Citrus Sinensis ID: 029874

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGIRYVGILNPCEHSIRSSKFSTKFIIVTL
cEEEccccccccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccEEEEccccccccccHHHHHHHHHHHccccccccccEEccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHcccccccccccEEc
cEEEcccccEEEcEcEEcccccHHHHHHHHHHHHHHcccEEEccHHHccHHHHHHHHHHHHHcccccHHHcEEEEEEcHHHcHHHHHHHHHHHHHHccccEEEEEEccccEEcccccccccccccccccEEEcccccHHHHHHHHHHHHHcccEccEEEEccccccccEEEEEccccccHHHHHcc
maitlnngfkmpiiglgvwrmdeSNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFIttklwnsdhghVLEACKDSLKKLQLDYLDLYLVHfpvatkhtgvgttdsaldadgvleidttiSLETTWHAMEDLVSMGLVRSIGIRYvgilnpcehsirsskfstKFIIVTL
maitlnngfkmpiiGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGIRYVGILNpcehsirsskfstkfiivtl
MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDHGHVLEACKDSlkklqldyldlylVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGIRYVGILNPCEHSIRSSKFSTKFIIVTL
***TLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGIRYVGILNPCEHSIRSSKFSTKFIIV**
MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGIRYVGILNPCEHSIRSSKFSTKFIIVTL
MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGIRYVGILNPCEHSIRSSKFSTKFIIVTL
MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGIRYVGILNPCEHSIRSSKFSTKFIIVTL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGIRYVGILNPCEHSIRSSKFSTKFIIVTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
P28475 310 NADP-dependent D-sorbitol N/A no 0.844 0.506 0.675 3e-63
Q3ZCJ2 325 Alcohol dehydrogenase [NA yes no 0.822 0.470 0.481 2e-35
Q6AZW2 324 Alcohol dehydrogenase [NA no no 0.822 0.472 0.462 4e-34
P78736 318 NAD(P)H-dependent D-xylos N/A no 0.844 0.493 0.478 6e-34
Q8X195 321 NADPH-dependent D-xylose N/A no 0.876 0.507 0.476 6e-34
O94735 317 NADPH-dependent D-xylose N/A no 0.854 0.501 0.447 8e-34
P51635 325 Alcohol dehydrogenase [NA yes no 0.827 0.473 0.447 9e-34
P50578 325 Alcohol dehydrogenase [NA yes no 0.822 0.470 0.462 1e-33
Q0CUL0 320 Probable NAD(P)H-dependen N/A no 0.838 0.487 0.450 2e-33
C5FFQ7 327 Probable NAD(P)H-dependen N/A no 0.849 0.483 0.428 2e-33
>sp|P28475|S6PD_MALDO NADP-dependent D-sorbitol-6-phosphate dehydrogenase OS=Malus domestica GN=S6PDH PE=2 SV=1 Back     alignment and function desciption
 Score =  240 bits (613), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 106/157 (67%), Positives = 137/157 (87%)

Query: 3   ITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFS 62
           +TL++G++MP+IGLG+WR+++  ++++I+NAIKIGYRH DCAA Y++EA+VGEALAEAF 
Sbjct: 4   VTLSSGYEMPVIGLGLWRLEKDELKEVILNAIKIGYRHFDCAAHYKSEADVGEALAEAFK 63

Query: 63  TGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDS 122
           TGLVKRE+LFITTK+WNSDHGHV+EACK+SL+KLQ+DYLDLYLVH+P+ TKH  +G T S
Sbjct: 64  TGLVKREELFITTKIWNSDHGHVVEACKNSLEKLQIDYLDLYLVHYPMPTKHNAIGKTAS 123

Query: 123 ALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGI 159
            L  D VL+ID TISL+ TW  ME  VS+GLVRSIG+
Sbjct: 124 LLGEDKVLDIDVTISLQQTWEGMEKTVSLGLVRSIGL 160
Synthesizes sorbitol-6-phosphate, a key intermediate in the synthesis of sorbitol which is a major photosynthetic product in many members of the Rosaceae family.
Malus domestica (taxid: 3750)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 0EC: 0
>sp|Q3ZCJ2|AK1A1_BOVIN Alcohol dehydrogenase [NADP(+)] OS=Bos taurus GN=AKR1A1 PE=2 SV=1 Back     alignment and function description
>sp|Q6AZW2|A1A1A_DANRE Alcohol dehydrogenase [NADP(+)] A OS=Danio rerio GN=akr1a1a PE=2 SV=2 Back     alignment and function description
>sp|P78736|XYL1_PACTA NAD(P)H-dependent D-xylose reductase OS=Pachysolen tannophilus GN=XYL1 PE=1 SV=1 Back     alignment and function description
>sp|Q8X195|XYL1_CANBO NADPH-dependent D-xylose reductase OS=Candida boidinii GN=XYL1 PE=1 SV=2 Back     alignment and function description
>sp|O94735|XYL1_PICGU NADPH-dependent D-xylose reductase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=XYL1 PE=1 SV=2 Back     alignment and function description
>sp|P51635|AK1A1_RAT Alcohol dehydrogenase [NADP(+)] OS=Rattus norvegicus GN=Akr1a1 PE=1 SV=2 Back     alignment and function description
>sp|P50578|AK1A1_PIG Alcohol dehydrogenase [NADP(+)] OS=Sus scrofa GN=AKR1A1 PE=1 SV=2 Back     alignment and function description
>sp|Q0CUL0|XYL1_ASPTN Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xyl1 PE=3 SV=1 Back     alignment and function description
>sp|C5FFQ7|XYL1_ARTOC Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=xyl1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
255543887 309 aldo-keto reductase, putative [Ricinus c 0.854 0.514 0.924 5e-81
297824975 309 hypothetical protein ARALYDRAFT_480985 [ 0.854 0.514 0.893 2e-78
225427786 309 PREDICTED: NADP-dependent D-sorbitol-6-p 0.854 0.514 0.874 2e-77
15226489 309 NAD(P)-linked oxidoreductase domain-cont 0.854 0.514 0.874 3e-77
21592829 309 putative NADPH dependent mannose 6-phosp 0.854 0.514 0.874 3e-77
42570859238 NAD(P)-linked oxidoreductase domain-cont 0.854 0.668 0.874 1e-76
449461629 309 PREDICTED: NADP-dependent D-sorbitol-6-p 0.854 0.514 0.861 3e-76
15226502 309 aldose-6-phosphate reductase (NADPH2) [A 0.854 0.514 0.849 3e-75
10334991 310 NADPH-dependent mannose 6-phosphate redu 0.854 0.512 0.849 1e-74
358248610 309 uncharacterized protein LOC100806500 [Gl 0.854 0.514 0.855 1e-74
>gi|255543887|ref|XP_002513006.1| aldo-keto reductase, putative [Ricinus communis] gi|223548017|gb|EEF49509.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  305 bits (781), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 151/159 (94%)

Query: 1   MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEA 60
           MAITLNNGFKMPIIGLGVWRM+  +IRDLIINAIKIGYRH DCAADY NE EVGEALAEA
Sbjct: 1   MAITLNNGFKMPIIGLGVWRMEGKDIRDLIINAIKIGYRHFDCAADYHNEKEVGEALAEA 60

Query: 61  FSTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTT 120
           F TGLVKREDLFITTKLWNSDHGHV EACKDSL+KLQL+YLDLYLVHFPVATKHTGVGTT
Sbjct: 61  FQTGLVKREDLFITTKLWNSDHGHVTEACKDSLQKLQLEYLDLYLVHFPVATKHTGVGTT 120

Query: 121 DSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGI 159
           DSALD DGVLEIDTTISLETTWHAMEDLVSMGLVRSIGI
Sbjct: 121 DSALDEDGVLEIDTTISLETTWHAMEDLVSMGLVRSIGI 159

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297824975|ref|XP_002880370.1| hypothetical protein ARALYDRAFT_480985 [Arabidopsis lyrata subsp. lyrata] gi|297326209|gb|EFH56629.1| hypothetical protein ARALYDRAFT_480985 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225427786|ref|XP_002269232.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase [Vitis vinifera] gi|297744718|emb|CBI37980.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15226489|ref|NP_179721.1| NAD(P)-linked oxidoreductase domain-containing protein [Arabidopsis thaliana] gi|4567260|gb|AAD23673.1| putative NADPH dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|20198119|gb|AAM15409.1| putative NADPH dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|20260680|gb|AAM13238.1| putative NADPH-dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|24899831|gb|AAN65130.1| putative NADPH-dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|330252056|gb|AEC07150.1| NAD(P)-linked oxidoreductase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21592829|gb|AAM64779.1| putative NADPH dependent mannose 6-phosphate reductase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42570859|ref|NP_973503.1| NAD(P)-linked oxidoreductase domain-containing protein [Arabidopsis thaliana] gi|330252055|gb|AEC07149.1| NAD(P)-linked oxidoreductase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449461629|ref|XP_004148544.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Cucumis sativus] gi|449521003|ref|XP_004167521.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15226502|ref|NP_179722.1| aldose-6-phosphate reductase (NADPH2) [Arabidopsis thaliana] gi|4567261|gb|AAD23674.1| putative NADPH dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|20198120|gb|AAM15410.1| putative NADPH dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|108385345|gb|ABF85774.1| At2g21260 [Arabidopsis thaliana] gi|330252057|gb|AEC07151.1| aldose-6-phosphate reductase (NADPH2) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|10334991|gb|AAG15839.2|AF055910_1 NADPH-dependent mannose 6-phosphate reductase [Orobanche ramosa] Back     alignment and taxonomy information
>gi|358248610|ref|NP_001240166.1| uncharacterized protein LOC100806500 [Glycine max] gi|255646011|gb|ACU23493.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
TAIR|locus:2050135 309 AT2G21250 [Arabidopsis thalian 0.854 0.514 0.798 2e-65
TAIR|locus:2050155 309 AT2G21260 [Arabidopsis thalian 0.854 0.514 0.773 1.2e-63
ZFIN|ZDB-GENE-040625-7 345 akr1b1 "aldo-keto reductase fa 0.827 0.446 0.437 5e-28
UNIPROTKB|F1PK43 325 AKR1A1 "Uncharacterized protei 0.822 0.470 0.418 2.2e-27
UNIPROTKB|Q3ZCJ2 325 AKR1A1 "Alcohol dehydrogenase 0.822 0.470 0.425 2.8e-27
ZFIN|ZDB-GENE-040808-44 324 akr1a1a "aldo-keto reductase f 0.822 0.472 0.406 2.8e-27
UNIPROTKB|Q90W83 317 akr "Uncharacterized protein" 0.811 0.476 0.414 7.3e-27
ASPGD|ASPL0000055817 319 AN0423 [Emericella nidulans (t 0.838 0.489 0.403 1.5e-26
UNIPROTKB|E9PCX2263 AKR1B1 "Aldose reductase" [Hom 0.817 0.577 0.437 3.2e-26
UNIPROTKB|P15121 316 AKR1B1 "Aldose reductase" [Hom 0.817 0.481 0.437 3.2e-26
TAIR|locus:2050135 AT2G21250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 666 (239.5 bits), Expect = 2.0e-65, P = 2.0e-65
 Identities = 127/159 (79%), Positives = 136/159 (85%)

Query:     1 MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEA 60
             M ITLN+GFKMPI+GLGVWRM++  IRDLI+NAIKIGYRH+DCAADYRNE EVG+AL EA
Sbjct:     1 MEITLNSGFKMPIVGLGVWRMEKEGIRDLILNAIKIGYRHLDCAADYRNETEVGDALTEA 60

Query:    61 FSTGLVKREDLFITTKLWNSDHGHVLEACKDSXXXXXXXXXXXXXVHFPVATKHTGVGTT 120
             F TGLVKREDLFITTKLWNSDHGHV+EACKDS             VHFPVATKHTGVGTT
Sbjct:    61 FKTGLVKREDLFITTKLWNSDHGHVIEACKDSLKKLQLDYLDLFLVHFPVATKHTGVGTT 120

Query:   121 DSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGI 159
             DSAL  DGVL+IDTTISLETTWH ME LVSMGLVRSIGI
Sbjct:   121 DSALGDDGVLDIDTTISLETTWHDMEKLVSMGLVRSIGI 159
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2050155 AT2G21260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-7 akr1b1 "aldo-keto reductase family 1, member B1 (aldose reductase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK43 AKR1A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCJ2 AKR1A1 "Alcohol dehydrogenase [NADP(+)]" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040808-44 akr1a1a "aldo-keto reductase family 1, member A1a (aldehyde reductase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q90W83 akr "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ASPGD|ASPL0000055817 AN0423 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|E9PCX2 AKR1B1 "Aldose reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P15121 AKR1B1 "Aldose reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
COG0656 280 COG0656, ARA1, Aldo/keto reductases, related to di 2e-56
PRK11565 275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 3e-46
cd06660 285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 2e-43
PRK11172 267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 3e-29
pfam00248 277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 4e-26
COG0667 316 COG0667, Tas, Predicted oxidoreductases (related t 4e-20
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 2e-13
COG4989 298 COG4989, COG4989, Predicted oxidoreductase [Genera 2e-09
PRK10625 346 PRK10625, tas, putative aldo-keto reductase; Provi 2e-06
PRK09912 346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 2e-06
TIGR01293 317 TIGR01293, Kv_beta, voltage-dependent potassium ch 2e-05
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
 Score =  178 bits (454), Expect = 2e-56
 Identities = 70/162 (43%), Positives = 97/162 (59%), Gaps = 28/162 (17%)

Query: 1   MAITLNNGFKMPIIGLGVWRM-DESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAE 59
             +TLNNG ++P IGLG W++ D+      +  A+++GYR ID A  Y NE EVGEA+ E
Sbjct: 4   TKVTLNNGVEIPAIGLGTWQIGDDEWAVRAVRAALELGYRLIDTAEIYGNEEEVGEAIKE 63

Query: 60  AFSTGLVKREDLFITTKLWNSDHGH--VLEACKDSLKKLQLDYLDLYLVHFPVATKHTGV 117
                 V RE+LFITTK+W SD G+   L+A + SLK+L LDY+DLYL+H+PV  K    
Sbjct: 64  ----SGVPREELFITTKVWPSDLGYDETLKALEASLKRLGLDYVDLYLIHWPVPNK---- 115

Query: 118 GTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGI 159
                             + +E TW A+E+LV  GL+R+IG+
Sbjct: 116 -----------------YVVIEETWKALEELVDEGLIRAIGV 140

Length = 280
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
KOG1577 300 consensus Aldo/keto reductase family proteins [Gen 100.0
COG0656 280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
PRK11565 275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
COG0667 316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
TIGR01293 317 Kv_beta voltage-dependent potassium channel beta s 100.0
PRK11172 267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
cd06660 285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
PLN02587 314 L-galactose dehydrogenase 100.0
PRK10625 346 tas putative aldo-keto reductase; Provisional 100.0
PRK09912 346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
KOG1575 336 consensus Voltage-gated shaker-like K+ channel, su 100.0
PRK14863 292 bifunctional regulator KidO; Provisional 99.98
PF00248 283 Aldo_ket_red: Aldo/keto reductase family; InterPro 99.97
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 99.97
KOG1576 342 consensus Predicted oxidoreductase [Energy product 99.96
COG4989 298 Predicted oxidoreductase [General function predict 99.95
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 96.91
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1e-41  Score=275.35  Aligned_cols=169  Identities=50%  Similarity=0.804  Sum_probs=146.9

Q ss_pred             eeecCCCCcCCccccccccCCchhHHHHHHHHHHhCCceEeCCCCCCCHHHHHHHHHHHhhcCCccccceEEEeccCCC-
Q 029874            2 AITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNS-   80 (186)
Q Consensus         2 ~~~~~tg~~v~~lglG~~~~~~~~~~~~l~~a~~~Gi~~~Dta~~Yg~e~~vG~~l~~~~~~~~~~R~~~~i~tK~~~~-   80 (186)
                      ++++++|.+||.||||||+.++.++.++++.|+++|+||||||..|+||..+|++|+.++..+.++|+++||+||+|+. 
T Consensus         6 ~~~Ln~G~~mP~iGlGTw~~~~~~~~~aV~~Al~~GYRHIDtA~~Y~NE~evG~aik~~i~~~~v~RediFiTSKlw~~~   85 (300)
T KOG1577|consen    6 TVKLNNGFKMPIIGLGTWQSPPGQVAEAVKAAIKAGYRHIDTAHVYGNEKEVGEAIKELLAEGGVKREDIFITSKLWPTD   85 (300)
T ss_pred             eEeccCCCccceeeeEecccChhhHHHHHHHHHHhCcceeechhhhCChHHHHHHHHHHhhhCCcchhhheeeeccCccc
Confidence            5789999999999999999999999999999999999999999999999999999999998888999999999999985 


Q ss_pred             -ChhHHHHHHHHHHHHhCCCcccEEEEecCCCCCCCCCCCCCCCCCCCCcccccccccHHHHHHHHHHHHHcCCccEEEe
Q 029874           81 -DHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGI  159 (186)
Q Consensus        81 -~~~~i~~~~~~sl~~Lg~~~lDl~~lH~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~G~ir~iGv  159 (186)
                       .++.++.++++||++||+||+|+|++|||...++      ..|.+..+....+ ..+..++|++||++++.|++|+|||
T Consensus        86 ~~~~~v~~al~~sLk~L~ldYvDLyLiH~P~~~k~------~~~~~~~~~~~~~-~~~~~~tW~amE~~~~~Gl~rsIGV  158 (300)
T KOG1577|consen   86 HAPELVEKALEKSLKKLQLDYVDLYLIHWPVAFKD------SFPKDENGKVNYD-DVDRIETWKAMEKLVDEGLVRSIGV  158 (300)
T ss_pred             cChhhHHHHHHHHHHHhChhhhheeeEecccccCC------CCCcccccccccc-cchHHHHHHHHHHHHHcCCceEeee
Confidence             7899999999999999999999999999977632      2333332332222 2368899999999999999999999


Q ss_pred             cCCCchhHhhHHhhccCCC
Q 029874          160 RYVGILNPCEHSIRSSKFS  178 (186)
Q Consensus       160 sn~~~~~l~~~~~~~~~~~  178 (186)
                      |||+..+ ++.++...++-
T Consensus       159 SNF~~~~-le~ll~~~ki~  176 (300)
T KOG1577|consen  159 SNFNIKQ-LEELLNLAKIK  176 (300)
T ss_pred             ecCCHHH-HHHHHhcCCCC
Confidence            9999999 55555555443

>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3lz5_A 316 Human Aldose Reductase Mutant T113v Complexed With 2e-28
2pdb_A 316 Human Aldose Reductase Mutant F121p Complexed With 3e-28
2is7_A 315 Crystal Structure Of Aldose Reductase Complexed Wit 5e-28
3lqg_A 316 Human Aldose Reductase Mutant T113a Complexed With 6e-28
3onb_A 315 Bond Breakage And Relocation Of A Covalently Bound 6e-28
2pdm_A 316 Human Aldose Reductase Mutant S302r Complexed With 6e-28
1pwl_A 316 Crystal Structure Of Human Aldose Reductase Complex 6e-28
1z3n_A 319 Human Aldose Reductase In Complex With Nadp+ And Th 6e-28
3lbo_A 316 Human Aldose Reductase Mutant T113c Complexed With 6e-28
2agt_A 319 Aldose Reductase Mutant Leu 300 Pro Complexed With 7e-28
3q67_A 316 Human Aldose Reductase C298s Mutant In Complex With 7e-28
2pdk_A 316 Human Aldose Reductase Mutant L301m Complexed With 7e-28
2pdf_A 316 Human Aldose Reductase Mutant L300p Complexed With 7e-28
2pd5_A 316 Human Aldose Reductase Mutant V47i Complexed With Z 7e-28
2pdq_A 316 Human Aldose Reductase Mutant C303d Complexed With 7e-28
2pdi_A 316 Human Aldose Reductase Mutant L300a Complexed With 7e-28
2pdx_A 316 Human Aldose Reductase Double Mutant S302r-C303d Co 7e-28
3ld5_A 316 Human Aldose Reductase Mutant T113s Complexed With 9e-28
2ipw_A 315 Crystal Structure Of C298a W219y Aldose Reductase C 1e-27
2r24_A 316 Human Aldose Reductase Structure Length = 316 1e-27
1xgd_A 315 Apo R268a Human Aldose Reductase Length = 315 1e-27
1el3_A 316 Human Aldose Reductase Complexed With Idd384 Inhibi 1e-27
1ef3_A 315 Fidarestat Bound To Human Aldose Reductase Length = 1e-27
1abn_A 315 The Crystal Structure Of The Aldose Reductase Nadph 1e-27
3rx2_A 336 Crystal Structure Of Human Aldose Reductase Complex 1e-27
1dla_A 314 Novel Nadph-Binding Domain Revealed By The Crystal 1e-27
1eko_A 315 Pig Aldose Reductase Complexed With Idd384 Inhibito 1e-27
1ah0_A 316 Pig Aldose Reductase Complexed With Sorbinil Length 1e-27
3cv7_A 325 Crystal Structure Of Porcine Aldehyde Reductase Ter 3e-27
1cwn_A 324 Crystal Structure Of Porcine Aldehyde Reductase Hol 3e-27
1ae4_A 325 Aldehyde Reductase Complexed With Cofactor And Inhi 4e-27
2acu_A 315 Tyrosine-48 Is The Proton Donor And Histidine-110 D 6e-27
4gac_A 324 High Resolution Structure Of Mouse Aldehyde Reducta 9e-27
1hqt_A 326 The Crystal Structure Of An Aldehyde Reductase Y50f 1e-26
2alr_A 324 Aldehyde Reductase Length = 324 3e-26
3h7u_A 335 Crystal Structure Of The Plant Stress-Response Enzy 9e-26
3qkz_A 316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 4e-23
1frb_A 315 Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 4e-23
3o3r_A 316 Crystal Structure Of Akr1b14 In Complex With Nadp L 4e-23
1z9a_A 321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 9e-23
3h7r_A 331 Crystal Structure Of The Plant Stress-Response Enzy 9e-23
1ye4_A 322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 1e-22
1jez_A 322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 1e-22
1sm9_A 322 Crystal Structure Of An Engineered K274rn276d Doubl 1e-22
1vp5_A 298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 3e-22
1c9w_A 315 Cho Reductase With Nadp+ Length = 315 4e-22
1zua_X 317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 5e-22
3krb_A 334 Structure Of Aldose Reductase From Giardia Lamblia 1e-21
1r38_A 322 Crystal Structure Of H114a Mutant Of Candida Tenuis 1e-21
1zgd_A 312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 9e-21
1mzr_A 296 Structure Of Dkga From E.Coli At 2.13 A Resolution 8e-20
1ihi_A 323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 3e-19
1j96_A 323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 3e-19
1xjb_A 325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 3e-19
1s1p_A 331 Crystal Structures Of Prostaglandin D2 11-Ketoreduc 5e-19
1ry0_A 323 Structure Of Prostaglandin F Synthase With Prostagl 5e-19
3uwe_A 331 Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length 5e-19
3r43_A 331 Akr1c3 Complexed With Mefenamic Acid Length = 331 5e-19
2fvl_A 324 Crystal Structure Of Human 3-alpha Hydroxysteroid/d 8e-19
1mrq_A 323 Crystal Structure Of Human 20alpha-hsd In Ternary C 1e-18
3c3u_A 323 Crystal Structure Of Akr1c1 In Complex With Nadp An 1e-18
3gug_A 323 Crystal Structure Of Akr1c1 L308v Mutant In Complex 1e-18
2ipj_A 321 Crystal Structure Of H3alpha-Hydroxysteroid Dehydro 1e-18
1vbj_A 281 The Crystal Structure Of Prostaglandin F Synthase F 2e-18
1q13_A 323 Crystal Structure Of Rabbit 20alpha Hyroxysteroid D 3e-18
1q5m_A 322 Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh 3e-18
3b3d_A 314 B.Subtilis Ytbe Length = 314 3e-18
1qwk_A 317 Structural Genomics Of Caenorhabditis Elegans: Hypo 9e-18
4f40_A 288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 1e-17
3uzw_A 346 Crystal Structure Of 5beta-Reductase (Akr1d1) E120h 3e-17
1lwi_A 322 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO 6e-17
1afs_A 323 Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr 6e-17
1ral_A 308 Three-Dimensional Structure Of Rat Liver 3alpha- Hy 6e-17
2bgq_A 344 Apo Aldose Reductase From Barley Length = 344 1e-16
3cmf_A 346 Crystal Structure Of Human Liver 5beta-Reductase (A 2e-16
3bur_A 326 Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- 3e-16
3ln3_A 324 Crystal Structure Of Putative Reductase (Np_038806. 3e-16
2he5_A 323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 7e-16
3cv6_A 323 The Crystal Structure Of Mouse 17-Alpha Hydroxyster 7e-16
3fjn_A 323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 7e-16
2ipf_A 318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 7e-16
3d3f_A 275 Crystal Structure Of Yvgn And Cofactor Nadph From B 9e-16
3f7j_A 276 B.Subtilis Yvgn Length = 276 1e-15
4fzi_A 290 Crystal Structure Of Prostaglandin F Synthase From 1e-15
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 1e-15
2ipg_A 319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 1e-15
1m9h_A 278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 2e-13
1a80_A 277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 3e-13
1hw6_A 278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 3e-13
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 3e-12
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 5e-11
>pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (304), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 91/160 (56%), Gaps = 8/160 (5%)
Query: 3   ITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFS 62
           I LNNG KMPI+GLG W+     + + +  AI +GYRHIDCA  Y+NE EVG A+ E   
Sbjct: 5   ILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 64
Query: 63  TGLVKREDLFITTKLWNSDH--GHVLEACKDSXXXXXXXXXXXXXVHFPVATKHTGVGTT 120
             +VKRE+LFI +KLW + H  G V  AC+ +             +H+PV  K    G  
Sbjct: 65  EQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKP---GKE 121
Query: 121 DSALDADG-VLEIDTTISLETTWHAMEDLVSMGLVRSIGI 159
              LD  G V+  DT I    TW AME+LV  GLV++IGI
Sbjct: 122 FFPLDESGNVVPSDTNIL--DTWAAMEELVDEGLVKAIGI 159
>pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 Back     alignment and structure
>pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 Back     alignment and structure
>pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 Back     alignment and structure
>pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 Back     alignment and structure
>pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 Back     alignment and structure
>pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 Back     alignment and structure
>pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 Back     alignment and structure
>pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 Back     alignment and structure
>pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 Back     alignment and structure
>pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 Back     alignment and structure
>pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 Back     alignment and structure
>pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 Back     alignment and structure
>pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 Back     alignment and structure
>pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 Back     alignment and structure
>pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 Back     alignment and structure
>pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 Back     alignment and structure
>pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 Back     alignment and structure
>pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 Back     alignment and structure
>pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 Back     alignment and structure
>pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 Back     alignment and structure
>pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 Back     alignment and structure
>pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 Back     alignment and structure
>pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 Back     alignment and structure
>pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 Back     alignment and structure
>pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 Back     alignment and structure
>pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 Back     alignment and structure
>pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 Back     alignment and structure
>pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3o3r_A 316 Aldo-keto reductase family 1, member B7; aldose re 4e-87
1us0_A 316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 2e-86
1mi3_A 322 Xylose reductase, XR; aldo-keto reductase, beta-al 1e-85
1afs_A 323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 2e-85
3buv_A 326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 6e-85
1s1p_A 331 Aldo-keto reductase family 1 member C3; TIM-barrel 1e-84
2ao0_A 324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 2e-84
3krb_A 334 Aldose reductase; ssgcid, SBRI, emerald biostructu 3e-82
3h7u_A 335 Aldo-keto reductase; stress response, NADP, drough 1e-81
3h7r_A 331 Aldo-keto reductase; stress response, NADP, drough 6e-81
1zgd_A 312 Chalcone reductase; polyketide, deoxychalcone, iso 7e-81
1qwk_A 317 Aldose reductase, aldo-keto reductase family 1 mem 1e-80
2bgs_A 344 Aldose reductase; holoenzyme, aldo/keto reductase, 3e-79
1vp5_A 298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 1e-65
4f40_A 288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 1e-62
1mzr_A 296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 5e-62
1vbj_A 281 Prostaglandin F synthase; TIM barrel, oxidoreducta 1e-61
4gie_A 290 Prostaglandin F synthase; structural genomics, nia 2e-61
2wzm_A 283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 2e-61
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 3e-61
1hw6_A 278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 1e-60
3f7j_A 276 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-60
3up8_A 298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-60
3ln3_A 324 Dihydrodiol dehydrogenase; putative reductase, str 2e-60
3b3e_A 310 YVGN protein; aldo-keto reductase, oxidoreductase; 3e-60
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 1e-22
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 4e-22
1ur3_M 319 Hypothetical oxidoreductase YDHF; NADP binding, al 8e-22
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 2e-21
3erp_A 353 Putative oxidoreductase; funded by the national in 3e-21
1pyf_A 312 IOLS protein; beta-alpha barrel, aldo-keto reducta 6e-21
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 6e-21
1ynp_A 317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 6e-20
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 9e-20
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 6e-18
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 2e-17
1lqa_A 346 TAS protein; TIM barrel, structure 2 function proj 8e-13
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 2e-12
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-06
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
 Score =  257 bits (659), Expect = 4e-87
 Identities = 63/163 (38%), Positives = 95/163 (58%), Gaps = 8/163 (4%)

Query: 1   MA--ITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALA 58
           M   + L    KMP++GLG W+     +++ +  AI  GYRH DCA  Y+NE+EVGEA+ 
Sbjct: 1   MTTFVKLRTKAKMPLVGLGTWKSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQ 60

Query: 59  EAFSTGLVKREDLFITTKLWNSDHG--HVLEACKDSLKKLQLDYLDLYLVHFPVATKHTG 116
           E      V+REDLFI +KLW++      + EA + +L  L+LDYLDLYL+H+P   +   
Sbjct: 61  EKIKEKAVRREDLFIVSKLWSTFFEKSLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQA-- 118

Query: 117 VGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGI 159
            G      D+ G + +  + +    W  ME+LV  GLV+++G+
Sbjct: 119 -GKEFLPKDSQGKVLMSKS-TFLDAWEGMEELVDQGLVKALGV 159
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
3o3r_A 316 Aldo-keto reductase family 1, member B7; aldose re 100.0
3ln3_A 324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
1us0_A 316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
1afs_A 323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
3h7u_A 335 Aldo-keto reductase; stress response, NADP, drough 100.0
4gie_A 290 Prostaglandin F synthase; structural genomics, nia 100.0
1mi3_A 322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
1s1p_A 331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
3buv_A 326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
1qwk_A 317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
4gac_A 324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
1vp5_A 298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
3krb_A 334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
1hw6_A 278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3f7j_A 276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
4f40_A 288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
1zgd_A 312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
3up8_A 298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
2wzm_A 283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
3b3d_A 314 YTBE protein, putative morphine dehydrogenase; ald 100.0
3h7r_A 331 Aldo-keto reductase; stress response, NADP, drough 100.0
1mzr_A 296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
1vbj_A 281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
3b3e_A 310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
1ynp_A 317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
2bgs_A 344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 100.0
1pyf_A 312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 100.0
1ur3_M 319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
3erp_A 353 Putative oxidoreductase; funded by the national in 100.0
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 100.0
1lqa_A 346 TAS protein; TIM barrel, structure 2 function proj 100.0
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 90.98
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-41  Score=279.85  Aligned_cols=179  Identities=36%  Similarity=0.686  Sum_probs=147.8

Q ss_pred             CeeecCCCCcCCccccccccCCchhHHHHHHHHHHhCCceEeCCCCCCCHHHHHHHHHHHhhcCCccccceEEEeccCCC
Q 029874            1 MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNS   80 (186)
Q Consensus         1 ~~~~~~tg~~v~~lglG~~~~~~~~~~~~l~~a~~~Gi~~~Dta~~Yg~e~~vG~~l~~~~~~~~~~R~~~~i~tK~~~~   80 (186)
                      .+++++||.+||+||||||+.+.+++.+++..|+++|||+||||+.||+|..+|++|++.+..+.++|++++|+||+|+.
T Consensus         3 ~~~~l~tg~~v~~lglGt~~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~E~~lG~al~~~~~~~~~~R~~v~I~TK~~~~   82 (316)
T 3o3r_A            3 TFVKLRTKAKMPLVGLGTWKSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWST   82 (316)
T ss_dssp             CEEECTTSCEEESBEEBCTTCCTTHHHHHHHHHHHTTCCEEECCGGGSCHHHHHHHHHHHHHTTSCCGGGCEEEEEECGG
T ss_pred             CeEECCCCCEeCCeeeECCcCCcHHHHHHHHHHHHcCCCEEEccCccCCHHHHHHHHHHHHhhCCCChHHcEEEeeeCCC
Confidence            36789999999999999999999999999999999999999999999999999999999877776799999999999864


Q ss_pred             --ChhHHHHHHHHHHHHhCCCcccEEEEecCCCCCCCCCCCCCCCCCCCCcccccccccHHHHHHHHHHHHHcCCccEEE
Q 029874           81 --DHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIG  158 (186)
Q Consensus        81 --~~~~i~~~~~~sl~~Lg~~~lDl~~lH~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~G~ir~iG  158 (186)
                        +++.+++++++||++||+||||+|++|||+...+   ++...+.++++.. .+...++.++|++|++|+++|+||+||
T Consensus        83 ~~~~~~i~~~~~~SL~rL~~dyiDl~~lH~p~~~~~---~~~~~~~~~~~~~-~~~~~~~~e~~~al~~l~~~Gkir~iG  158 (316)
T 3o3r_A           83 FFEKSLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQA---GKEFLPKDSQGKV-LMSKSTFLDAWEGMEELVDQGLVKALG  158 (316)
T ss_dssp             GCSHHHHHHHHHHHHHHHTCSCEEEEEESCSSCBCC---SSCSSCBCTTSCB-CBCSCCHHHHHHHHHHHHHTTSEEEEE
T ss_pred             cCCHHHHHHHHHHHHHHcCCCeeeEEEEcCCccccC---ccccccccccccc-ccccccHHHHHHHHHHHHHcCCCcEEE
Confidence              7899999999999999999999999999975432   1122222222211 223456899999999999999999999


Q ss_pred             ecCCCchhHhhHHhhccCCCCCccee
Q 029874          159 IRYVGILNPCEHSIRSSKFSTKFIIV  184 (186)
Q Consensus       159 vsn~~~~~l~~~~~~~~~~~~~~~~~  184 (186)
                      ||||+.+++ +.+++...++.+++++
T Consensus       159 vSn~~~~~l-~~~~~~~~~~~~p~~~  183 (316)
T 3o3r_A          159 VSNFNHFQI-ERLLNKPGLKHKPVTN  183 (316)
T ss_dssp             EESCCHHHH-HHHHTCTTCCSCCCEE
T ss_pred             EecCCHHHH-HHHHHhCCCCCCceEe
Confidence            999999994 5555655554344443
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d1us0a_ 314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 7e-35
d1mi3a_ 319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 1e-34
d1afsa_ 319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 2e-33
d1frba_ 315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 2e-32
d1s1pa_ 315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 3e-32
d1hqta_ 324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-30
d1vp5a_ 284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 3e-28
d1qwka_ 312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 1e-27
d1mzra_ 274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 7e-27
d1lqaa_ 346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 3e-18
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 5e-18
d3eaua1 326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 4e-15
d1pz1a_ 333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 4e-13
d1pyfa_ 311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 3e-11
d1ur3m_ 298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 6e-10
d1gvea_ 324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 9e-10
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Aldose reductase (aldehyde reductase)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  122 bits (307), Expect = 7e-35
 Identities = 76/169 (44%), Positives = 101/169 (59%), Gaps = 6/169 (3%)

Query: 3   ITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFS 62
           I LNNG KMPI+GLG W+     + + +  AI +GYRHIDCA  Y+NE EVG A+ E   
Sbjct: 5   ILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 64

Query: 63  TGLVKREDLFITTKLWNS--DHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTT 120
             +VKRE+LFI +KLW +  + G V  AC+ +L  L+LDYLDLYL+H+P   K    G  
Sbjct: 65  EQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKP---GKE 121

Query: 121 DSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGIRYVGILNPCE 169
              LD  G   + +  ++  TW AME+LV  GLV++IGI     L    
Sbjct: 122 FFPLDESGN-VVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEM 169
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d1qwka_ 312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1vp5a_ 284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1mzra_ 274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1afsa_ 319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1s1pa_ 315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1us0a_ 314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1mi3a_ 319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1ur3m_ 298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d1frba_ 315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1hqta_ 324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1pyfa_ 311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1pz1a_ 333 Putative oxidoreductase YhdN {Bacillus subtilis [T 99.98
d1gvea_ 324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 99.97
d1lqaa_ 346 Tas protein {Escherichia coli [TaxId: 562]} 99.97
d3eaua1 326 Voltage-dependent K+ channel beta subunit {Rat (Ra 99.97
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Hypothetical protein C07D8.6
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

Probab=100.00  E-value=6.1e-38  Score=255.77  Aligned_cols=168  Identities=35%  Similarity=0.631  Sum_probs=146.8

Q ss_pred             eeecCCCCcCCccccccccCCchhHHHHHHHHHHhCCceEeCCCCCCCHHHHHHHHHHHhhcCCccccceEEEeccCCC-
Q 029874            2 AITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNS-   80 (186)
Q Consensus         2 ~~~~~tg~~v~~lglG~~~~~~~~~~~~l~~a~~~Gi~~~Dta~~Yg~e~~vG~~l~~~~~~~~~~R~~~~i~tK~~~~-   80 (186)
                      +++++||.+||+||||||+++++++.++|+.|+++|||+||||+.||||..+|++|++......++|.++++.+|.+.. 
T Consensus         3 ~~kL~tG~~vs~lg~Gt~~~~~~~~~~~i~~Al~~Gin~~DTA~~YgsE~~lG~al~~~~~~~~~~r~~~~i~~k~~~~~   82 (312)
T d1qwka_           3 SIKLSNGVEMPVIGLGTWQSSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEEGVVKREELFITTKAWTHE   82 (312)
T ss_dssp             EEECTTSCEEESBCEECTTCCHHHHHHHHHHHHHHTCCEEECCGGGTCHHHHHHHHHHHHHHTSCCGGGCEEEEEECTTT
T ss_pred             cEECCCCCccccceeECCCCCHHHHHHHHHHHHHcCCCEEEChhhhcCHHHHHHHHHHhhhccccccccceeeccccccc
Confidence            7899999999999999999999999999999999999999999999999999999999877777899999999999755 


Q ss_pred             -ChhHHHHHHHHHHHHhCCCcccEEEEecCCCCCCCCCCCCCCCCCCCCcccccccccHHHHHHHHHHHHHcCCccEEEe
Q 029874           81 -DHGHVLEACKDSLKKLQLDYLDLYLVHFPVATKHTGVGTTDSALDADGVLEIDTTISLETTWHAMEDLVSMGLVRSIGI  159 (186)
Q Consensus        81 -~~~~i~~~~~~sl~~Lg~~~lDl~~lH~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~G~ir~iGv  159 (186)
                       +++.+++++++||++||++|+|+|++|+|+......              ......+++++|++|++++++|+||+||+
T Consensus        83 ~~~~~~~~~~~~SL~rL~~d~iDl~~lH~p~~~~~~~--------------~~~~~~~~ee~~~~l~~l~~~G~ir~iG~  148 (312)
T d1qwka_          83 LAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFNDDM--------------SEHIASPVEDVWRQFDAVYKAGLAKAVGV  148 (312)
T ss_dssp             SSTTTHHHHHHHHHHHHTCSCBSEEEESCSCEECTTS--------------CSEECCCHHHHHHHHHHHHHTTSBSSEEE
T ss_pred             ccchhHHHHHHHHhhhcCCCcceeeecccCCcccccc--------------cccccCcHHHHHHHHHHHHhcCccccccc
Confidence             789999999999999999999999999997542200              01223458999999999999999999999


Q ss_pred             cCCCchhHhhHHhhccCCCCCccee
Q 029874          160 RYVGILNPCEHSIRSSKFSTKFIIV  184 (186)
Q Consensus       160 sn~~~~~l~~~~~~~~~~~~~~~~~  184 (186)
                      |||+.++ ++.+++...++.....+
T Consensus       149 Sn~~~~~-l~~~~~~~~~~~~~~~~  172 (312)
T d1qwka_         149 SNWNNDQ-ISRALALGLTPVHNSQV  172 (312)
T ss_dssp             ESCCHHH-HHHHHTTCSSCCCEEEE
T ss_pred             cccchhH-HHHHhhccccchhhhhh
Confidence            9999998 56677777777655443
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure