Citrus Sinensis ID: 029888

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDIDEMRRTSKETARTDMIEDFTAVDEEHSQ
ccccHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccHHHHHHccccccccccccccccHHHccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
cccHHHHHHHHHHHHHHHcHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccEEEEEccccEEEEEcccccccEEEcccccccccccccEcHHHHHHHHHHcccccccccccccHHEEHHHccccHHHHHHHHHHHHcccccccccHHHHHccccccccc
meafgdcthhsaaiqsvgntyqpgteltdfKKLLVDedaksraasssvppndplhkfREAVWNVhhagelmpgeeqeDIVMTSTQSnilniscplsgkpitelaepvrsveckhiYEKNAIQAYIKsknanarcpvagcprklqvsKVVCDSLLLVDIDEMRRTSKETARTDMiedftavdeehsq
meafgdcthhsaaiqsvgntyqpGTELTDFKKLLVDEDAKSraasssvppndplHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAgcprklqvskvvcdslllvdidemrrtsketartdmiedftavdeehsq
MEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDIDEMRRTSKETARTDMIEDFTAVDEEHSQ
********************************************************FREAVWNVHHAGEL********IVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDID***************************
*******THHSAAIQSVGN**Q**TELTDFKKLLV********************KFR**********************MTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLV******************************
********HHSAAIQSVGNTYQPGTELTDFKKLLVDE************PNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDIDEMRRTSKETARTDMIEDFT********
MEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDIDEMRRT**********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDIDEMRRTSKETARTDMIEDFTAVDEEHSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
Q8GYH7249 E3 SUMO-protein ligase MM yes no 0.978 0.730 0.616 2e-60
Q4PIR3250 E3 SUMO-protein ligase ns no no 0.489 0.364 0.315 5e-06
Q91VT1247 E3 SUMO-protein ligase NS yes no 0.747 0.562 0.261 9e-06
Q4V8A0247 E3 SUMO-protein ligase NS yes no 0.817 0.615 0.262 2e-05
Q7ZXH2238 E3 SUMO-protein ligase NS N/A no 0.569 0.445 0.295 2e-05
Q96MF7247 E3 SUMO-protein ligase NS yes no 0.655 0.493 0.263 5e-05
Q32KY9248 E3 SUMO-protein ligase NS yes no 0.827 0.620 0.237 7e-05
>sp|Q8GYH7|NSE2_ARATH E3 SUMO-protein ligase MMS21 OS=Arabidopsis thaliana GN=MMS21 PE=1 SV=1 Back     alignment and function desciption
 Score =  231 bits (590), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 114/185 (61%), Positives = 143/185 (77%), Gaps = 3/185 (1%)

Query: 1   MEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPL-HKFRE 59
           ++   DC H S AIQSV N YQP  +LTDFKKLL DE  K +A  SSVP ND L  +FRE
Sbjct: 66  LDLHSDCNHRSTAIQSVANRYQPVEQLTDFKKLLDDEFTKLKATPSSVPQNDHLMRQFRE 125

Query: 60  AVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKN 119
           AVWNVHHAGE MPG++ EDIVMTSTQ  +LN++CPLSGKP+TELA+PVRS++C+H+YEK+
Sbjct: 126 AVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCPLSGKPVTELADPVRSMDCRHVYEKS 185

Query: 120 AIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDIDEMRRTSKETARTDMIEDFTA 179
            I  YI + N NA CPVAGC  KLQ SKV+CD++L  +I+EMR  +K++ R ++IEDFT 
Sbjct: 186 VILHYIVN-NPNANCPVAGCRGKLQNSKVICDAMLKFEIEEMRSLNKQSNRAEVIEDFTE 244

Query: 180 -VDEE 183
            VDE+
Sbjct: 245 DVDED 249
E3 SUMO-protein ligase that modulates cell cycle progression and functions as a repressor of endocycle onset in meristems. May functions downstream of the meristem patterning transcription factors PLETHORA 1 and 2 (PLT1 and PLT2) in root meristem development. Modulates the expression of the mitotic cyclins CYCB1-1 and CYCB1-2 and cyclin-dependent kinases CDKB1-1 and CDKB2-1 in root meristem. Involved in cytokinin signaling in root development.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q4PIR3|NSE2_SCHPO E3 SUMO-protein ligase nse2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nse2 PE=1 SV=3 Back     alignment and function description
>sp|Q91VT1|NSE2_MOUSE E3 SUMO-protein ligase NSE2 OS=Mus musculus GN=Nsmce2 PE=2 SV=1 Back     alignment and function description
>sp|Q4V8A0|NSE2_RAT E3 SUMO-protein ligase NSE2 OS=Rattus norvegicus GN=Nsmce2 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZXH2|NSE2_XENLA E3 SUMO-protein ligase NSE2 OS=Xenopus laevis GN=nsmce2 PE=2 SV=1 Back     alignment and function description
>sp|Q96MF7|NSE2_HUMAN E3 SUMO-protein ligase NSE2 OS=Homo sapiens GN=NSMCE2 PE=1 SV=2 Back     alignment and function description
>sp|Q32KY9|NSE2_BOVIN E3 SUMO-protein ligase NSE2 OS=Bos taurus GN=NSMCE2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
224115350257 predicted protein [Populus trichocarpa] 0.978 0.708 0.663 8e-66
255564555253 conserved hypothetical protein [Ricinus 0.978 0.719 0.619 3e-63
359493638261 PREDICTED: E3 SUMO-protein ligase MMS21- 0.908 0.647 0.682 8e-63
302142956 449 unnamed protein product [Vitis vinifera] 0.908 0.376 0.682 2e-62
449456611248 PREDICTED: E3 SUMO-protein ligase MMS21- 0.956 0.717 0.615 4e-60
11994504 336 unnamed protein product [Arabidopsis tha 0.978 0.541 0.616 6e-59
30683483249 E3 SUMO-protein ligase MMS21 [Arabidopsi 0.978 0.730 0.616 8e-59
297834382248 hypothetical protein ARALYDRAFT_897788 [ 0.946 0.709 0.608 1e-57
388509446245 unknown [Lotus japonicus] 0.908 0.689 0.545 1e-48
194692406245 unknown [Zea mays] gi|195648671|gb|ACG43 0.967 0.734 0.510 2e-48
>gi|224115350|ref|XP_002317010.1| predicted protein [Populus trichocarpa] gi|222860075|gb|EEE97622.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 142/184 (77%), Gaps = 2/184 (1%)

Query: 1   MEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPL-HKFRE 59
           +  + DCT+ ++AI+SVGNTYQPG ELTDFKKLL DE  K +   SS P N PL  +FRE
Sbjct: 72  LATYEDCTYQTSAIESVGNTYQPGAELTDFKKLLNDEFMKFKGNKSSAPQNHPLLRQFRE 131

Query: 60  AVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKN 119
           AVWNVHH+G+ MPGEE EDIVMTSTQS ILNI+CPLSGKPITELAEPVR V+CKH+YEK 
Sbjct: 132 AVWNVHHSGQPMPGEEHEDIVMTSTQSTILNITCPLSGKPITELAEPVRGVDCKHVYEKK 191

Query: 120 AIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDIDEMRRTSKETARTDMIEDFTA 179
           AI  YI S NA A+CPV GCPR L+  KVV D LLLV+I+EMR  SKE     ++EDFT 
Sbjct: 192 AIMGYI-SLNAQAKCPVTGCPRYLRQDKVVSDPLLLVEIEEMRSMSKENMTATLVEDFTM 250

Query: 180 VDEE 183
            D+E
Sbjct: 251 TDDE 254

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255564555|ref|XP_002523273.1| conserved hypothetical protein [Ricinus communis] gi|223537486|gb|EEF39112.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|359493638|ref|XP_002282690.2| PREDICTED: E3 SUMO-protein ligase MMS21-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142956|emb|CBI20251.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449456611|ref|XP_004146042.1| PREDICTED: E3 SUMO-protein ligase MMS21-like [Cucumis sativus] gi|449510330|ref|XP_004163634.1| PREDICTED: E3 SUMO-protein ligase MMS21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|11994504|dbj|BAB02569.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30683483|ref|NP_188133.2| E3 SUMO-protein ligase MMS21 [Arabidopsis thaliana] gi|75151435|sp|Q8GYH7.1|NSE2_ARATH RecName: Full=E3 SUMO-protein ligase MMS21; AltName: Full=MMS21 homolog; Short=AtMMS21; AltName: Full=Protein HIGH PLOIDY 2 gi|26450312|dbj|BAC42272.1| unknown protein [Arabidopsis thaliana] gi|111074302|gb|ABH04524.1| At3g15150 [Arabidopsis thaliana] gi|332642104|gb|AEE75625.1| E3 SUMO-protein ligase MMS21 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297834382|ref|XP_002885073.1| hypothetical protein ARALYDRAFT_897788 [Arabidopsis lyrata subsp. lyrata] gi|297330913|gb|EFH61332.1| hypothetical protein ARALYDRAFT_897788 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388509446|gb|AFK42789.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|194692406|gb|ACF80287.1| unknown [Zea mays] gi|195648671|gb|ACG43803.1| hypothetical protein [Zea mays] gi|413946512|gb|AFW79161.1| hypothetical protein ZEAMMB73_425303 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
TAIR|locus:2083641249 HPY2 "HIGH PLOIDY2" [Arabidops 0.978 0.730 0.616 1.7e-57
DICTYBASE|DDB_G0289341251 DDB_G0289341 "MIZ-type zinc fi 0.709 0.525 0.326 2.6e-09
ZFIN|ZDB-GENE-081022-128230 zgc:194590 "zgc:194590" [Danio 0.698 0.565 0.284 1.8e-07
FB|FBgn0030657230 cerv "cervantes" [Drosophila m 0.575 0.465 0.305 2.9e-07
UNIPROTKB|F1NF41106 NSMCE2 "Uncharacterized protei 0.462 0.811 0.343 2.9e-07
UNIPROTKB|F1MGQ8176 NSMCE2 "E3 SUMO-protein ligase 0.844 0.892 0.224 3.5e-07
MGI|MGI:1915751247 Nsmce2 "non-SMC element 2 homo 0.827 0.623 0.237 3.7e-07
UNIPROTKB|Q7ZXH2238 nsmce2 "E3 SUMO-protein ligase 0.639 0.5 0.295 4.6e-07
RGD|1305156247 Nsmce2 "non-SMC element 2, MMS 0.833 0.627 0.244 7.4e-07
UNIPROTKB|Q4V8A0247 Nsmce2 "E3 SUMO-protein ligase 0.833 0.627 0.244 7.4e-07
TAIR|locus:2083641 HPY2 "HIGH PLOIDY2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 591 (213.1 bits), Expect = 1.7e-57, P = 1.7e-57
 Identities = 114/185 (61%), Positives = 143/185 (77%)

Query:     1 MEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPL-HKFRE 59
             ++   DC H S AIQSV N YQP  +LTDFKKLL DE  K +A  SSVP ND L  +FRE
Sbjct:    66 LDLHSDCNHRSTAIQSVANRYQPVEQLTDFKKLLDDEFTKLKATPSSVPQNDHLMRQFRE 125

Query:    60 AVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKN 119
             AVWNVHHAGE MPG++ EDIVMTSTQ  +LN++CPLSGKP+TELA+PVRS++C+H+YEK+
Sbjct:   126 AVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCPLSGKPVTELADPVRSMDCRHVYEKS 185

Query:   120 AIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDIDEMRRTSKETARTDMIEDFTA 179
              I  YI + N NA CPVAGC  KLQ SKV+CD++L  +I+EMR  +K++ R ++IEDFT 
Sbjct:   186 VILHYIVN-NPNANCPVAGCRGKLQNSKVICDAMLKFEIEEMRSLNKQSNRAEVIEDFTE 244

Query:   180 -VDEE 183
              VDE+
Sbjct:   245 DVDED 249
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0019789 "SUMO ligase activity" evidence=IDA
GO:0032876 "negative regulation of DNA endoreduplication" evidence=IMP
GO:0048509 "regulation of meristem development" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0008284 "positive regulation of cell proliferation" evidence=IMP
GO:0010082 "regulation of root meristem growth" evidence=IMP
GO:0016925 "protein sumoylation" evidence=IDA
GO:0045931 "positive regulation of mitotic cell cycle" evidence=IMP
GO:0080038 "positive regulation of cytokinin mediated signaling pathway" evidence=IMP
GO:0006974 "response to DNA damage stimulus" evidence=IMP
GO:0060250 "germ-line stem-cell niche homeostasis" evidence=IMP
DICTYBASE|DDB_G0289341 DDB_G0289341 "MIZ-type zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081022-128 zgc:194590 "zgc:194590" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0030657 cerv "cervantes" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NF41 NSMCE2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGQ8 NSMCE2 "E3 SUMO-protein ligase NSE2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915751 Nsmce2 "non-SMC element 2 homolog (MMS21, S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q7ZXH2 nsmce2 "E3 SUMO-protein ligase NSE2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
RGD|1305156 Nsmce2 "non-SMC element 2, MMS21 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4V8A0 Nsmce2 "E3 SUMO-protein ligase NSE2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GYH7NSE2_ARATH6, ., 3, ., 2, ., -0.61620.97840.7309yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
pfam1178957 pfam11789, zf-Nse, Zinc-finger of the MIZ type in 5e-13
COG5627275 COG5627, MMS21, DNA repair protein MMS21 [DNA repl 5e-07
>gnl|CDD|192832 pfam11789, zf-Nse, Zinc-finger of the MIZ type in Nse subunit Back     alignment and domain information 
 Score = 60.7 bits (148), Expect = 5e-13
 Identities = 21/63 (33%), Positives = 39/63 (61%), Gaps = 7/63 (11%)

Query: 77  EDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPV 136
           +++V+       ++++CPL+ +P  E   PV S +C H++EK+AI + ++      +CPV
Sbjct: 1   DELVVEG---GTISLTCPLTLQPFEE---PVTSKKCNHVFEKDAILSMLRRNKT-VKCPV 53

Query: 137 AGC 139
           AGC
Sbjct: 54  AGC 56

Nse1 and Nse2 are novel non-SMC subunits of the fission yeast Smc5-6 DNA repair complex. This family is the zinc-finger domain similar to the MIZ type of zinc-finger. Length = 57
>gnl|CDD|227914 COG5627, MMS21, DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 99.8
KOG2979262 consensus Protein involved in DNA repair [General 99.61
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.55
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.53
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 99.32
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.22
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.17
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.08
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.05
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.99
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.82
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.76
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.76
COG5222427 Uncharacterized conserved protein, contains RING Z 98.76
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.73
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.69
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.65
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.59
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.58
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.48
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.47
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.42
PHA02929238 N1R/p28-like protein; Provisional 98.39
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 98.38
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.37
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.36
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.31
PF1463444 zf-RING_5: zinc-RING finger domain 98.29
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.29
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.1
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.03
KOG2660 331 consensus Locus-specific chromosome binding protei 98.01
PHA02926242 zinc finger-like protein; Provisional 97.96
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.95
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.73
COG5152259 Uncharacterized conserved protein, contains RING a 97.67
KOG2169 636 consensus Zn-finger transcription factor [Transcri 97.65
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.43
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.41
PF04641260 Rtf2: Rtf2 RING-finger 97.37
KOG1002 791 consensus Nucleotide excision repair protein RAD16 97.28
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 97.19
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.13
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.96
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.8
KOG0289 506 consensus mRNA splicing factor [General function p 96.75
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 96.68
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.6
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 96.44
KOG3113293 consensus Uncharacterized conserved protein [Funct 96.39
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.38
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.19
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.17
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 96.16
KOG3039 303 consensus Uncharacterized conserved protein [Funct 95.95
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 95.92
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.92
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 95.74
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 95.47
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.3
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 95.21
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.03
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 94.75
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 94.63
KOG4367 699 consensus Predicted Zn-finger protein [Function un 94.61
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.6
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 94.38
KOG0825 1134 consensus PHD Zn-finger protein [General function 94.29
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 92.72
PF04641 260 Rtf2: Rtf2 RING-finger 92.68
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 92.49
COG5109396 Uncharacterized conserved protein, contains RING Z 92.44
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 92.22
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 91.93
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.89
KOG149384 consensus Anaphase-promoting complex (APC), subuni 91.59
KOG4739 233 consensus Uncharacterized protein involved in syna 90.44
KOG1941518 consensus Acetylcholine receptor-associated protei 90.05
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 89.41
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 88.25
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 87.86
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 87.08
PHA03096284 p28-like protein; Provisional 86.66
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 86.62
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 85.66
COG5175 480 MOT2 Transcriptional repressor [Transcription] 85.21
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 84.21
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 82.71
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 81.97
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 81.48
PHA0062659 hypothetical protein 81.46
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 81.22
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 80.85
COG52191525 Uncharacterized conserved protein, contains RING Z 80.52
PF1266099 zf-TFIIIC: Putative zinc-finger of transcription f 80.3
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 80.27
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information 
Probab=99.80  E-value=1e-20  Score=126.94  Aligned_cols=57  Identities=42%  Similarity=0.964  Sum_probs=38.9

Q ss_pred             cceEEeccCCccceeeccCcCCCCccccCCccccCCCccccHHHHHHHHHhcCCCCCCCCCCCC
Q 029888           77 EDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCP  140 (186)
Q Consensus        77 dDi~i~~~~~~~~~l~CPI~~~~~~~l~dPV~s~~CgH~fck~~I~~~l~~~~~~~~CPv~GC~  140 (186)
                      |||+|++   ++++++||||++   .|++||+|+.|||+|++++|++||+ +++..+||++||+
T Consensus         1 ddi~i~~---~~~~~~CPiT~~---~~~~PV~s~~C~H~fek~aI~~~i~-~~~~~~CPv~GC~   57 (57)
T PF11789_consen    1 DDIVIEG---GTISLKCPITLQ---PFEDPVKSKKCGHTFEKEAILQYIQ-RNGSKRCPVAGCN   57 (57)
T ss_dssp             S-----S---SB--SB-TTTSS---B-SSEEEESSS--EEEHHHHHHHCT-TTS-EE-SCCC-S
T ss_pred             CceEEec---cEeccCCCCcCC---hhhCCcCcCCCCCeecHHHHHHHHH-hcCCCCCCCCCCC
Confidence            6899984   678999999998   6799999999999999999999996 5788999999995

>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2169 consensus Zn-finger transcription factor [Transcription] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12660 zf-TFIIIC: Putative zinc-finger of transcription factor IIIC complex; InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 6e-18
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 7e-15
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 2e-06
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
 Score = 78.1 bits (191), Expect = 6e-18
 Identities = 26/146 (17%), Positives = 66/146 (45%), Gaps = 13/146 (8%)

Query: 37  EDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMP----GEEQEDIVMTSTQSNILNIS 92
            +  +   ++ V   D L   +   +  +    ++P      +++D+ +   +   + ++
Sbjct: 127 LNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGK---IELT 183

Query: 93  CPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCPRKLQVSKVVCDS 152
           CP++ KP      P+ S +C H+++++ IQ Y++       CP A C + + +   V D 
Sbjct: 184 CPITCKPYEA---PLISRKCNHVFDRDGIQNYLQGYT-TRDCPQAACSQVVSMRDFVRDP 239

Query: 153 LL--LVDIDEMRRTSKETARTDMIED 176
           ++     I +M+ + ++  R+    D
Sbjct: 240 IMELRCKIAKMKESQEQDKRSSQAID 265
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.95
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.78
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.7
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.64
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.64
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.61
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.53
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.52
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.51
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.42
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.4
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.38
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.36
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.36
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.29
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.27
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.26
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.26
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.25
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.25
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.25
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.24
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.24
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 99.24
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.23
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.21
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.21
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.21
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.19
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.15
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.13
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.13
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.12
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.11
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.1
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.04
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.03
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 99.01
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.0
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.99
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.91
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.9
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.89
2ect_A78 Ring finger protein 126; metal binding protein, st 98.87
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.83
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.82
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.76
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.74
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.74
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.68
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.67
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.67
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.66
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.66
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.65
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.56
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 98.53
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.47
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.41
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.4
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.37
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.15
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.15
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.12
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.93
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.85
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.84
2ea5_A68 Cell growth regulator with ring finger domain prot 97.67
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.57
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.51
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.21
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.93
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.63
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 95.18
3nw0_A238 Non-structural maintenance of chromosomes element 93.23
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 88.13
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 87.21
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 83.97
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 83.74
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 81.63
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 81.39
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 80.82
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.95  E-value=1.2e-28  Score=208.61  Aligned_cols=151  Identities=14%  Similarity=0.398  Sum_probs=121.5

Q ss_pred             hhhhhHHHHHHHHHHhhccC----CC---------------ChhhHHHHHHHHHhhhhccCCCCCCCChh-hhhHHHHHh
Q 029888            4 FGDCTHHSAAIQSVGNTYQP----GT---------------ELTDFKKLLVDEDAKSRAASSSVPPNDPL-HKFREAVWN   63 (186)
Q Consensus         4 ~~~~~~~~~al~~l~~~y~~----~~---------------~~~~f~~~~~~~~~~~~~~~~~~~~~~~~-~~F~~~i~~   63 (186)
                      -++..++..+|+.+++.|..    -+               ..+++.+++.+..   ..+......+|++ +.||..+|.
T Consensus        77 ~~~~~~~~~~~~~~K~~yk~~~d~~~~~~~~twd~y~~~e~~ap~l~~~~~~~~---~~~~~~~~~~~~~~~~lk~~~~i  153 (267)
T 3htk_C           77 ESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMP---TPEPATMVNNTDTLKILKVLPYI  153 (267)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTSCCCCTTHHHHHHHTSSCCCCHHHHHHTCC---CCSCCSCCCCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccCCCCCHHHHHHHhcCCcCCchHHHHHHhcc---ccCcccccccchHHHHHHHcccc
Confidence            45667788888888877752    12               2457777776432   1223334556888 999999999


Q ss_pred             hcCCCCCCCC----CCCcceEEeccCCccceeeccCcCCCCccccCCccccCCCccccHHHHHHHHHhcCCCCCCCCCCC
Q 029888           64 VHHAGELMPG----EEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGC  139 (186)
Q Consensus        64 ~~~~g~~~~~----d~ddDi~i~~~~~~~~~l~CPI~~~~~~~l~dPV~s~~CgH~fck~~I~~~l~~~~~~~~CPv~GC  139 (186)
                      +++|+.++|+    ++||||+|++   ...+++||||+.   +|++||+++.|||+||+.||..||. .++...||++||
T Consensus       154 ~~~P~~~lPd~~~~~dDDDI~v~~---~~~el~CPIcl~---~f~DPVts~~CGHsFcR~cI~~~~~-~~~~~~CPvtGC  226 (267)
T 3htk_C          154 WNDPTCVIPDLQNPADEDDLQIEG---GKIELTCPITCK---PYEAPLISRKCNHVFDRDGIQNYLQ-GYTTRDCPQAAC  226 (267)
T ss_dssp             HHCTTBCCCCCSSTTCSSCCCCCS---SBCCSBCTTTSS---BCSSEEEESSSCCEEEHHHHHHHST-TCSCEECSGGGC
T ss_pred             ccCCCCCCCCCCCCCCCccceecC---CceeeECcCccC---cccCCeeeCCCCCcccHHHHHHHHH-hCCCCCCCcccc
Confidence            9999999986    5788999984   568999999997   7899999779999999999999998 356678999999


Q ss_pred             CCCccCCCCccCHHHHHHHHHHHhc
Q 029888          140 PRKLQVSKVVCDSLLLVDIDEMRRT  164 (186)
Q Consensus       140 ~~~l~~~~L~~d~~L~~~I~~~r~~  164 (186)
                      ++.+...+|++|..|.++|+.++++
T Consensus       227 r~~l~~~dL~pN~~L~~lve~~k~r  251 (267)
T 3htk_C          227 SQVVSMRDFVRDPIMELRCKIAKMK  251 (267)
T ss_dssp             SCEECGGGEEECHHHHHHHHHHHHH
T ss_pred             cCcCchhhCCcCHHHHHHHHHHHHH
Confidence            9999999999999999999887664
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.67
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.65
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.64
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.56
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.49
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.43
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.37
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.97
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.92
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.85
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.81
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.65
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.44
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.41
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.05
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.0
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 85.98
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 85.06
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 84.2
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 83.67
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 80.35
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.67  E-value=2.1e-17  Score=114.50  Aligned_cols=69  Identities=14%  Similarity=0.180  Sum_probs=62.1

Q ss_pred             eeeccCcCCCCccccCCccccCCCccccHHHHHHHHHhcCCCCCCCCCCCCCCccCCCCccCHHHHHHHHHHHhcCc
Q 029888           90 NISCPLSGKPITELAEPVRSVECKHIYEKNAIQAYIKSKNANARCPVAGCPRKLQVSKVVCDSLLLVDIDEMRRTSK  166 (186)
Q Consensus        90 ~l~CPI~~~~~~~l~dPV~s~~CgH~fck~~I~~~l~~~~~~~~CPv~GC~~~l~~~~L~~d~~L~~~I~~~r~~~~  166 (186)
                      .|.||||+.   +|++||+ +.|||+||+.||.+|+..  +...||+  |+..++..+|.+|..|+..|+++++.++
T Consensus         7 ~l~CpIc~~---l~~dPv~-~~cGhtfc~~ci~~~l~~--~~~~cP~--c~~~l~~~~l~pN~~L~~~I~~~l~~~~   75 (80)
T d2c2la2           7 YLCGKISFE---LMREPCI-TPSGITYDRKDIEEHLQR--VGHFNPV--TRSPLTQEQLIPNLAMKEVIDAFISENG   75 (80)
T ss_dssp             TTBCTTTCS---BCSSEEE-CSSCCEEETTHHHHHHHH--TCSSCTT--TCCCCCGGGCEECHHHHHHHHHHHTTCS
T ss_pred             cccCcCcCc---hhhhhcc-cCCcCeecHHHHHHHHhc--CCccCCC--ccccccccccccHHHHHHHHHHHHHHCC
Confidence            589999997   8999998 899999999999999984  3467999  9899999999999999999999987644
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure