.12
PF00255108 GSHPx: Glutathione peroxidase; InterPro: IPR000889 89.75
PRK01655131 spxA transcriptional regulator Spx; Reviewed 89.66
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 89.45
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 89.36
cd03074120 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase 89.26
PHA03075123 glutaredoxin-like protein; Provisional 89.1
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 88.4
KOG2792280 consensus Putative cytochrome C oxidase assembly p 87.73
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 87.71
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 87.54
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 86.95
cd03022192 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-car 86.38
PF06053 249 DUF929: Domain of unknown function (DUF929); Inter 86.07
PF0768982 KaiB: KaiB domain; InterPro: IPR011649 The cyanoba 85.88
PF04134114 DUF393: Protein of unknown function, DUF393; Inter 85.77
KOG2244 786 consensus Highly conserved protein containing a th 84.76
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 84.58
PRK00366360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 83.19
KOG0852196 consensus Alkyl hydroperoxide reductase, thiol spe 82.8
PRK12559131 transcriptional regulator Spx; Provisional 82.39
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.97  E-value=1.7e-30  Score=189.46  Aligned_cols=106  Identities=50%  Similarity=0.956  Sum_probs=101.4

Q ss_pred             ccccccChhHHHHHHHhCCCcEEEEEECCCCcccccchHHHHHHHHHhcCceEEEEEeCCCChHHHHHcCCCcccEEEEE
Q 029863           81 VEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIF  160 (186)
Q Consensus        81 ~~v~~l~~~~~~~~~~~~~k~vvv~F~a~wC~~C~~~~p~l~~l~~~~~~~v~~~~v~~d~~~~l~~~~~i~~~Pt~i~~  160 (186)
                      .....++..+|++.+.+++.||+|+|||+||+||+++.|.++++..+|.++++++++|+|++.+++.+|+|..+||+++|
T Consensus        43 ~~~~~~s~~~~~~~Vi~S~~PVlVdF~A~WCgPCk~l~P~l~~~~~~~~g~~k~~kvdtD~~~ela~~Y~I~avPtvlvf  122 (150)
T KOG0910|consen   43 TLFNVQSDSEFDDKVINSDVPVLVDFHAEWCGPCKMLGPILEELVSEYAGKFKLYKVDTDEHPELAEDYEISAVPTVLVF  122 (150)
T ss_pred             ccccccCHHHHHHHHHccCCCEEEEEecCcCccHhHhhHHHHHHHHhhcCeEEEEEEccccccchHhhcceeeeeEEEEE
Confidence            44566789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCeEEEEEeCCCCHHHHHHHHHhhC
Q 029863          161 KNGEKKDTVIGAVPKSTLTTSIEKFL  186 (186)
Q Consensus       161 ~~G~~~~~~~G~~~~~~l~~~l~~~l  186 (186)
                      +||+++.++.|..+.+.|.++|+++|
T Consensus       123 knGe~~d~~vG~~~~~~l~~~i~k~l  148 (150)
T KOG0910|consen  123 KNGEKVDRFVGAVPKEQLRSLIKKFL  148 (150)
T ss_pred             ECCEEeeeecccCCHHHHHHHHHHHh
Confidence            99999999999999999999999875



>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG3414 consensus Component of the U4/U6 Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13743 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] Back     alignment and domain information
>KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>KOG2640 consensus Thioredoxin [Function unknown] Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>KOG1651 consensus Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>COG3531 Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>TIGR02654 circ_KaiB circadian clock protein KaiB Back     alignment and domain information
>PRK09301 circadian clock protein KaiB; Provisional Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain Back     alignment and domain information
>KOG0855 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09673 TrbC_Ftype: Type-F conjugative transfer system pilin assembly protein; InterPro: IPR019106 This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system (aka type 4 secretion system) for the transfer of plasmid DNA [, ] Back     alignment and domain information
>TIGR02742 TrbC_Ftype type-F conjugative transfer system pilin assembly protein TrbC Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PF13778 DUF4174: Domain of unknown function (DUF4174) Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>PF09822 ABC_transp_aux: ABC-type uncharacterized transport system; InterPro: IPR019196 This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins Back     alignment and domain information
>cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1 Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PHA03075 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway Back     alignment and domain information
>PF06053 DUF929: Domain of unknown function (DUF929); InterPro: IPR009272 This is a family of proteins from the archaeon Sulfolobus, with undetermined function Back     alignment and domain information
>PF07689 KaiB: KaiB domain; InterPro: IPR011649 The cyanobacterial clock proteins KaiA and KaiB are proposed as regulators of the circadian rhythm in cyanobacteria Back     alignment and domain information
>PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG Back     alignment and domain information
>KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only] Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>KOG0852 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
1fb0_A105 Crystal Structure Of Thioredoxin M From Spinach Chl 6e-40
1gl8_A104 Solution Structure Of Thioredoxin M From Spinach, O 3e-39
2puk_C106 Crystal Srtucture Of The Binary Complex Between Fer 4e-39
1dby_A107 Nmr Structures Of Chloroplast Thioredoxin M Ch2 Fro 1e-36
2yj7_A106 Crystal Structure Of A Hyperstable Protein From The 1e-28
2fch_A108 Crystal Structure Of Thioredoxin Mutant G74s Length 2e-25
3dxb_A 222 Structure Of The Uhm Domain Of Puf60 Fused To Thior 2e-25
1zzy_A108 Crystal Structure Of Thioredoxin Mutant L7v Length 3e-25
2h75_A108 Crystal Structure Of Thioredoxin Mutant D13e In Hex 4e-25
2h71_A108 Crystal Structure Of Thioredoxin Mutant D47e In Hex 5e-25
2h76_A108 Crystal Structure Of Thioredoxin Mutant D10e In Hex 5e-25
2h74_A108 Crystal Structure Of Thioredoxin Mutant D2e In Hexa 6e-25
2trx_A108 Crystal Structure Of Thioredoxin From Escherichia C 6e-25
1xob_A108 Thioredoxin (Reduced Dithio Form), Nmr, 20 Structur 6e-25
2eio_A108 Design Of Disulfide-Linked Thioredoxin Dimers And M 8e-25
2h6y_A108 Crystal Structure Of Thioredoxin Mutant E48d In Hex 9e-25
2tir_A108 Crystal Structure Analysis Of A Mutant Escherichia 1e-24
2h6z_A108 Crystal Structure Of Thioredoxin Mutant E44d In Hex 1e-24
2h72_A108 Crystal Structure Of Thioredoxin Mutant E85d In Hex 1e-24
2eir_A108 Design Of Disulfide-Linked Thioredoxin Dimers And M 1e-24
3dyr_A111 Crystal Structure Of E. Coli Thioredoxin Mutant I76 2e-24
2h70_A108 Crystal Structure Of Thioredoxin Mutant D9e In Hexa 2e-24
2h73_A108 Crystal Structure Of Thioredoxin Mutant D43e In Hex 2e-24
2eiq_A108 Design Of Disulfide-linked Thioredoxin Dimers And M 3e-24
2o8v_B128 Paps Reductase In A Covalent Complex With Thioredox 5e-24
2fd3_A108 Crystal Structure Of Thioredoxin Mutant P34h Length 5e-24
1f6m_C108 Crystal Structure Of A Complex Between Thioredoxin 6e-24
1keb_A108 Crystal Structure Of Double Mutant M37l,P40s E.Coli 1e-23
1t00_A112 The Structure Of Thioredoxin From S. Coelicolor Len 1e-23
1tho_A109 Crystal Structure Of A Mutant Escherichia Coli Thio 1e-23
1v98_A140 Crystal Structure Analysis Of Thioredoxin From Ther 4e-23
1txx_A108 Active-Site Variant Of E.Coli Thioredoxin Length = 2e-22
2o7k_A107 S. Aureus Thioredoxin Length = 107 2e-22
2i4a_A107 Crystal Structure Of Thioredoxin From The Acidophil 3e-22
1srx_A108 Three-Dimensional Structure Of Escherichia Coli Thi 4e-22
1zcp_A108 Crystal Structure Of A Catalytic Site Mutant E. Col 4e-22
1oaz_A123 Ige Fv Spe7 Complexed With A Recombinant Thioredoxi 5e-22
2cvk_A110 Crystal Structure Of Thermus Thermophilus Thioredox 5e-22
2yzu_A109 Crystal Structure Of Oxidized Thioredoxin From Ther 5e-22
1rqm_A105 Solution Structure Of The K18gR82E ALICYCLOBACILLUS 6e-22
2o87_A106 S. Aureus Thioredoxin P31s Mutant Length = 106 2e-21
2o85_A107 S. Aureus Thioredoxin P31t Mutant Length = 107 2e-21
1nw2_A105 The Crystal Structure Of The Mutant R82e Of Thiored 2e-21
1nsw_A105 The Crystal Structure Of The K18g Mutant Of The Thi 3e-21
3die_A106 Domain Swapping Of Staphylococcus Aureus Thioredoxi 3e-21
2gzy_A104 Solution Structures Of The Reduced Form Of Thioredo 5e-21
1quw_A105 Solution Structure Of The Thioredoxin From Bacillus 1e-20
3p2a_A148 Crystal Structure Of Thioredoxin 2 From Yersinia Pe 1e-20
2o89_A107 S. Aureus Thioredoxin P31tC32S MUTANT Length = 107 2e-20
2ipa_A104 Solution Structure Of Trx-Arsc Complex Length = 104 5e-20
2e0q_A104 Crystal Structure Of K53e Thioredoxin From Sulfolob 8e-20
2l5l_A136 Solution Structure Of Thioredoxin From Bacteroides 1e-19
3hhv_A110 The Crystal Structure Of The Thioredoxin A2 From Su 1e-19
2voc_A112 Thioredoxin A Active Site Mutants Form Mixed Disulf 2e-19
2l4q_A116 Solution Structures Of Oxidized And Reduced Thiored 2e-19
2i1u_A121 Mycobacterium Tuberculosis Thioredoxin C Length = 1 4e-19
3hxs_A141 Crystal Structure Of Bacteroides Fragilis Trxp Leng 1e-18
3nof_A118 Mycobacterium Tuberculosis Thioredoxin C C40s Mutan 3e-18
2j23_A121 Cross-Reactivity And Crystal Structure Of Malassezi 3e-18
3hyp_A141 Crystal Structure Of Bacteroides Fragilis Trxp_s105 3e-18
3tco_A109 Crystallographic And Spectroscopic Characterization 7e-18
1thx_A115 Thioredoxin-2 Length = 115 8e-16
1m7t_A107 Solution Structure And Dynamics Of The Human-Escher 9e-16
1xwa_A111 Drospohila Thioredoxin, Oxidized, P41212 Length = 1 7e-15
1xw9_A106 Drospohila Thioredoxin, Oxidized, P21 Length = 106 1e-14
2ppt_A155 Crystal Structure Of Thioredoxin-2 Length = 155 1e-14
2i9h_A103 Nmr Solution Structure Of The Reduced Form Of Thior 1e-14
3f3q_A109 Crystal Structure Of The Oxidised Form Of Thioredox 1e-14
2vm1_A118 Crystal Structure Of Barley Thioredoxin H Isoform 1 4e-14
1uvz_A119 Structure Of Human Thioredoxin 2 Length = 119 4e-14
3f3r_A109 Crystal Structure Of Yeast Thioredoxin1-Glutathione 1e-13
1syr_A112 Initial Structural Analysis Of Plasmodium Falciparu 1e-13
1wmj_A130 Solution Structure Of Thioredoxin Type H From Oryza 2e-13
1xfl_A124 Solution Structure Of Thioredoxin H1 From Arabidops 3e-13
2hsy_A104 Solution Structure Of Thioredoxin 2 From Saccharomy 3e-13
2fa4_A111 Crystal Structure Of Oxidized Form From Saccharomyc 3e-13
1x5d_A133 The Solution Structure Of The Second Thioredoxin-Li 9e-13
3qdn_A 287 Putative Thioredoxin Protein From Salmonella Typhim 1e-12
2vlt_A122 Crystal Structure Of Barley Thioredoxin H Isoform 2 3e-12
3pin_A104 Crystal Structure Of Mxr1 From Saccharomyces Cerevi 4e-12
4dss_B112 Crystal Structure Of Peroxiredoxin Ahp1 From Saccha 4e-12
3zzx_A105 Crystallographic Structure Of Thioredoxin From Lito 5e-12
3qou_A 287 Crystal Structure Of E. Coli Ybbn Length = 287 5e-12
1ep7_A112 Crystal Structure Of Wt Thioredoxin H From Chlamydo 6e-12
2xbi_A108 Crystal Structure Of Schistosoma Mansoni Thioredoxi 6e-12
2xbq_A117 Crystal Structure Of Reduced Schistosoma Mansoni Th 7e-12
1ep8_A112 Crystal Structure Of A Mutated Thioredoxin, D30a, F 1e-11
2iwt_A125 Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfide Compl 4e-11
2alb_A113 Nmr Structure Of The N-Terminal Domain A Of The Gly 7e-11
2vim_A104 X-Ray Structure Of Fasciola Hepatica Thioredoxin Le 9e-11
3gnj_A111 The Crystal Structure Of A Thioredoxin-Related Prot 2e-10
2dj3_A133 The Solution Structure Of The Third Thioredoxin Dom 2e-10
3m9j_A105 Crystal Structure Of Human Thioredoxin C6973S DOUBL 4e-10
3hz4_A140 Crystal Structure Of Thioredoxin From Methanosarcin 5e-10
2oe0_A114 Crystal Structure Of Mitochondrial Thioredoxin 3 Fr 6e-10
2hsh_A105 Crystal Structure Of C73s Mutant Of Human Thioredox 6e-10
1trs_A105 The High-Resolution Three-Dimensional Solution Stru 7e-10
1ti3_A113 Solution Structure Of The Thioredoxin H1 From Popla 8e-10
3kd0_A105 Human Thioredoxin C35s,C62s,C69s,C73s Mutant Showin 8e-10
2wz9_A153 Crystal Structure Of The Thioredoxin Domain Of Huma 1e-09
3f8u_A 481 TapasinERP57 HETERODIMER Length = 481 1e-09
1mek_A120 Human Protein Disulfide Isomerase, Nmr, 40 Structur 2e-09
2ifq_A105 Crystal Structure Of S-Nitroso Thioredoxin Length = 2e-09
2diy_A130 The Solution Structure Of The Thioredoxin Domain Of 2e-09
2ifq_B105 Crystal Structure Of S-Nitroso Thioredoxin Length = 3e-09
3trx_A105 High-Resolution Three-Dimensional Structure Of Redu 5e-09
3aps_A122 Crystal Structure Of Trx4 Domain Of Erdj5 Length = 5e-09
1mdi_A105 High Resolution Solution Nmr Structure Of Mixed Dis 6e-09
3vfi_A104 Crystal Structure Of A Metagenomic Thioredoxin Leng 7e-09
3qfa_C116 Crystal Structure Of The Human Thioredoxin Reductas 8e-09
1aiu_A105 Human Thioredoxin (D60n Mutant, Reduced Form) Lengt 9e-09
2dml_A130 The Solution Structure Of The First Thioredoxin Dom 3e-08
3d21_A139 Crystal Structure Of A Poplar Wild-Type Thioredoxin 3e-08
3e3e_A105 Human Thioredoxin Double Mutant C35s,C73r Length = 3e-08
2diz_A117 The Solution Structure Of The Third Thioredoxin Dom 4e-08
3uj1_A110 Crystal Structure Of The Third Thioredoxin Domain O 5e-08
3uvt_A111 Crystal Structure Of The Third Catalytic Domain Of 5e-08
3ul3_B128 Structural Insights Into Thioredoxin-2: A Component 6e-08
3d22_A139 Crystal Structure Of A Poplar Thioredoxin H Mutant, 1e-07
3idv_A 241 Crystal Structure Of The A0a Fragment Of Erp72 Leng 1e-07
1f9m_A112 Crystal Structure Of Thioredoxin F From Spinach Chl 2e-07
1faa_A124 Crystal Structure Of Thioredoxin F From Spinach Chl 2e-07
3uem_A361 Crystal Structure Of Human Pdi Bb'a' Domains Length 3e-07
2dj2_A120 The Solution Structure Of The Second Thioredoxin Do 3e-07
1x5c_A121 The Solution Structure Of The Second Thioredoxin-Li 4e-07
3apo_A780 Crystal Structure Of Full-Length Erdj5 Length = 780 4e-07
1erw_A105 Human Thioredoxin Double Mutant With Cys 32 Replace 6e-07
3ed3_A 298 Crystal Structure Of The Yeast DithiolDISULFIDE Oxi 6e-07
2r2j_A 382 Crystal Structure Of Human Erp44 Length = 382 9e-07
2f51_A118 Structure Of Trichomonas Vaginalis Thioredoxin Leng 9e-07
2hxk_A105 Crystal Structure Of S-Nitroso Thioredoxin Length = 9e-07
2dj1_A140 The Solution Structure Of The First Thioredoxin Dom 2e-06
2pu9_C111 Crystal Srtucture Of The Binary Complex Between Fer 3e-06
1x5e_A126 The Solution Structure Of The Thioredoxin-Like Doma 6e-06
2djj_A121 Solution Structure Of The A' Domain Of Thermophilic 6e-06
2b5e_A504 Crystal Structure Of Yeast Protein Disulfide Isomer 2e-05
2dmm_A142 The Solution Structure Of The Second Thioredoxin Do 3e-05
3gl3_A152 Crystal Structure Of A Putative Thiol:disulfide Int 5e-05
1r26_A125 Crystal Structure Of Thioredoxin From Trypanosoma B 6e-05
1fo5_A85 Solution Structure Of Reduced Mj0307 Length = 85 7e-05
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-04
2lja_A152 Solution Structure Of A Putative Thiol-Disulfide Ox 2e-04
2g0f_A168 Crystal Structure Of P144a Mutant Of E.Coli Ccmg Pr 4e-04
3k8n_A185 Crystal Structure Of E. Coli Ccmg Length = 185 4e-04
2b1l_A129 Crystal Structure Of N-Terminal 57 Residue Deletion 4e-04
2b1k_A168 Crystal Structure Of E. Coli Ccmg Protein Length = 5e-04
1a8l_A226 Protein Disulfide Oxidoreductase From Archaeon Pyro 8e-04
2dj0_A137 The Solution Structure Of The Thioredoxin Domain Of 8e-04
>pdb|1FB0|A Chain A, Crystal Structure Of Thioredoxin M From Spinach Chloroplast (Reduced Form) Length = 105 Back     alignment and structure

Iteration: 1

Score = 160 bits (404), Expect = 6e-40, Method: Compositional matrix adjust. Identities = 69/105 (65%), Positives = 90/105 (85%) Query: 82 EVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDE 141 EV V D++W+ VL+S PV+V+FWAPWCGPC++I P+IDEL+K+Y GK+ YK+NTDE Sbjct: 1 EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDE 60 Query: 142 SPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL 186 +P IAT+Y IRSIPTV+ FKNGE+K+++IGAVPKSTLT SIEK+L Sbjct: 61 APGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 105
>pdb|1GL8|A Chain A, Solution Structure Of Thioredoxin M From Spinach, Oxidized Form Length = 104 Back     alignment and structure
>pdb|2PUK|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin: Thioredoxin Reductase And Thioredoxin M Length = 106 Back     alignment and structure
>pdb|1DBY|A Chain A, Nmr Structures Of Chloroplast Thioredoxin M Ch2 From The Green Alga Chlamydomonas Reinhardtii Length = 107 Back     alignment and structure
>pdb|2YJ7|A Chain A, Crystal Structure Of A Hyperstable Protein From The Precambrian Period Length = 106 Back     alignment and structure
>pdb|2FCH|A Chain A, Crystal Structure Of Thioredoxin Mutant G74s Length = 108 Back     alignment and structure
>pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 Back     alignment and structure
>pdb|1ZZY|A Chain A, Crystal Structure Of Thioredoxin Mutant L7v Length = 108 Back     alignment and structure
>pdb|2H75|A Chain A, Crystal Structure Of Thioredoxin Mutant D13e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H71|A Chain A, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H76|A Chain A, Crystal Structure Of Thioredoxin Mutant D10e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H74|A Chain A, Crystal Structure Of Thioredoxin Mutant D2e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2TRX|A Chain A, Crystal Structure Of Thioredoxin From Escherichia Coli At 1.68 Angstroms Resolution Length = 108 Back     alignment and structure
>pdb|1XOB|A Chain A, Thioredoxin (Reduced Dithio Form), Nmr, 20 Structures Length = 108 Back     alignment and structure
>pdb|2EIO|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 Back     alignment and structure
>pdb|2H6Y|A Chain A, Crystal Structure Of Thioredoxin Mutant E48d In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2TIR|A Chain A, Crystal Structure Analysis Of A Mutant Escherichia Coli Thioredoxin In Which Lysine 36 Is Replaced By Glutamic Acid Length = 108 Back     alignment and structure
>pdb|2H6Z|A Chain A, Crystal Structure Of Thioredoxin Mutant E44d In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H72|A Chain A, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2EIR|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 Back     alignment and structure
>pdb|3DYR|A Chain A, Crystal Structure Of E. Coli Thioredoxin Mutant I76t In Its Oxidized Form Length = 111 Back     alignment and structure
>pdb|2H70|A Chain A, Crystal Structure Of Thioredoxin Mutant D9e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H73|A Chain A, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2EIQ|A Chain A, Design Of Disulfide-linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 Back     alignment and structure
>pdb|2O8V|B Chain B, Paps Reductase In A Covalent Complex With Thioredoxin C35a Length = 128 Back     alignment and structure
>pdb|2FD3|A Chain A, Crystal Structure Of Thioredoxin Mutant P34h Length = 108 Back     alignment and structure
>pdb|1F6M|C Chain C, Crystal Structure Of A Complex Between Thioredoxin Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+ Length = 108 Back     alignment and structure
>pdb|1KEB|A Chain A, Crystal Structure Of Double Mutant M37l,P40s E.Coli Thioredoxin Length = 108 Back     alignment and structure
>pdb|1T00|A Chain A, The Structure Of Thioredoxin From S. Coelicolor Length = 112 Back     alignment and structure
>pdb|1THO|A Chain A, Crystal Structure Of A Mutant Escherichia Coli Thioredoxin With An Arginine Insertion In The Active Site Length = 109 Back     alignment and structure
>pdb|1V98|A Chain A, Crystal Structure Analysis Of Thioredoxin From Thermus Thermophilus Length = 140 Back     alignment and structure
>pdb|1TXX|A Chain A, Active-Site Variant Of E.Coli Thioredoxin Length = 108 Back     alignment and structure
>pdb|2O7K|A Chain A, S. Aureus Thioredoxin Length = 107 Back     alignment and structure
>pdb|2I4A|A Chain A, Crystal Structure Of Thioredoxin From The Acidophile Acetobacter Aceti Length = 107 Back     alignment and structure
>pdb|1SRX|A Chain A, Three-Dimensional Structure Of Escherichia Coli Thioredoxin-S2 To 2.8 Angstroms Resolution Length = 108 Back     alignment and structure
>pdb|1ZCP|A Chain A, Crystal Structure Of A Catalytic Site Mutant E. Coli Trxa (Caca) Length = 108 Back     alignment and structure
>pdb|1OAZ|A Chain A, Ige Fv Spe7 Complexed With A Recombinant Thioredoxin Length = 123 Back     alignment and structure
>pdb|2CVK|A Chain A, Crystal Structure Of Thermus Thermophilus Thioredoxin Length = 110 Back     alignment and structure
>pdb|2YZU|A Chain A, Crystal Structure Of Oxidized Thioredoxin From Thermus Thermophilus Hb8 Length = 109 Back     alignment and structure
>pdb|1RQM|A Chain A, Solution Structure Of The K18gR82E ALICYCLOBACILLUS Acidocaldarius Thioredoxin Mutant Length = 105 Back     alignment and structure
>pdb|2O87|A Chain A, S. Aureus Thioredoxin P31s Mutant Length = 106 Back     alignment and structure
>pdb|2O85|A Chain A, S. Aureus Thioredoxin P31t Mutant Length = 107 Back     alignment and structure
>pdb|1NW2|A Chain A, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 Back     alignment and structure
>pdb|1NSW|A Chain A, The Crystal Structure Of The K18g Mutant Of The Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 Back     alignment and structure
>pdb|3DIE|A Chain A, Domain Swapping Of Staphylococcus Aureus Thioredoxin W28a Mutant Length = 106 Back     alignment and structure
>pdb|2GZY|A Chain A, Solution Structures Of The Reduced Form Of Thioredoxin From Bacillus Subtilis Length = 104 Back     alignment and structure
>pdb|1QUW|A Chain A, Solution Structure Of The Thioredoxin From Bacillus Acidocaldarius Length = 105 Back     alignment and structure
>pdb|3P2A|A Chain A, Crystal Structure Of Thioredoxin 2 From Yersinia Pestis Length = 148 Back     alignment and structure
>pdb|2O89|A Chain A, S. Aureus Thioredoxin P31tC32S MUTANT Length = 107 Back     alignment and structure
>pdb|2IPA|A Chain A, Solution Structure Of Trx-Arsc Complex Length = 104 Back     alignment and structure
>pdb|2E0Q|A Chain A, Crystal Structure Of K53e Thioredoxin From Sulfolobus Tokodaii Strain7 Length = 104 Back     alignment and structure
>pdb|2L5L|A Chain A, Solution Structure Of Thioredoxin From Bacteroides Vulgatus Length = 136 Back     alignment and structure
>pdb|3HHV|A Chain A, The Crystal Structure Of The Thioredoxin A2 From Sulfolobus Solfataricus Length = 110 Back     alignment and structure
>pdb|2VOC|A Chain A, Thioredoxin A Active Site Mutants Form Mixed Disulfide Dimers That Resemble Enzyme-substrate Reaction Intermediate Length = 112 Back     alignment and structure
>pdb|2L4Q|A Chain A, Solution Structures Of Oxidized And Reduced Thioredoxin C From M. Tb Length = 116 Back     alignment and structure
>pdb|2I1U|A Chain A, Mycobacterium Tuberculosis Thioredoxin C Length = 121 Back     alignment and structure
>pdb|3HXS|A Chain A, Crystal Structure Of Bacteroides Fragilis Trxp Length = 141 Back     alignment and structure
>pdb|3NOF|A Chain A, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant Length = 118 Back     alignment and structure
>pdb|2J23|A Chain A, Cross-Reactivity And Crystal Structure Of Malassezia Sympodialis Thioredoxin (Mala S 13), A Member Of A New Pan- Allergen Family Length = 121 Back     alignment and structure
>pdb|3HYP|A Chain A, Crystal Structure Of Bacteroides Fragilis Trxp_s105g Mutant Length = 141 Back     alignment and structure
>pdb|3TCO|A Chain A, Crystallographic And Spectroscopic Characterization Of Sulfolobus Solfataricus Trxa1 Provide Insights Into The Determinants Of Thioredoxin Fold Stability Length = 109 Back     alignment and structure
>pdb|1THX|A Chain A, Thioredoxin-2 Length = 115 Back     alignment and structure
>pdb|1M7T|A Chain A, Solution Structure And Dynamics Of The Human-Escherichia Coli Thioredoxin Chimera: Insights Into Thermodynamic Stability Length = 107 Back     alignment and structure
>pdb|1XWA|A Chain A, Drospohila Thioredoxin, Oxidized, P41212 Length = 111 Back     alignment and structure
>pdb|1XW9|A Chain A, Drospohila Thioredoxin, Oxidized, P21 Length = 106 Back     alignment and structure
>pdb|2PPT|A Chain A, Crystal Structure Of Thioredoxin-2 Length = 155 Back     alignment and structure
>pdb|2I9H|A Chain A, Nmr Solution Structure Of The Reduced Form Of Thioredoxin 1 From Yeast (Trx1) Length = 103 Back     alignment and structure
>pdb|3F3Q|A Chain A, Crystal Structure Of The Oxidised Form Of Thioredoxin 1 From Saccharomyces Cerevisiae Length = 109 Back     alignment and structure
>pdb|2VM1|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 1 Crystallized Using Ammonium Sulfate As Precipitant Length = 118 Back     alignment and structure
>pdb|1UVZ|A Chain A, Structure Of Human Thioredoxin 2 Length = 119 Back     alignment and structure
>pdb|3F3R|A Chain A, Crystal Structure Of Yeast Thioredoxin1-Glutathione Mixed Disulfide Complex Length = 109 Back     alignment and structure
>pdb|1SYR|A Chain A, Initial Structural Analysis Of Plasmodium Falciparum Thioredoxin Length = 112 Back     alignment and structure
>pdb|1WMJ|A Chain A, Solution Structure Of Thioredoxin Type H From Oryza Sativa Length = 130 Back     alignment and structure
>pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Arabidopsis Thaliana Length = 124 Back     alignment and structure
>pdb|2HSY|A Chain A, Solution Structure Of Thioredoxin 2 From Saccharomyces Cerevisiae Length = 104 Back     alignment and structure
>pdb|2FA4|A Chain A, Crystal Structure Of Oxidized Form From Saccharomyces Cerevisiae Length = 111 Back     alignment and structure
>pdb|1X5D|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase A6 Length = 133 Back     alignment and structure
>pdb|3QDN|A Chain A, Putative Thioredoxin Protein From Salmonella Typhimurium Length = 287 Back     alignment and structure
>pdb|2VLT|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 2 In The Oxidized State Length = 122 Back     alignment and structure
>pdb|3PIN|A Chain A, Crystal Structure Of Mxr1 From Saccharomyces Cerevisiae In Complex With Trx2 Length = 104 Back     alignment and structure
>pdb|4DSS|B Chain B, Crystal Structure Of Peroxiredoxin Ahp1 From Saccharomyces Cerevisiae In Complex With Thioredoxin Trx2 Length = 112 Back     alignment and structure
>pdb|3ZZX|A Chain A, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei Length = 105 Back     alignment and structure
>pdb|3QOU|A Chain A, Crystal Structure Of E. Coli Ybbn Length = 287 Back     alignment and structure
>pdb|1EP7|A Chain A, Crystal Structure Of Wt Thioredoxin H From Chlamydomonas Reinhardtii Length = 112 Back     alignment and structure
>pdb|2XBI|A Chain A, Crystal Structure Of Schistosoma Mansoni Thioredoxin At 1.6 Angstrom Length = 108 Back     alignment and structure
>pdb|2XBQ|A Chain A, Crystal Structure Of Reduced Schistosoma Mansoni Thioredoxin Pre-Protein At 1.7 Angstrom Length = 117 Back     alignment and structure
>pdb|1EP8|A Chain A, Crystal Structure Of A Mutated Thioredoxin, D30a, From Chlamydomonas Reinhardtii Length = 112 Back     alignment and structure
>pdb|2IWT|A Chain A, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfide Complex With The Target Protein Basi Length = 125 Back     alignment and structure
>pdb|2ALB|A Chain A, Nmr Structure Of The N-Terminal Domain A Of The Glycoprotein Chaperone Erp57 Length = 113 Back     alignment and structure
>pdb|2VIM|A Chain A, X-Ray Structure Of Fasciola Hepatica Thioredoxin Length = 104 Back     alignment and structure
>pdb|3GNJ|A Chain A, The Crystal Structure Of A Thioredoxin-Related Protein From Desulfitobacterium Hafniense Dcb Length = 111 Back     alignment and structure
>pdb|2DJ3|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 133 Back     alignment and structure
>pdb|3M9J|A Chain A, Crystal Structure Of Human Thioredoxin C6973S DOUBLE MUTANT, REDUCED Form Length = 105 Back     alignment and structure
>pdb|3HZ4|A Chain A, Crystal Structure Of Thioredoxin From Methanosarcina Mazei Length = 140 Back     alignment and structure
>pdb|2OE0|A Chain A, Crystal Structure Of Mitochondrial Thioredoxin 3 From Saccharomyces Cerevisiae Length = 114 Back     alignment and structure
>pdb|2HSH|A Chain A, Crystal Structure Of C73s Mutant Of Human Thioredoxin-1 Oxidized With H2o2 Length = 105 Back     alignment and structure
>pdb|1TRS|A Chain A, The High-Resolution Three-Dimensional Solution Structures Of The Oxidized And Reduced States Of Human Thioredoxin Length = 105 Back     alignment and structure
>pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 From Poplar, A Cppc Active Site Variant Length = 113 Back     alignment and structure
>pdb|3KD0|A Chain A, Human Thioredoxin C35s,C62s,C69s,C73s Mutant Showing Cadmium Chloride Bound To The Active Site Length = 105 Back     alignment and structure
>pdb|2WZ9|A Chain A, Crystal Structure Of The Thioredoxin Domain Of Human Txnl2 Length = 153 Back     alignment and structure
>pdb|3F8U|A Chain A, TapasinERP57 HETERODIMER Length = 481 Back     alignment and structure
>pdb|1MEK|A Chain A, Human Protein Disulfide Isomerase, Nmr, 40 Structures Length = 120 Back     alignment and structure
>pdb|2IFQ|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 Back     alignment and structure
>pdb|2DIY|A Chain A, The Solution Structure Of The Thioredoxin Domain Of Human Thioredoxin-Like Protein 2 Length = 130 Back     alignment and structure
>pdb|2IFQ|B Chain B, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 Back     alignment and structure
>pdb|3TRX|A Chain A, High-Resolution Three-Dimensional Structure Of Reduced Recombinant Human Thioredoxin In Solution Length = 105 Back     alignment and structure
>pdb|3APS|A Chain A, Crystal Structure Of Trx4 Domain Of Erdj5 Length = 122 Back     alignment and structure
>pdb|1MDI|A Chain A, High Resolution Solution Nmr Structure Of Mixed Disulfide Intermediate Between Mutant Human Thioredoxin And A 13 Residue Peptide Comprising Its Target Site In Human Nfkb Length = 105 Back     alignment and structure
>pdb|3VFI|A Chain A, Crystal Structure Of A Metagenomic Thioredoxin Length = 104 Back     alignment and structure
>pdb|3QFA|C Chain C, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 116 Back     alignment and structure
>pdb|1AIU|A Chain A, Human Thioredoxin (D60n Mutant, Reduced Form) Length = 105 Back     alignment and structure
>pdb|2DML|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A6 Length = 130 Back     alignment and structure
>pdb|3D21|A Chain A, Crystal Structure Of A Poplar Wild-Type Thioredoxin H, Pttrxh4 Length = 139 Back     alignment and structure
>pdb|3E3E|A Chain A, Human Thioredoxin Double Mutant C35s,C73r Length = 105 Back     alignment and structure
>pdb|2DIZ|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Human Thioredoxin Domain-Containing Protein 5 Length = 117 Back     alignment and structure
>pdb|3UJ1|A Chain A, Crystal Structure Of The Third Thioredoxin Domain Of Human Erp46 Length = 110 Back     alignment and structure
>pdb|3UVT|A Chain A, Crystal Structure Of The Third Catalytic Domain Of Erp46 Length = 111 Back     alignment and structure
>pdb|3UL3|B Chain B, Structural Insights Into Thioredoxin-2: A Component Of Malaria Parasite Protein Secretion Machinery Length = 128 Back     alignment and structure
>pdb|3D22|A Chain A, Crystal Structure Of A Poplar Thioredoxin H Mutant, Pttrxh4c61s Length = 139 Back     alignment and structure
>pdb|3IDV|A Chain A, Crystal Structure Of The A0a Fragment Of Erp72 Length = 241 Back     alignment and structure
>pdb|1F9M|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Short Form) Length = 112 Back     alignment and structure
>pdb|1FAA|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Long Form) Length = 124 Back     alignment and structure
>pdb|3UEM|A Chain A, Crystal Structure Of Human Pdi Bb'a' Domains Length = 361 Back     alignment and structure
>pdb|2DJ2|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 120 Back     alignment and structure
>pdb|1X5C|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase Length = 121 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|1ERW|A Chain A, Human Thioredoxin Double Mutant With Cys 32 Replaced By Ser And Cys 35 Replaced By Ser Length = 105 Back     alignment and structure
>pdb|3ED3|A Chain A, Crystal Structure Of The Yeast DithiolDISULFIDE Oxidoreductase Mpd1p Length = 298 Back     alignment and structure
>pdb|2R2J|A Chain A, Crystal Structure Of Human Erp44 Length = 382 Back     alignment and structure
>pdb|2F51|A Chain A, Structure Of Trichomonas Vaginalis Thioredoxin Length = 118 Back     alignment and structure
>pdb|2HXK|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 Back     alignment and structure
>pdb|2DJ1|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 140 Back     alignment and structure
>pdb|2PU9|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin: Thioredoxin Reductase And Thioredoxin F Length = 111 Back     alignment and structure
>pdb|1X5E|A Chain A, The Solution Structure Of The Thioredoxin-Like Domain Of Human Thioredoxin-Related Transmembrane Protein Length = 126 Back     alignment and structure
>pdb|2DJJ|A Chain A, Solution Structure Of The A' Domain Of Thermophilic Fungal Protein Disulfide Isomerase Length = 121 Back     alignment and structure
>pdb|2B5E|A Chain A, Crystal Structure Of Yeast Protein Disulfide Isomerase Length = 504 Back     alignment and structure
>pdb|2DMM|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Human Protein Disulfide-Isomerase A3 Length = 142 Back     alignment and structure
>pdb|3GL3|A Chain A, Crystal Structure Of A Putative Thiol:disulfide Interchange Protein Dsbe From Chlorobium Tepidum Length = 152 Back     alignment and structure
>pdb|1R26|A Chain A, Crystal Structure Of Thioredoxin From Trypanosoma Brucei Brucei Length = 125 Back     alignment and structure
>pdb|1FO5|A Chain A, Solution Structure Of Reduced Mj0307 Length = 85 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2LJA|A Chain A, Solution Structure Of A Putative Thiol-Disulfide Oxidoreductase From Bacteroides Vulgatus Length = 152 Back     alignment and structure
>pdb|2G0F|A Chain A, Crystal Structure Of P144a Mutant Of E.Coli Ccmg Protein Length = 168 Back     alignment and structure
>pdb|2B1L|A Chain A, Crystal Structure Of N-Terminal 57 Residue Deletion Mutant Of E. Coli Ccmg Protein(Residues 58-185) Length = 129 Back     alignment and structure
>pdb|2B1K|A Chain A, Crystal Structure Of E. Coli Ccmg Protein Length = 168 Back     alignment and structure
>pdb|1A8L|A Chain A, Protein Disulfide Oxidoreductase From Archaeon Pyrococcus Furiosus Length = 226 Back     alignment and structure
>pdb|2DJ0|A Chain A, The Solution Structure Of The Thioredoxin Domain Of Human Thioredoxin-Related Transmembrane Protein 2 Length = 137 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 4e-65
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 1e-63
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 1e-61
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 1e-60
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 3e-60
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 6e-60
2l5l_A136 Thioredoxin; structural genomics, electron transpo 1e-59
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 1e-59
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 4e-59
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 1e-58
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 1e-58
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 3e-57
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 3e-57
2yzu_A109 Thioredoxin; redox protein, electron transport, st 3e-57
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 3e-57
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 2e-56
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 3e-56
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 3e-56
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 4e-56
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 4e-56
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 5e-56
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 5e-56
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 2e-55
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 3e-55
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 1e-54
3dxb_A 222 Thioredoxin N-terminally fused to PUF60(UHM); spli 3e-54
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 7e-53
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 3e-51
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 6e-49
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 1e-47
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 5e-47
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 9e-47
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 1e-46
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 2e-45
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 2e-45
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 2e-45
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 7e-45
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 1e-44
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 1e-44
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 1e-44
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 5e-44
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 2e-43
2l57_A126 Uncharacterized protein; structural genomics, unkn 2e-43
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 8e-43
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 1e-42
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 1e-42
1wmj_A130 Thioredoxin H-type; structural genomics, program f 1e-41
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 4e-41
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 5e-41
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 1e-40
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 1e-40
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 5e-40
4euy_A105 Uncharacterized protein; structural genomics, PSI- 5e-40
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 5e-40
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 6e-40
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 9e-40
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 2e-39
2kuc_A130 Putative disulphide-isomerase; structural genomics 9e-39
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 3e-37
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 3e-36
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 7e-35
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 8e-35
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 2e-28
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 8e-28
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 9e-28
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 3e-27
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 1e-26
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 1e-25
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 1e-24
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 9e-24
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 4e-23
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 5e-23
2qsi_A137 Putative hydrogenase expression/formation protein; 4e-22
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 2e-21
1mek_A120 Protein disulfide isomerase; electron transport, r 2e-21
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 3e-21
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 7e-17
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 1e-20
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-19
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-16
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-16
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 7e-09
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 4e-20
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 5e-20
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 2e-16
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 9e-20
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 1e-19
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 1e-18
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 6e-18
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 2e-18
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 7e-18
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 1e-17
1zma_A118 Bacterocin transport accessory protein; alpha-beta 1e-17
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 4e-17
2l5o_A153 Putative thioredoxin; structural genomics, unknown 5e-17
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 6e-17
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 8e-17
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 9e-17
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 4e-06
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 1e-16
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 2e-16
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 2e-16
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 3e-16
4evm_A138 Thioredoxin family protein; structural genomics, n 5e-16
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 7e-16
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 8e-16
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 8e-16
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 2e-15
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 3e-15
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 3e-15
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 5e-15
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 5e-15
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 6e-15
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 3e-14
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 5e-14
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 7e-14
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 8e-14
2lrn_A152 Thiol:disulfide interchange protein; structural ge 2e-13
2lrt_A152 Uncharacterized protein; structural genomics, thio 2e-13
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 3e-13
3raz_A151 Thioredoxin-related protein; structural genomics, 4e-13
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 6e-13
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 8e-13
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 1e-12
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 2e-12
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 3e-12
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 5e-12
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 7e-12
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 8e-12
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 8e-12
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 1e-11
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 1e-11
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 1e-11
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 2e-11
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 2e-11
2ls5_A159 Uncharacterized protein; structural genomics, unkn 2e-11
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 5e-11
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 7e-11
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 8e-11
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 9e-11
2ywm_A 229 Glutaredoxin-like protein; redox protein, structur 3e-10
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 1e-10
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 2e-10
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 7e-10
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 2e-09
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 1e-08
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 3e-08
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 5e-08
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 7e-08
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 9e-08
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 1e-07
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 5e-07
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 1e-06
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 2e-06
3f9u_A172 Putative exported cytochrome C biogenesis-related; 3e-04
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 8e-04
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Length = 105 Back     alignment and structure
 Score =  194 bits (495), Expect = 4e-65
 Identities = 69/105 (65%), Positives = 90/105 (85%)

Query: 82  EVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDE 141
           EV  V D++W+  VL+S  PV+V+FWAPWCGPC++I P+IDEL+K+Y GK+  YK+NTDE
Sbjct: 1   EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDE 60

Query: 142 SPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL 186
           +P IAT+Y IRSIPTV+ FKNGE+K+++IGAVPKSTLT SIEK+L
Sbjct: 61  APGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 105


>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Length = 106 Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Length = 112 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Length = 108 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Length = 115 Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Length = 109 Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 128 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Length = 107 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Length = 155 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Length = 106 Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Length = 105 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Length = 121 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Length = 141 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Length = 119 Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Length = 112 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Length = 123 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Length = 114 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Length = 112 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Length = 125 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Length = 109 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Length = 106 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Length = 118 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Length = 104 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Length = 112 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Length = 117 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Length = 130 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Length = 118 Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Length = 122 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Length = 139 Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Length = 133 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Length = 226 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} Length = 127 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Length = 245 Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Length = 137 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Length = 121 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Length = 217 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Length = 118 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Length = 153 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Length = 151 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Length = 148 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Length = 164 Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Length = 240 Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Length = 152 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Length = 136 Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Length = 138 Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 136 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Length = 152 Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} Length = 145 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Length = 158 Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Length = 154 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Length = 154 Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} Length = 165 Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Length = 470 Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Length = 148 Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Length = 352 Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130 Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Length = 152 Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Length = 152 Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Length = 143 Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Length = 151 Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Length = 148 Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Length = 183 Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164 Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Length = 140 Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Length = 142 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Length = 146 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Length = 144 Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Length = 143 Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Length = 142 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Length = 165 Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Length = 150 Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Length = 144 Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Length = 160 Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Length = 159 Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Length = 165 Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Length = 123 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Length = 158 Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Length = 160 Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Length = 186 Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Length = 167 Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Length = 168 Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Length = 176 Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Length = 156 Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Length = 116 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Length = 243 Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Length = 248 Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Length = 154 Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} Length = 151 Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Length = 172 Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Length = 178 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
2qsi_A137 Putative hydrogenase expression/formation protein; 99.96
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 99.95
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.95
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.94
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.93
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.93
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.93
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 99.93
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 99.93
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 99.93
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 99.93
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.92
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.92
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.92
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.92
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 99.92
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.92
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.92
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 99.92
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 99.92
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 99.92
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.92
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.92
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 99.91
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 99.91
2yzu_A109 Thioredoxin; redox protein, electron transport, st 99.91
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.91
4euy_A105 Uncharacterized protein; structural genomics, PSI- 99.91
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.91
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 99.91
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.91
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.91
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 99.91
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 99.91
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 99.91
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 99.91
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 99.91
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 99.91
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 99.9
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 99.9
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.9
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 99.9
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 99.9
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 99.9
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 99.9
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 99.9
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 99.9
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 99.9
3dxb_A 222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.9
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 99.9
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 99.9
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 99.9
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 99.9
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.9
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.9
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 99.89
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 99.89
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 99.89
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 99.89
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 99.89
2l57_A126 Uncharacterized protein; structural genomics, unkn 99.89
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 99.89
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 99.89
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 99.88
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 99.88
1mek_A120 Protein disulfide isomerase; electron transport, r 99.88
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 99.88
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.88
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 99.88
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 99.88
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 99.87
1zma_A118 Bacterocin transport accessory protein; alpha-beta 99.87
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 99.87
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 99.87
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 99.87
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 99.79
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 99.86
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 99.86
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 99.85
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.85
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 99.85
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 99.84
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 99.84
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 99.84
1wmj_A130 Thioredoxin H-type; structural genomics, program f 99.84
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 99.84
2kuc_A130 Putative disulphide-isomerase; structural genomics 99.83
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 99.83
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.83
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 99.83
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 99.83
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.82
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 99.82
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.82
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.82
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 99.82
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 99.82
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.81
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 99.81
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.81
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.8
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.8
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 99.8
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.8
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 99.67
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 99.79
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.79
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.79
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.78
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.78
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 99.78
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.78
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.77
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.77
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 99.77
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 99.77
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.77
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.77
4evm_A138 Thioredoxin family protein; structural genomics, n 99.77
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 99.77
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.77
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.76
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.76
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.76
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.75
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 99.75
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 99.75
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.75
3ira_A173 Conserved protein; methanosarcina mazei,structural 99.75
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.75
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 99.75
3raz_A151 Thioredoxin-related protein; structural genomics, 99.75
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 99.74
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.74
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.74
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 99.74
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.74
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.73
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 99.73
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 99.73
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 99.72
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.72
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 99.71
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.71
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 99.71
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.71
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.71
1ttz_A87 Conserved hypothetical protein; structural genomic 99.7
1a8l_A 226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.7
2ywm_A 229 Glutaredoxin-like protein; redox protein, structur 99.7
2ywi_A196 Hypothetical conserved protein; uncharacterized co 99.7
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 99.7
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 99.69
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 99.69
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 99.68
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 99.68
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 99.67
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 99.66
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 99.66
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 99.66
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 99.66
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 99.66
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.66
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 99.65
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 99.65
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.65
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 99.65
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 99.65
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.64
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 99.64
2ls5_A159 Uncharacterized protein; structural genomics, unkn 99.43
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 99.62
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 99.62
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 99.62
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 99.62
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 99.4
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.6
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.58
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 99.57
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 99.57
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 99.57
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 99.57
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 99.57
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 99.56
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 99.56
2hls_A 243 Protein disulfide oxidoreductase; thioredoxin fold 99.55
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.55
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 99.54
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 99.54
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 99.53
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 99.52
2jsy_A167 Probable thiol peroxidase; solution structure, ant 99.51
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 99.5
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 99.49
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 99.49
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 99.48
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 99.48
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 99.47
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 99.47
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 99.47
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 99.46
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 99.44
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 99.43
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 99.43
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 99.43
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 99.43
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 99.39
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 99.39
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 99.39
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 99.38
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 99.34
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 99.33
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 99.32
1psq_A163 Probable thiol peroxidase; structural genomics, NY 99.32
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 99.31
3me7_A170 Putative uncharacterized protein; electron transfe 99.31
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 99.28
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 99.27
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 99.26
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 99.26
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 99.26
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 99.25
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 99.24
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.23
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 99.21
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 99.2
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 99.2
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 99.2
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 99.18
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 99.17
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 99.17
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 99.16
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 99.15
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 99.14
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 99.14
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 99.14
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 99.14
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 99.12
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 99.12
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 99.09
1kte_A105 Thioltransferase; redox-active center, electron tr 99.08
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 99.07
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 99.07
1z6m_A175 Conserved hypothetical protein; structural genomic 99.06
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 99.02
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 99.01
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 98.97
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 98.97
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 98.95
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 98.92
3keb_A224 Probable thiol peroxidase; structural genomics, AP 98.92
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 98.92
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 98.91
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 98.85
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.84
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 98.83
3l9s_A191 Thiol:disulfide interchange protein; thioredoxin-f 98.77
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 98.76
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 98.75
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 98.74
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 98.73
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 98.72
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 98.7
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 98.68
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 98.67
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 98.64
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.63
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 98.62
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 98.62
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 98.52
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 98.5
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 98.49
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 98.45
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 98.42
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thi 98.41
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 98.41
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 98.39
4f9z_D 227 Endoplasmic reticulum resident protein 27; thiored 98.37
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 98.3
3c7m_A195 Thiol:disulfide interchange protein DSBA-like; red 98.26
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 98.24
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 98.23
2in3_A216 Hypothetical protein; DSBA family, FRNE-like subfa 98.15
3kzq_A208 Putative uncharacterized protein VP2116; protein w 98.15
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 98.14
3tdg_A273 DSBG, putative uncharacterized protein; thioredoxi 98.14
2h8l_A 252 Protein disulfide-isomerase A3; thioredoxin-like f 98.11
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 98.09
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2 98.04
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, s 97.99
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 97.91
3ec3_A 250 Protein disulfide-isomerase A4; thioredoxin-like f 97.88
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 97.86
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 97.83
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 97.79
2axo_A 270 Hypothetical protein ATU2684; alpha beta protein., 97.78
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 97.77
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 97.7
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 97.69
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 97.69
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 97.68
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 97.67
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 97.59
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 97.57
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 97.56
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 97.35
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 96.99
2imf_A 203 HCCA isomerase, 2-hydroxychromene-2-carboxylate is 96.86
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 96.38
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 96.26
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 96.12
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 96.12
1t4y_A105 Adaptive-response sensory-kinase SASA; alpha/beta 95.91
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 95.73
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 95.5
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 94.9
3ktb_A106 Arsenical resistance operon trans-acting represso; 94.17
3gl5_A239 Putative DSBA oxidoreductase SCO1869; probable DSB 93.36
3kgk_A110 Arsenical resistance operon trans-acting represso; 92.96
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 92.89
1z3e_A132 Regulatory protein SPX; bacterial transcription re 92.81
1r4w_A226 Glutathione S-transferase, mitochondrial; glutathi 91.51
3l78_A120 Regulatory protein SPX; transcription, transcripti 91.3
3fz5_A202 Possible 2-hydroxychromene-2-carboxylate isomeras; 90.88
2g2q_A124 Glutaredoxin-2; thioredoxin-fold, oxidoreductase, 89.4
3fz4_A120 Putative arsenate reductase; APC61768, structural 88.51
3gkx_A120 Putative ARSC family related protein; ARSC family 86.66
3rpp_A234 Glutathione S-transferase kappa 1; glutathione tra 86.3
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 83.71
4g9p_A406 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 83.62
1wwj_A105 Circadian clock protein KAIB; 1.90A {Synechocystis 82.56
3rdw_A121 Putative arsenate reductase; structural genomics, 81.73
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural 81.6
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.96  E-value=4.8e-29  Score=181.14  Aligned_cols=110  Identities=16%  Similarity=0.258  Sum_probs=98.7

Q ss_pred             ccccccccccChhHHHHHHHhCCCcEEEEEECCCC--cccccchHHHHHHHHHhcCceEEEEEeCCCChHHHHHcCCCcc
Q 029863           77 QETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWC--GPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSI  154 (186)
Q Consensus        77 ~~~~~~v~~l~~~~~~~~~~~~~k~vvv~F~a~wC--~~C~~~~p~l~~l~~~~~~~v~~~~v~~d~~~~l~~~~~i~~~  154 (186)
                      .......+.+++++|++.+...++++||+||++||  ++|+++.|.+++++++|.++++|+++|+|++++++.+|||+++
T Consensus        11 l~~~~g~~~vt~~~F~~~v~~~~~~vlVdF~A~wCr~gpCk~iaPvleela~e~~~~v~~~KVdvDe~~~la~~ygV~si   90 (137)
T 2qsi_A           11 AARPNAPTLVDEATVDDFIAHSGKIVVLFFRGDAVRFPEAADLAVVLPELINAFPGRLVAAEVAAEAERGLMARFGVAVC   90 (137)
T ss_dssp             ------CEEECTTTHHHHHHTSSSEEEEEECCCTTTCTTHHHHHHHHHHHHHTSTTTEEEEEECGGGHHHHHHHHTCCSS
T ss_pred             HHHhcCCcccCHhHHHHHHhcCCCcEEEEEeCCccCCCchhhHHhHHHHHHHHccCCcEEEEEECCCCHHHHHHcCCccC
Confidence            34445667889999999887777799999999999  9999999999999999999999999999999999999999999


Q ss_pred             cEEEEEeCCeEEEEEeCCCCHHHHHHHHHhhC
Q 029863          155 PTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL  186 (186)
Q Consensus       155 Pt~i~~~~G~~~~~~~G~~~~~~l~~~l~~~l  186 (186)
                      ||+++|+||+++.+..|..++++|.++|++++
T Consensus        91 PTlilFkdG~~v~~~vG~~~k~~l~~~l~~~l  122 (137)
T 2qsi_A           91 PSLAVVQPERTLGVIAKIQDWSSYLAQIGAML  122 (137)
T ss_dssp             SEEEEEECCEEEEEEESCCCHHHHHHHHHHHH
T ss_pred             CEEEEEECCEEEEEEeCCCCHHHHHHHHHHHh
Confidence            99999999999999999999999999998753



>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} Back     alignment and structure
>3kzq_A Putative uncharacterized protein VP2116; protein with unknown function, STRU genomics, PSI, MCSG, protein structure initiative; HET: PG6; 2.10A {Vibrio parahaemolyticus} Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Back     alignment and structure
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>1t4y_A Adaptive-response sensory-kinase SASA; alpha/beta protein, thioredoxin fold, transferase; NMR {Synechococcus elongatus} SCOP: c.47.1.15 PDB: 1t4z_A Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} Back     alignment and structure
>3gl5_A Putative DSBA oxidoreductase SCO1869; probable DSBA oxidoreductase structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.15A {Streptomyces coelicolor A3} Back     alignment and structure
>3kgk_A Arsenical resistance operon trans-acting represso; alpha+beta, chaperone, DNA-binding, RE transcription, transcription regulation; 1.40A {Escherichia coli} PDB: 3mwh_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>1r4w_A Glutathione S-transferase, mitochondrial; glutathione transferase, kappa GST, RGSTK1-1; HET: GSH; 2.50A {Rattus norvegicus} SCOP: c.47.1.13 Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>3fz5_A Possible 2-hydroxychromene-2-carboxylate isomeras; 2-hydroxychromene-2-carboxylate ISO structural genomics, PSI-2; HET: MSE GSH PGE; 2.40A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2g2q_A Glutaredoxin-2; thioredoxin-fold, oxidoreductase, poxvirus; 2.50A {Vaccinia virus} Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>3rpp_A Glutathione S-transferase kappa 1; glutathione transferase, kappa GST, TRX domain, GSH binding, detoxification, APO form; 1.80A {Homo sapiens} PDB: 3rpn_A 1yzx_A* Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>4g9p_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; oxidoreductase, isoprenoid biosynthesis, non mevalonate PATH iron-sulphur-cluster; HET: CDI MES; 1.55A {Thermus thermophilus} PDB: 2y0f_A* Back     alignment and structure
>1wwj_A Circadian clock protein KAIB; 1.90A {Synechocystis SP} PDB: 1r5p_A 2qke_A 1vgl_A Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d2trxa_108 c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId 5e-33
d1dbya_107 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 4e-31
d1nw2a_105 c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc 1e-28
d1thxa_108 c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 2e-28
d1fb6a_104 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 2e-28
d2es7a1119 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H 3e-28
d2hfda1132 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H 1e-25
d1gh2a_107 c.47.1.1 (A:) Thioredoxin-like protein, N-terminal 4e-24
d1f9ma_112 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 1e-23
d2b5ea1140 c.47.1.2 (A:365-504) Protein disulfide isomerase, 2e-23
d2ifqa1105 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapien 3e-23
d1qgva_137 c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human 3e-23
d2djja1116 c.47.1.2 (A:6-121) Protein disulfide isomerase, PD 1e-22
d1nhoa_85 c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik 5e-22
d2trcp_217 c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [ 7e-22
d1meka_120 c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu 3e-21
d1syra_103 c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plas 6e-20
d1ep7a_112 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 8e-20
d1xfla_114 c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsi 3e-19
d1a8la2107 c.47.1.2 (A:120-226) Protein disulfide isomerase, 4e-18
d2b5xa1143 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase 8e-18
d1xwaa_111 c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila m 9e-18
d1ti3a_113 c.47.1.1 (A:) Thioredoxin {European aspen (Populus 1e-17
d2c0ga2122 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma 4e-17
d1r26a_113 c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [Tax 5e-17
d1zmaa1115 c.47.1.1 (A:1-115) Bacterocin transport accessory 7e-17
d1fo5a_85 c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-lik 7e-17
d1g7ea_122 c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, 1e-16
d1woua_119 c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxi 1e-16
d2fy6a1143 c.47.1.10 (A:33-175) Peptide methionine sulfoxide 3e-16
d1wjka_100 c.47.1.1 (A:) Thioredoxin-like structure containin 6e-15
d1z5ye1136 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG 1e-14
d2b5ea4119 c.47.1.2 (A:23-141) Protein disulfide isomerase, P 4e-14
d1a8ya1124 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctola 9e-14
d1z6na1166 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Ps 5e-13
d1sena_135 c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 4e-12
d1hyua496 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase 7e-12
d2fwha1117 c.47.1.1 (A:428-544) Thiol:disulfide interchange p 2e-11
d1i5ga_144 c.47.1.10 (A:) Tryparedoxin II {Crithidia fascicul 2e-10
d1lu4a_134 c.47.1.10 (A:) Soluble secreted antigen MPT53 {Myc 6e-10
d1knga_144 c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY 1e-09
d1o73a_144 c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei 2e-07
d2dlxa1147 c.47.1.24 (A:1-147) UBX domain-containing protein 2e-06
d1zzoa1134 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacteri 3e-06
d1z6ma1172 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {E 0.003
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin
species: Escherichia coli [TaxId: 562]
 Score =  112 bits (280), Expect = 5e-33
 Identities = 47/101 (46%), Positives = 70/101 (69%)

Query: 86  VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSI 145
           +TD ++ + VL +   +LV+FWA WCGPC+MI PI+DE++ +Y GKL   K+N D++P  
Sbjct: 7   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 66

Query: 146 ATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL 186
           A +YGIR IPT+++FKNGE   T +GA+ K  L   ++  L
Sbjct: 67  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 107


>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Length = 104 Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 217 Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 103 Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 112 Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 114 Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 107 Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Length = 143 Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 111 Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Length = 113 Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Length = 113 Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 85 Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Length = 143 Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Length = 136 Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 119 Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 124 Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 96 Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Length = 117 Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Length = 144 Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 134 Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Length = 144 Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Length = 144 Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Length = 134 Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Length = 172 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.96
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.96
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.96
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.96
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.95
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.94
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.93
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.93
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.93
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.93
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.92
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.92
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.92
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.92
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.91
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.9
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 99.9
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.9
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.9
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.88
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 99.87
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 99.86
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 99.86
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 99.85
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 99.84
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 99.84
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.81
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 99.8
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.79
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.79
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.75
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.74
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 99.73
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.73
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.73
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.71
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.7
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.69
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.67
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.63
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.6
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.57
d1wjka_100 Thioredoxin-like structure containing protein C330 99.55
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 99.53
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 99.52
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 99.48
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 99.37
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 99.23
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 99.15
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.15
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 99.11
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 99.09
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.08
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.03
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 98.99
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 98.96
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 98.94
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 98.9
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 98.9
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 98.88
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 98.87
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 98.82
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.8
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 98.8
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 98.77
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 98.77
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.72
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 98.6
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 98.58
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 98.54
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 98.54
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 98.5
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 98.5
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 98.47
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 98.41
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 98.39
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 98.36
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 98.35
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.35
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.3
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.26
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 98.22
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.07
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.01
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 97.97
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.81
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 97.79
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 97.02
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 96.95
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 96.78
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 96.36
d1hyua3102 Alkyl hydroperoxide reductase subunit F (AhpF), N- 96.33
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 96.19
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 96.06
d2axoa1 225 Hypothetical protein Atu2684 {Agrobacterium tumefa 95.82
d1t4za_105 Adaptive-response sensory-kinase SasA, N-terminal 95.25
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 95.06
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 94.61
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 94.5
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 91.92
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 90.1
d1r4wa_221 Mitochondrial class kappa glutathione S-transferas 89.86
d1un2a_ 195 Disulfide-bond formation facilitator (DsbA) {Esche 89.42
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 88.04
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 87.94
d1r5pa_90 Circadian oscillation regulator KaiB {Cyanobacteri 86.85
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 86.78
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 84.68
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 82.42
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 80.78
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin
species: Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]
Probab=99.96  E-value=1.9e-29  Score=173.73  Aligned_cols=104  Identities=65%  Similarity=1.251  Sum_probs=100.0

Q ss_pred             ccccChhHHHHHHHhCCCcEEEEEECCCCcccccchHHHHHHHHHhcCceEEEEEeCCCChHHHHHcCCCcccEEEEEeC
Q 029863           83 VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKN  162 (186)
Q Consensus        83 v~~l~~~~~~~~~~~~~k~vvv~F~a~wC~~C~~~~p~l~~l~~~~~~~v~~~~v~~d~~~~l~~~~~i~~~Pt~i~~~~  162 (186)
                      +.++|+++|++.+..++++++|+||++||++|+++.|.+.++++++.+++.++.+|+|++++++++|+|+++||+++|++
T Consensus         1 v~el~d~~f~~~v~~~~~~vlv~F~a~wC~~C~~~~~~~~~l~~~~~~~~~~~~v~~d~~~~l~~~~~V~~~Pt~~~~~~   80 (104)
T d1fb6a_           1 VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKN   80 (104)
T ss_dssp             CEECCTTTHHHHTTTCSSCEEEEEECTTCHHHHHHHHHHHHHHHHTTTTCEEEEEETTTCHHHHHHTTCCSSSEEEEEET
T ss_pred             CeECchhhHHHHHHcCCCcEEEEEEcCccCCccccCchhHHHHHhhcCccceeEEecccchhhhhhcceeeeeEEEEEEc
Confidence            46789999999888889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeEEEEEeCCCCHHHHHHHHHhhC
Q 029863          163 GEKKDTVIGAVPKSTLTTSIEKFL  186 (186)
Q Consensus       163 G~~~~~~~G~~~~~~l~~~l~~~l  186 (186)
                      |+++.++.|..+.++|.++|+++|
T Consensus        81 G~~v~~~~G~~~~~~l~~~i~~~L  104 (104)
T d1fb6a_          81 GERKESIIGAVPKSTLTDSIEKYL  104 (104)
T ss_dssp             TEEEEEEEECCCHHHHHHHHHHHC
T ss_pred             CeEEEEEeCCCCHHHHHHHHHHhC
Confidence            999999999999999999999986



>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1t4za_ c.47.1.15 (A:) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r4wa_ c.47.1.13 (A:) Mitochondrial class kappa glutathione S-transferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5pa_ c.47.1.15 (A:) Circadian oscillation regulator KaiB {Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId: 1180]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure