Citrus Sinensis ID: 029935
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| 224119184 | 306 | predicted protein [Populus trichocarpa] | 1.0 | 0.604 | 0.951 | 1e-100 | |
| 255540839 | 306 | protein phsophatase-2a, putative [Ricinu | 1.0 | 0.604 | 0.956 | 1e-100 | |
| 359488758 | 306 | PREDICTED: serine/threonine-protein phos | 1.0 | 0.604 | 0.951 | 1e-100 | |
| 224133358 | 306 | predicted protein [Populus trichocarpa] | 1.0 | 0.604 | 0.945 | 1e-100 | |
| 356500864 | 306 | PREDICTED: serine/threonine-protein phos | 1.0 | 0.604 | 0.945 | 1e-100 | |
| 449458049 | 306 | PREDICTED: serine/threonine-protein phos | 1.0 | 0.604 | 0.951 | 1e-100 | |
| 225456598 | 306 | PREDICTED: serine/threonine-protein phos | 1.0 | 0.604 | 0.929 | 2e-99 | |
| 356498091 | 306 | PREDICTED: serine/threonine-protein phos | 1.0 | 0.604 | 0.935 | 3e-99 | |
| 7248359 | 306 | type 2A protein phosphatase-1 [Vicia fab | 1.0 | 0.604 | 0.935 | 4e-99 | |
| 449434857 | 306 | PREDICTED: serine/threonine-protein phos | 1.0 | 0.604 | 0.935 | 9e-99 |
| >gi|224119184|ref|XP_002318007.1| predicted protein [Populus trichocarpa] gi|222858680|gb|EEE96227.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 370 bits (950), Expect = e-100, Method: Compositional matrix adjust.
Identities = 176/185 (95%), Positives = 179/185 (96%)
Query: 1 MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFH 60
MPS DLDRQIEHLMQCKPL E EV LCEQARA+LVEEWNVQPVKCPVTVCGDIHGQFH
Sbjct: 1 MPSHVDLDRQIEHLMQCKPLAEAEVKALCEQARAVLVEEWNVQPVKCPVTVCGDIHGQFH 60
Query: 61 DLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI 120
DLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI
Sbjct: 61 DLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI 120
Query: 121 TQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRAL 180
TQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQ+FCLHGGLSPSLDTLDNIR+L
Sbjct: 121 TQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQIFCLHGGLSPSLDTLDNIRSL 180
Query: 181 DRIQE 185
DRIQE
Sbjct: 181 DRIQE 185
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255540839|ref|XP_002511484.1| protein phsophatase-2a, putative [Ricinus communis] gi|223550599|gb|EEF52086.1| protein phsophatase-2a, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359488758|ref|XP_003633814.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Vitis vinifera] gi|296087750|emb|CBI35006.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224133358|ref|XP_002321547.1| predicted protein [Populus trichocarpa] gi|222868543|gb|EEF05674.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356500864|ref|XP_003519250.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449458049|ref|XP_004146760.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225456598|ref|XP_002267386.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Vitis vinifera] gi|147784485|emb|CAN74947.1| hypothetical protein VITISV_000262 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356498091|ref|XP_003517887.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|7248359|dbj|BAA92697.1| type 2A protein phosphatase-1 [Vicia faba] | Back alignment and taxonomy information |
|---|
| >gi|449434857|ref|XP_004135212.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Cucumis sativus] gi|449478494|ref|XP_004155333.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| TAIR|locus:2194626 | 306 | PP2A-2 "protein phosphatase 2A | 1.0 | 0.604 | 0.908 | 3.5e-91 | |
| TAIR|locus:2025976 | 306 | PP2A-1 "AT1G59830" [Arabidopsi | 1.0 | 0.604 | 0.902 | 1.2e-90 | |
| TAIR|locus:2020598 | 307 | PP2A "AT1G69960" [Arabidopsis | 0.994 | 0.599 | 0.880 | 1.6e-88 | |
| TAIR|locus:2076451 | 313 | PP2A-4 "protein phosphatase 2A | 1.0 | 0.591 | 0.807 | 1.5e-81 | |
| TAIR|locus:2041579 | 313 | PP2A-3 "AT2G42500" [Arabidopsi | 1.0 | 0.591 | 0.807 | 2.5e-81 | |
| ASPGD|ASPL0000005337 | 329 | pphA [Emericella nidulans (tax | 0.967 | 0.544 | 0.843 | 5.2e-81 | |
| UNIPROTKB|Q6P365 | 309 | ppp2ca "Serine/threonine-prote | 0.972 | 0.582 | 0.816 | 6.6e-81 | |
| ZFIN|ZDB-GENE-050417-441 | 309 | ppp2ca "protein phosphatase 2 | 0.972 | 0.582 | 0.816 | 6.6e-81 | |
| DICTYBASE|DDB_G0290263 | 306 | pho2a "protein phosphatase 2A | 0.972 | 0.588 | 0.827 | 8.5e-81 | |
| UNIPROTKB|P67774 | 309 | PPP2CA "Serine/threonine-prote | 0.972 | 0.582 | 0.816 | 8.5e-81 |
| TAIR|locus:2194626 PP2A-2 "protein phosphatase 2A-2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 909 (325.0 bits), Expect = 3.5e-91, P = 3.5e-91
Identities = 168/185 (90%), Positives = 178/185 (96%)
Query: 1 MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFH 60
MPS DLDRQIE LM+CKPL E +V LC+QARAILVEE+NVQPVKCPVTVCGDIHGQF+
Sbjct: 1 MPSNGDLDRQIEQLMECKPLSEADVRTLCDQARAILVEEYNVQPVKCPVTVCGDIHGQFY 60
Query: 61 DLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI 120
DL+ELFRIGGNAPDTNYLFMGDYVDRGYYSVETV+LLVALKVRYRDR+TILRGNHESRQI
Sbjct: 61 DLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQI 120
Query: 121 TQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRAL 180
TQVYGFYDECLRKYGNANVWK+FTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIR+L
Sbjct: 121 TQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSL 180
Query: 181 DRIQE 185
DRIQE
Sbjct: 181 DRIQE 185
|
|
| TAIR|locus:2025976 PP2A-1 "AT1G59830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020598 PP2A "AT1G69960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2076451 PP2A-4 "protein phosphatase 2A-4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2041579 PP2A-3 "AT2G42500" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000005337 pphA [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6P365 ppp2ca "Serine/threonine-protein phosphatase" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050417-441 ppp2ca "protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0290263 pho2a "protein phosphatase 2A subunit C" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67774 PPP2CA "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 185 | |||
| cd07415 | 285 | cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos | 1e-134 | |
| PTZ00239 | 303 | PTZ00239, PTZ00239, serine/threonine protein phosp | 6e-94 | |
| smart00156 | 271 | smart00156, PP2Ac, Protein phosphatase 2A homologu | 6e-82 | |
| cd07414 | 293 | cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li | 8e-70 | |
| cd07416 | 305 | cd07416, MPP_PP2B, PP2B, metallophosphatase domain | 5e-68 | |
| PTZ00480 | 320 | PTZ00480, PTZ00480, serine/threonine-protein phosp | 6e-58 | |
| cd07419 | 311 | cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho | 4e-53 | |
| cd07417 | 316 | cd07417, MPP_PP5_C, PP5, C-terminal metallophospha | 9e-52 | |
| PTZ00244 | 294 | PTZ00244, PTZ00244, serine/threonine-protein phosp | 5e-47 | |
| cd00144 | 225 | cd00144, MPP_PPP_family, phosphoprotein phosphatas | 7e-46 | |
| cd07418 | 377 | cd07418, MPP_PP7, PP7, metallophosphatase domain | 5e-37 | |
| cd07420 | 321 | cd07420, MPP_RdgC, Drosophila melanogaster RdgC an | 3e-30 | |
| pfam00149 | 185 | pfam00149, Metallophos, Calcineurin-like phosphoes | 3e-30 | |
| COG0639 | 155 | COG0639, ApaH, Diadenosine tetraphosphatase and re | 3e-12 | |
| cd07425 | 208 | cd07425, MPP_Shelphs, Shewanella-like phosphatases | 5e-06 | |
| cd07413 | 222 | cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 | 1e-05 | |
| cd00838 | 131 | cd00838, MPP_superfamily, metallophosphatase super | 6e-05 | |
| cd07421 | 304 | cd07421, MPP_Rhilphs, Rhilph phosphatases, metallo | 8e-05 | |
| PHA02239 | 235 | PHA02239, PHA02239, putative protein phosphatase | 2e-04 | |
| cd07424 | 207 | cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos | 0.001 | |
| cd07422 | 257 | cd07422, MPP_ApaH, Escherichia coli ApaH and relat | 0.001 |
| >gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
Score = 376 bits (968), Expect = e-134
Identities = 140/180 (77%), Positives = 161/180 (89%)
Query: 6 DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVEL 65
DLD+ IE L +C+ LPE EV LCE+A+ ILV+E NVQ V+ PVTVCGDIHGQF+DL+EL
Sbjct: 1 DLDKWIEQLKKCELLPESEVKSLCEKAKEILVKESNVQRVRSPVTVCGDIHGQFYDLLEL 60
Query: 66 FRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYG 125
FR+GG+ PDTNYLF+GDYVDRGYYSVET LL+ALKVRY DRIT+LRGNHESRQITQVYG
Sbjct: 61 FRVGGDPPDTNYLFLGDYVDRGYYSVETFLLLLALKVRYPDRITLLRGNHESRQITQVYG 120
Query: 126 FYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQE 185
FYDECLRKYGNANVWK+ TDLFDYLPL ALI++Q+FC+HGGLSPS+DTLD IRA+DR QE
Sbjct: 121 FYDECLRKYGNANVWKYCTDLFDYLPLAALIDNQIFCVHGGLSPSIDTLDQIRAIDRFQE 180
|
PP2A-like family of phosphoprotein phosphatases (PPP's) including PP4 and PP6. PP2A (Protein phosphatase 2A) is a critical regulator of many cellular activities. PP2A comprises about 1% of total cellular proteins. PP2A, together with protein phosphatase 1 (PP1), accounts for more than 90% of all serine/threonine phosphatase activities in most cells and tissues. The PP2A subunit in addition to having a catalytic domain homologous to PP1, has a unique C-terminal tail, containing a motif that is conserved in the catalytic subunits of all PP2A-like phosphatases including PP4 and PP6, and has an important role in PP2A regulation. The PP2A-like family of phosphatases all share a similar heterotrimeric architecture, that includes: a 65kDa scaffolding subunit (A), a 36kDa catalytic subunit (C), and one of 18 regulatory subunits (B). The PPP (phosphoprotein phosphatase) family, to which PP2A belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 285 |
| >gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase | Back alignment and domain information |
|---|
| >gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163656 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163664 cd07421, MPP_Rhilphs, Rhilph phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|107154 PHA02239, PHA02239, putative protein phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163665 cd07422, MPP_ApaH, Escherichia coli ApaH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| KOG0372 | 303 | consensus Serine/threonine specific protein phosph | 100.0 | |
| cd07420 | 321 | MPP_RdgC Drosophila melanogaster RdgC and related | 100.0 | |
| KOG0373 | 306 | consensus Serine/threonine specific protein phosph | 100.0 | |
| cd07415 | 285 | MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein | 100.0 | |
| PTZ00239 | 303 | serine/threonine protein phosphatase 2A; Provision | 100.0 | |
| cd07416 | 305 | MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca | 100.0 | |
| PTZ00480 | 320 | serine/threonine-protein phosphatase; Provisional | 100.0 | |
| cd07414 | 293 | MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme | 100.0 | |
| PTZ00244 | 294 | serine/threonine-protein phosphatase PP1; Provisio | 100.0 | |
| smart00156 | 271 | PP2Ac Protein phosphatase 2A homologues, catalytic | 100.0 | |
| KOG0374 | 331 | consensus Serine/threonine specific protein phosph | 100.0 | |
| cd07417 | 316 | MPP_PP5_C PP5, C-terminal metallophosphatase domai | 100.0 | |
| cd07418 | 377 | MPP_PP7 PP7, metallophosphatase domain. PP7 is a p | 100.0 | |
| cd07419 | 311 | MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a | 100.0 | |
| KOG0371 | 319 | consensus Serine/threonine protein phosphatase 2A, | 100.0 | |
| KOG0375 | 517 | consensus Serine-threonine phosphatase 2B, catalyt | 100.0 | |
| TIGR00668 | 279 | apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric | 99.96 | |
| PRK13625 | 245 | bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision | 99.96 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 99.96 | |
| cd07422 | 257 | MPP_ApaH Escherichia coli ApaH and related protein | 99.96 | |
| PRK00166 | 275 | apaH diadenosine tetraphosphatase; Reviewed | 99.95 | |
| cd07423 | 234 | MPP_PrpE Bacillus subtilis PrpE and related protei | 99.95 | |
| cd07413 | 222 | MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat | 99.95 | |
| cd07421 | 304 | MPP_Rhilphs Rhilph phosphatases, metallophosphatas | 99.95 | |
| cd00144 | 225 | MPP_PPP_family phosphoprotein phosphatases of the | 99.94 | |
| PHA02239 | 235 | putative protein phosphatase | 99.94 | |
| PRK11439 | 218 | pphA serine/threonine protein phosphatase 1; Provi | 99.94 | |
| cd07425 | 208 | MPP_Shelphs Shewanella-like phosphatases, metallop | 99.92 | |
| cd07424 | 207 | MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do | 99.91 | |
| PRK09968 | 218 | serine/threonine-specific protein phosphatase 2; P | 99.9 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 99.83 | |
| PRK09453 | 182 | phosphodiesterase; Provisional | 99.45 | |
| PF00149 | 200 | Metallophos: Calcineurin-like phosphoesterase; Int | 99.44 | |
| TIGR00040 | 158 | yfcE phosphoesterase, MJ0936 family. Members of th | 99.39 | |
| cd00841 | 155 | MPP_YfcE Escherichia coli YfcE and related protein | 99.38 | |
| PF12850 | 156 | Metallophos_2: Calcineurin-like phosphoesterase su | 99.29 | |
| cd07397 | 238 | MPP_DevT Myxococcus xanthus DevT and related prote | 99.25 | |
| cd07388 | 224 | MPP_Tt1561 Thermus thermophilus Tt1561 and related | 99.25 | |
| cd07379 | 135 | MPP_239FB Homo sapiens 239FB and related proteins, | 99.03 | |
| cd07392 | 188 | MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel | 98.99 | |
| cd07394 | 178 | MPP_Vps29 Homo sapiens Vps29 and related proteins, | 98.99 | |
| PRK11340 | 271 | phosphodiesterase YaeI; Provisional | 98.93 | |
| cd00838 | 131 | MPP_superfamily metallophosphatase superfamily, me | 98.91 | |
| cd07385 | 223 | MPP_YkuE_C Bacillus subtilis YkuE and related prot | 98.9 | |
| PRK05340 | 241 | UDP-2,3-diacylglucosamine hydrolase; Provisional | 98.81 | |
| cd07404 | 166 | MPP_MS158 Microscilla MS158 and related proteins, | 98.81 | |
| TIGR03729 | 239 | acc_ester putative phosphoesterase. Members of thi | 98.76 | |
| TIGR00619 | 253 | sbcd exonuclease SbcD. This family is based on the | 98.69 | |
| cd07396 | 267 | MPP_Nbla03831 Homo sapiens Nbla03831 and related p | 98.65 | |
| cd07391 | 172 | MPP_PF1019 Pyrococcus furiosus PF1019 and related | 98.63 | |
| PHA02546 | 340 | 47 endonuclease subunit; Provisional | 98.6 | |
| PRK04036 | 504 | DNA polymerase II small subunit; Validated | 98.58 | |
| cd07402 | 240 | MPP_GpdQ Enterobacter aerogenes GpdQ and related p | 98.54 | |
| PRK11148 | 275 | cyclic 3',5'-adenosine monophosphate phosphodieste | 98.49 | |
| TIGR01854 | 231 | lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. | 98.49 | |
| cd00840 | 223 | MPP_Mre11_N Mre11 nuclease, N-terminal metallophos | 98.48 | |
| cd07403 | 129 | MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel | 98.46 | |
| cd07390 | 168 | MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro | 98.44 | |
| cd07400 | 144 | MPP_YydB Bacillus subtilis YydB and related protei | 98.43 | |
| COG0622 | 172 | Predicted phosphoesterase [General function predic | 98.42 | |
| TIGR00583 | 405 | mre11 DNA repair protein (mre11). All proteins in | 98.42 | |
| cd00844 | 262 | MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t | 98.41 | |
| TIGR00024 | 225 | SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 | 98.36 | |
| cd07383 | 199 | MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase | 98.35 | |
| COG1409 | 301 | Icc Predicted phosphohydrolases [General function | 98.35 | |
| PRK10966 | 407 | exonuclease subunit SbcD; Provisional | 98.33 | |
| cd08165 | 156 | MPP_MPPE1 human MPPE1 and related proteins, metall | 98.32 | |
| cd07393 | 232 | MPP_DR1119 Deinococcus radiodurans DR1119 and rela | 98.29 | |
| cd07399 | 214 | MPP_YvnB Bacillus subtilis YvnB and related protei | 98.28 | |
| COG2129 | 226 | Predicted phosphoesterases, related to the Icc pro | 98.24 | |
| COG1408 | 284 | Predicted phosphohydrolases [General function pred | 98.15 | |
| COG2908 | 237 | Uncharacterized protein conserved in bacteria [Fun | 98.13 | |
| cd07401 | 256 | MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal | 98.13 | |
| cd07395 | 262 | MPP_CSTP1 Homo sapiens CSTP1 and related proteins, | 98.12 | |
| cd07398 | 217 | MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat | 98.07 | |
| cd07386 | 243 | MPP_DNA_pol_II_small_archeal_C archeal DNA polymer | 98.06 | |
| cd00839 | 294 | MPP_PAPs purple acid phosphatases of the metalloph | 98.03 | |
| COG0420 | 390 | SbcD DNA repair exonuclease [DNA replication, reco | 97.99 | |
| PF14582 | 255 | Metallophos_3: Metallophosphoesterase, calcineurin | 97.97 | |
| COG4186 | 186 | Predicted phosphoesterase or phosphohydrolase [Gen | 97.94 | |
| cd08166 | 195 | MPP_Cdc1_like_1 uncharacterized subgroup related t | 97.85 | |
| cd00845 | 252 | MPP_UshA_N_like Escherichia coli UshA-like family, | 97.77 | |
| cd07384 | 171 | MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re | 97.76 | |
| cd07380 | 150 | MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re | 97.64 | |
| COG1407 | 235 | Predicted ICC-like phosphoesterases [General funct | 97.53 | |
| cd07410 | 277 | MPP_CpdB_N Escherichia coli CpdB and related prote | 97.51 | |
| PLN02533 | 427 | probable purple acid phosphatase | 97.45 | |
| cd08164 | 193 | MPP_Ted1 Saccharomyces cerevisiae Ted1 and related | 97.31 | |
| COG1768 | 230 | Predicted phosphohydrolase [General function predi | 97.26 | |
| cd07378 | 277 | MPP_ACP5 Homo sapiens acid phosphatase 5 and relat | 97.22 | |
| cd08163 | 257 | MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related | 97.18 | |
| cd07408 | 257 | MPP_SA0022_N Staphylococcus aureus SA0022 and rela | 97.15 | |
| KOG1432 | 379 | consensus Predicted DNA repair exonuclease SIA1 [G | 97.13 | |
| cd07412 | 288 | MPP_YhcR_N Bacillus subtilis YhcR endonuclease and | 97.0 | |
| PF06874 | 640 | FBPase_2: Firmicute fructose-1,6-bisphosphatase; I | 96.83 | |
| KOG3662 | 410 | consensus Cell division control protein/predicted | 96.77 | |
| cd07411 | 264 | MPP_SoxB_N Thermus thermophilus SoxB and related p | 96.7 | |
| cd07409 | 281 | MPP_CD73_N CD73 ecto-5'-nucleotidase and related p | 96.54 | |
| cd07406 | 257 | MPP_CG11883_N Drosophila melanogaster CG11883 and | 96.43 | |
| cd00842 | 296 | MPP_ASMase acid sphingomyelinase and related prote | 96.41 | |
| TIGR00282 | 266 | metallophosphoesterase, MG_246/BB_0505 family. A m | 96.36 | |
| PF08321 | 95 | PPP5: PPP5 TPR repeat region; InterPro: IPR013235 | 96.21 | |
| PRK09419 | 1163 | bifunctional 2',3'-cyclic nucleotide 2'-phosphodie | 96.02 | |
| cd07405 | 285 | MPP_UshA_N Escherichia coli UshA and related prote | 95.79 | |
| cd07382 | 255 | MPP_DR1281 Deinococcus radiodurans DR1281 and rela | 94.93 | |
| KOG2310 | 646 | consensus DNA repair exonuclease MRE11 [Replicatio | 94.9 | |
| cd08162 | 313 | MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA | 94.85 | |
| KOG2863 | 456 | consensus RNA lariat debranching enzyme [RNA proce | 94.71 | |
| PF04042 | 209 | DNA_pol_E_B: DNA polymerase alpha/epsilon subunit | 94.52 | |
| COG0737 | 517 | UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras | 94.51 | |
| COG3855 | 648 | Fbp Uncharacterized protein conserved in bacteria | 94.42 | |
| PRK09419 | 1163 | bifunctional 2',3'-cyclic nucleotide 2'-phosphodie | 94.0 | |
| cd07407 | 282 | MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and | 93.88 | |
| KOG2476 | 528 | consensus Uncharacterized conserved protein [Funct | 93.83 | |
| PRK09420 | 649 | cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp | 93.82 | |
| TIGR01390 | 626 | CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod | 93.8 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 93.37 | |
| PTZ00422 | 394 | glideosome-associated protein 50; Provisional | 93.29 | |
| KOG1378 | 452 | consensus Purple acid phosphatase [Carbohydrate tr | 93.19 | |
| COG1311 | 481 | HYS2 Archaeal DNA polymerase II, small subunit/DNA | 93.17 | |
| KOG2679 | 336 | consensus Purple (tartrate-resistant) acid phospha | 92.66 | |
| PRK11907 | 814 | bifunctional 2',3'-cyclic nucleotide 2'-phosphodie | 92.33 | |
| KOG3325 | 183 | consensus Membrane coat complex Retromer, subunit | 92.19 | |
| COG0639 | 155 | ApaH Diadenosine tetraphosphatase and related seri | 91.93 | |
| cd07387 | 257 | MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 | 91.81 | |
| PRK09558 | 551 | ushA bifunctional UDP-sugar hydrolase/5'-nucleotid | 91.63 | |
| TIGR01530 | 550 | nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi | 91.5 | |
| PTZ00235 | 291 | DNA polymerase epsilon subunit B; Provisional | 91.41 | |
| KOG3947 | 305 | consensus Phosphoesterases [General function predi | 90.95 | |
| PRK09418 | 780 | bifunctional 2',3'-cyclic nucleotide 2'-phosphodie | 89.87 | |
| KOG3339 | 211 | consensus Predicted glycosyltransferase [General f | 85.21 | |
| PF06874 | 640 | FBPase_2: Firmicute fructose-1,6-bisphosphatase; I | 83.19 |
| >KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-47 Score=298.95 Aligned_cols=180 Identities=72% Similarity=1.250 Sum_probs=176.2
Q ss_pred HHHHHHHHHHcCCCCCHHHHHHHHHHHHHhhcccCcceecCCCEEEEeCCCCCHHHHHHHHHhcCCCCCCeEEEeccccC
Q 029935 6 DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVD 85 (185)
Q Consensus 6 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~~~~~~~i~vigDIHG~~~~l~~ll~~~~~~~~~~lv~lGD~vd 85 (185)
.+++.++++.+++.+++.|+..||.++.++|.+|+++..++.|+.|+|||||++.+|..+++.-+..+...++|||||||
T Consensus 2 dldr~ie~L~~~~li~E~eV~~LC~~~~eiL~~E~NV~~i~tPvtvcGDIHGQf~Dllelf~igG~~~~t~YLFLGDyVD 81 (303)
T KOG0372|consen 2 DLDRQIEQLRRCELIAESEVKALCAKVREILVEESNVQRIDTPVTVCGDIHGQFYDLLELFRIGGDVPETNYLFLGDYVD 81 (303)
T ss_pred cHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhcCCCceecCCCcEEeecccchHHHHHHHHHhCCCCCCCceEeecchhc
Confidence 37899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCcHHHHHHHHHHHHhCCCcEEEEcCCCchhhhhhhhCCHHHHHHHhCCHHHHHHHHHHhhcCCceEEEcCcEEEEec
Q 029935 86 RGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHG 165 (185)
Q Consensus 86 rG~~~~e~l~~l~~l~~~~p~~v~~l~GNHE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~~i~~~~l~vHa 165 (185)
||..|+|++-+|..+|.+||+++++||||||...+.+.|||+.||.++||+...|+...+.|+.||+++++++++|||||
T Consensus 82 RG~~SvEt~lLLl~lK~rYP~ritLiRGNHEsRqitqvYGFY~EclrKYG~~~vWr~c~eiFdyL~l~aiid~kifCVHG 161 (303)
T KOG0372|consen 82 RGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSANVWRYCTEIFDYLSLAAIIDGKIFCVHG 161 (303)
T ss_pred cccchHHHHHHHHHHhhcCcceeEEeeccchhhhhhhhhhHHHHHHHHcCChHHHHHHHHHHHhhhHhheecCcEEEEcC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCHHHhhccccCCC
Q 029935 166 GLSPSLDTLDNIRALDRIQE 185 (185)
Q Consensus 166 Gi~p~~~~~~~i~~i~R~~~ 185 (185)
|++|+++.++||+.+.|.++
T Consensus 162 GlSP~i~~lDqIr~lDR~~E 181 (303)
T KOG0372|consen 162 GLSPSIQTLDQIRVLDRKQE 181 (303)
T ss_pred CCCcchhhHHHHHHhhcccc
Confidence 99999999999999999875
|
|
| >cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >PTZ00239 serine/threonine protein phosphatase 2A; Provisional | Back alignment and domain information |
|---|
| >cd07416 MPP_PP2B PP2B, metallophosphatase domain | Back alignment and domain information |
|---|
| >PTZ00480 serine/threonine-protein phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PTZ00244 serine/threonine-protein phosphatase PP1; Provisional | Back alignment and domain information |
|---|
| >smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain | Back alignment and domain information |
|---|
| >KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07418 MPP_PP7 PP7, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0371 consensus Serine/threonine protein phosphatase 2A, catalytic subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0375 consensus Serine-threonine phosphatase 2B, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) | Back alignment and domain information |
|---|
| >PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK00166 apaH diadenosine tetraphosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >PHA02239 putative protein phosphatase | Back alignment and domain information |
|---|
| >PRK11439 pphA serine/threonine protein phosphatase 1; Provisional | Back alignment and domain information |
|---|
| >cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK09968 serine/threonine-specific protein phosphatase 2; Provisional | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09453 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 | Back alignment and domain information |
|---|
| >TIGR00040 yfcE phosphoesterase, MJ0936 family | Back alignment and domain information |
|---|
| >cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] | Back alignment and domain information |
|---|
| >cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK11340 phosphodiesterase YaeI; Provisional | Back alignment and domain information |
|---|
| >cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR03729 acc_ester putative phosphoesterase | Back alignment and domain information |
|---|
| >TIGR00619 sbcd exonuclease SbcD | Back alignment and domain information |
|---|
| >cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PHA02546 47 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04036 DNA polymerase II small subunit; Validated | Back alignment and domain information |
|---|
| >cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase | Back alignment and domain information |
|---|
| >cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG0622 Predicted phosphoesterase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00583 mre11 DNA repair protein (mre11) | Back alignment and domain information |
|---|
| >cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related | Back alignment and domain information |
|---|
| >cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG1409 Icc Predicted phosphohydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10966 exonuclease subunit SbcD; Provisional | Back alignment and domain information |
|---|
| >cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1408 Predicted phosphohydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >COG2908 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A | Back alignment and domain information |
|---|
| >COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >COG1407 Predicted ICC-like phosphoesterases [General function prediction only] | Back alignment and domain information |
|---|
| >cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG1768 Predicted phosphohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] | Back alignment and domain information |
|---|
| >cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] | Back alignment and domain information |
|---|
| >KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR00282 metallophosphoesterase, MG_246/BB_0505 family | Back alignment and domain information |
|---|
| >PF08321 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 This domain is specific to the PPP5 subfamily of serine/threonine phosphatases | Back alignment and domain information |
|---|
| >PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed | Back alignment and domain information |
|---|
| >cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd08162 MPP_PhoA_N Synechococcus sp | Back alignment and domain information |
|---|
| >KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast | Back alignment and domain information |
|---|
| >COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG3855 Fbp Uncharacterized protein conserved in bacteria [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed | Back alignment and domain information |
|---|
| >cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG2476 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00422 glideosome-associated protein 50; Provisional | Back alignment and domain information |
|---|
| >KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed | Back alignment and domain information |
|---|
| >KOG3325 consensus Membrane coat complex Retromer, subunit VPS29/PEP11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain | Back alignment and domain information |
|---|
| >PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed | Back alignment and domain information |
|---|
| >TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN | Back alignment and domain information |
|---|
| >PTZ00235 DNA polymerase epsilon subunit B; Provisional | Back alignment and domain information |
|---|
| >KOG3947 consensus Phosphoesterases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed | Back alignment and domain information |
|---|
| >KOG3339 consensus Predicted glycosyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 185 | ||||
| 3p71_C | 304 | Crystal Structure Of The Complex Of Lcmt-1 And Pp2a | 1e-86 | ||
| 2nyl_C | 293 | Crystal Structure Of Protein Phosphatase 2a (Pp2a) | 1e-86 | ||
| 2ie4_C | 309 | Structure Of The Protein Phosphatase 2a Core Enzyme | 2e-86 | ||
| 2ie3_C | 309 | Structure Of The Protein Phosphatase 2a Core Enzyme | 2e-86 | ||
| 3c5w_C | 310 | Complex Between Pp2a-Specific Methylesterase Pme-1 | 2e-86 | ||
| 2iae_C | 309 | Crystal Structure Of A Protein Phosphatase 2a (Pp2a | 4e-86 | ||
| 3fga_C | 309 | Structural Basis Of Pp2a And Sgo Interaction Length | 5e-86 | ||
| 2o8a_A | 329 | Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng | 7e-46 | ||
| 1jk7_A | 323 | Crystal Structure Of The Tumor-Promoter Okadaic Aci | 7e-46 | ||
| 1fjm_A | 330 | Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor | 7e-46 | ||
| 4g9j_A | 331 | Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P | 8e-46 | ||
| 3v4y_A | 306 | Crystal Structure Of The First Nuclear Pp1 Holoenzy | 9e-46 | ||
| 3egg_A | 329 | Crystal Structure Of A Complex Between Protein Phos | 9e-46 | ||
| 3n5u_B | 300 | Crystal Structure Of An Rb C-Terminal Peptide Bound | 9e-46 | ||
| 1u32_A | 293 | Crystal Structure Of A Protein Phosphatase-1: Calci | 1e-45 | ||
| 3e7a_A | 299 | Crystal Structure Of Protein Phosphatase-1 Bound To | 1e-45 | ||
| 1s70_A | 330 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 3e-45 | ||
| 1aui_A | 521 | Human Calcineurin Heterodimer Length = 521 | 5e-44 | ||
| 2p6b_A | 383 | Crystal Structure Of Human Calcineurin In Complex W | 1e-43 | ||
| 1mf8_A | 373 | Crystal Structure Of Human Calcineurin Complexed Wi | 1e-43 | ||
| 3ll8_A | 357 | Crystal Structure Of Calcineurin In Complex With Ak | 1e-43 | ||
| 1m63_A | 372 | Crystal Structure Of Calcineurin-Cyclophilin-Cyclos | 1e-43 | ||
| 1tco_A | 375 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 1e-43 | ||
| 2jog_A | 327 | Structure Of The Calcineurin-Nfat Complex Length = | 2e-43 | ||
| 1wao_1 | 477 | Pp5 Structure Length = 477 | 1e-29 | ||
| 1s95_A | 333 | Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 | 1e-29 | ||
| 3h60_A | 315 | Catalytic Domain Of Human SerineTHREONINE PHOSPHATA | 2e-29 | ||
| 3icf_A | 335 | Structure Of Protein SerineTHREONINE PHOSPHATASE FR | 8e-27 |
| >pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 | Back alignment and structure |
|
| >pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 | Back alignment and structure |
| >pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 | Back alignment and structure |
| >pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 | Back alignment and structure |
| >pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 | Back alignment and structure |
| >pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 | Back alignment and structure |
| >pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 | Back alignment and structure |
| >pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 | Back alignment and structure |
| >pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 | Back alignment and structure |
| >pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 | Back alignment and structure |
| >pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 | Back alignment and structure |
| >pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 | Back alignment and structure |
| >pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 | Back alignment and structure |
| >pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 | Back alignment and structure |
| >pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 | Back alignment and structure |
| >pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 | Back alignment and structure |
| >pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 | Back alignment and structure |
| >pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 | Back alignment and structure |
| >pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 | Back alignment and structure |
| >pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 | Back alignment and structure |
| >pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 | Back alignment and structure |
| >pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 | Back alignment and structure |
| >pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 | Back alignment and structure |
| >pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 | Back alignment and structure |
| >pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 | Back alignment and structure |
| >pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 | Back alignment and structure |
| >pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 185 | |||
| 2ie4_C | 309 | PP2A-alpha;, serine/threonine-protein phosphatase | 1e-128 | |
| 3ll8_A | 357 | Serine/threonine-protein phosphatase 2B catalytic | 1e-126 | |
| 1fjm_A | 330 | Protein serine/threonine phosphatase-1 (alpha ISO | 1e-121 | |
| 3e7a_A | 299 | PP-1A, serine/threonine-protein phosphatase PP1-al | 1e-120 | |
| 3h63_A | 315 | Serine/threonine-protein phosphatase 5; metalloenz | 1e-119 | |
| 1aui_A | 521 | Calcineurin, serine/threonine phosphatase 2B; hydr | 1e-119 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 1e-116 | |
| 3icf_A | 335 | PPT, serine/threonine-protein phosphatase T; IRO m | 1e-116 | |
| 2z72_A | 342 | Protein-tyrosine-phosphatase; cold-active enzyme, | 7e-19 | |
| 1g5b_A | 221 | Serine/threonine protein phosphatase; bacteriophag | 3e-11 | |
| 2dfj_A | 280 | Diadenosinetetraphosphatase; helices and strands m | 3e-11 | |
| 2qjc_A | 262 | Diadenosine tetraphosphatase, putative; putative d | 2e-10 | |
| 1nnw_A | 252 | Hypothetical protein; structural genomics, PSI, pr | 7e-05 | |
| 3qfm_A | 270 | SAPH, putative uncharacterized protein; sandwich f | 3e-04 | |
| 3rqz_A | 246 | Metallophosphoesterase; PSI-biology, midwest cente | 5e-04 |
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 | Back alignment and structure |
|---|
Score = 360 bits (927), Expect = e-128
Identities = 147/184 (79%), Positives = 166/184 (90%)
Query: 2 PSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHD 61
+LD+ IE L +CK L E +V LCE+A+ IL +E NVQ V+CPVTVCGD+HGQFHD
Sbjct: 5 VFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHD 64
Query: 62 LVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQIT 121
L+ELFRIGG +PDTNYLFMGDYVDRGYYSVETVTLLVALKVRYR+RITILRGNHESRQIT
Sbjct: 65 LMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQIT 124
Query: 122 QVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALD 181
QVYGFYDECLRKYGNANVWK+FTDLFDYLPLTAL++ Q+FCLHGGLSPS+DTLD+IRALD
Sbjct: 125 QVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALD 184
Query: 182 RIQE 185
R+QE
Sbjct: 185 RLQE 188
|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 | Back alignment and structure |
|---|
| >1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 | Back alignment and structure |
|---|
| >3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 | Back alignment and structure |
|---|
| >3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 | Back alignment and structure |
|---|
| >2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 | Back alignment and structure |
|---|
| >1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 | Back alignment and structure |
|---|
| >2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 | Back alignment and structure |
|---|
| >2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 | Back alignment and structure |
|---|
| >1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Length = 252 | Back alignment and structure |
|---|
| >3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270 | Back alignment and structure |
|---|
| >3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} Length = 246 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| 3e7a_A | 299 | PP-1A, serine/threonine-protein phosphatase PP1-al | 100.0 | |
| 2ie4_C | 309 | PP2A-alpha;, serine/threonine-protein phosphatase | 100.0 | |
| 3ll8_A | 357 | Serine/threonine-protein phosphatase 2B catalytic | 100.0 | |
| 1fjm_A | 330 | Protein serine/threonine phosphatase-1 (alpha ISO | 100.0 | |
| 3h63_A | 315 | Serine/threonine-protein phosphatase 5; metalloenz | 100.0 | |
| 3icf_A | 335 | PPT, serine/threonine-protein phosphatase T; IRO m | 100.0 | |
| 1aui_A | 521 | Calcineurin, serine/threonine phosphatase 2B; hydr | 100.0 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 100.0 | |
| 2z72_A | 342 | Protein-tyrosine-phosphatase; cold-active enzyme, | 99.95 | |
| 2dfj_A | 280 | Diadenosinetetraphosphatase; helices and strands m | 99.95 | |
| 2qjc_A | 262 | Diadenosine tetraphosphatase, putative; putative d | 99.92 | |
| 1g5b_A | 221 | Serine/threonine protein phosphatase; bacteriophag | 99.87 | |
| 3rqz_A | 246 | Metallophosphoesterase; PSI-biology, midwest cente | 99.78 | |
| 1nnw_A | 252 | Hypothetical protein; structural genomics, PSI, pr | 99.78 | |
| 3qfm_A | 270 | SAPH, putative uncharacterized protein; sandwich f | 99.77 | |
| 1su1_A | 208 | Hypothetical protein YFCE; structural genomics, ph | 99.48 | |
| 2kkn_A | 178 | Uncharacterized protein; protein phosphatase 2A ho | 99.32 | |
| 1uf3_A | 228 | Hypothetical protein TT1561; metallo-dependent pho | 99.3 | |
| 2a22_A | 215 | Vacuolar protein sorting 29; alpha-beta-BETA-alpha | 99.24 | |
| 1s3l_A | 190 | Hypothetical protein MJ0936; phosphodiesterase, nu | 99.2 | |
| 1z2w_A | 192 | Vacuolar protein sorting 29; VPS29, retromer, phos | 99.18 | |
| 2yvt_A | 260 | Hypothetical protein AQ_1956; structural genomics, | 99.17 | |
| 3ck2_A | 176 | Conserved uncharacterized protein (predicted phosp | 99.12 | |
| 1xm7_A | 195 | Hypothetical protein AQ_1665; structural genomics, | 99.05 | |
| 3d03_A | 274 | Phosphohydrolase; glycerophosphodiesterase, metall | 98.89 | |
| 3ib7_A | 330 | ICC protein; metallophosphoesterase, alpha-beta fo | 98.87 | |
| 2q8u_A | 336 | Exonuclease, putative; structural genomics, joint | 98.82 | |
| 3av0_A | 386 | DNA double-strand break repair protein MRE11; DNA | 98.79 | |
| 1ii7_A | 333 | MRE11 nuclease; RAD50, DNA double-strand break rep | 98.74 | |
| 3rl5_A | 296 | Metallophosphoesterase mpped2; alpha-beta fold, me | 98.74 | |
| 2nxf_A | 322 | Putative dimetal phosphatase; dinuclear metal cent | 98.72 | |
| 2xmo_A | 443 | LMO2642 protein; phosphodiesterase, hydrolase; 1.7 | 98.55 | |
| 3tho_B | 379 | Exonuclease, putative; adenosine triphosphate, bac | 98.48 | |
| 3t1i_A | 431 | Double-strand break repair protein MRE11A; DNA rep | 98.35 | |
| 4fbk_A | 472 | DNA repair and telomere maintenance protein NBS1, | 98.33 | |
| 4fbw_A | 417 | DNA repair protein RAD32; DNA double-strand break | 98.32 | |
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 97.9 | |
| 1ute_A | 313 | Protein (II purple acid phosphatase); tartrate res | 97.9 | |
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 97.76 | |
| 3tgh_A | 342 | Glideosome-associated protein 50; phosphatase fold | 97.33 | |
| 1hp1_A | 516 | 5'-nucleotidase; metallophosphatase, dinuclear, me | 97.13 | |
| 3qfk_A | 527 | Uncharacterized protein; structural genomics, cent | 97.05 | |
| 1t71_A | 281 | Phosphatase, conserved HYPO; crystal, X-RAY crysta | 96.99 | |
| 2z1a_A | 552 | 5'-nucleotidase; metal-binding, nucleotide-binding | 96.85 | |
| 4h2g_A | 546 | 5'-nucleotidase; dimer, hydrolase, phosphatase, ex | 96.63 | |
| 2z06_A | 252 | Putative uncharacterized protein TTHA0625; metal b | 96.61 | |
| 3ztv_A | 579 | NAD nucleotidase, NADN; hydrolase, NAD pyrophospha | 96.49 | |
| 3ive_A | 509 | Nucleotidase; structural genomics, PSI-2, protein | 96.42 | |
| 1t70_A | 255 | Phosphatase; crystal, X-RAY crystallography, struc | 96.36 | |
| 3jyf_A | 339 | 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n | 95.87 | |
| 3gve_A | 341 | YFKN protein; alpha-beta-BETA-alpha sandwich, stru | 95.81 | |
| 3c9f_A | 557 | 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p | 95.64 | |
| 4h1s_A | 530 | 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo | 94.19 | |
| 2wdc_A | 562 | SOXB, sulfur oxidation protein SOXB; sulfur-sulfur | 93.39 | |
| 2yeq_A | 527 | Apased, PHOD, alkaline phosphatase D; hydrolase, p | 93.39 | |
| 3e0j_A | 476 | DNA polymerase subunit delta-2; DNA polymerase del | 86.77 |
| >3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.8e-45 Score=298.86 Aligned_cols=179 Identities=46% Similarity=0.959 Sum_probs=171.1
Q ss_pred HHHHHHHHHHcCC--------CCCHHHHHHHHHHHHHhhcccCcceecCCCEEEEeCCCCCHHHHHHHHHhcCCCCCCeE
Q 029935 6 DLDRQIEHLMQCK--------PLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNY 77 (185)
Q Consensus 6 ~~~~~~~~~~~~~--------~~~~~~~~~l~~~~~~~l~~~~~~~~~~~~i~vigDIHG~~~~l~~ll~~~~~~~~~~l 77 (185)
.++++++++++.. +++++++..||++|+++|.++|++++.++|++|||||||++++|.++++..+..+.+.+
T Consensus 7 ~~d~~i~~l~~~~~~~~~~~~~l~~~~~~~l~~~~~~il~~ep~ll~~~~~i~viGDIHG~~~~L~~ll~~~g~~~~~~~ 86 (299)
T 3e7a_A 7 NLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNY 86 (299)
T ss_dssp CHHHHHHHHHTTTTSCTTCCCCCCHHHHHHHHHHHHHHHHHSCSEEEECSSEEEECBCTTCHHHHHHHHHHHCSTTSSCE
T ss_pred CHHHHHHHHHhccccCCCcccCCCHHHHHHHHHHHHHHHHhCCCeeecCCCEEEEecCCCCHHHHHHHHHHhCCCCCccE
Confidence 3889999987654 79999999999999999999999999999999999999999999999999999999999
Q ss_pred EEeccccCCCCCcHHHHHHHHHHHHhCCCcEEEEcCCCchhhhhhhhCCHHHHHHHhCCHHHHHHHHHHhhcCCceEEEc
Q 029935 78 LFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIE 157 (185)
Q Consensus 78 v~lGD~vdrG~~~~e~l~~l~~l~~~~p~~v~~l~GNHE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~~i~ 157 (185)
||||||||||++|.|++.++.+++..+|.++++||||||.+.++..++|..++.++| ...+|+.+.++|++||+++.++
T Consensus 87 vfLGD~VDrG~~s~evl~lL~~lk~~~p~~v~~lrGNHE~~~i~~~ygF~~e~~~ky-~~~l~~~~~~~f~~LPlaaii~ 165 (299)
T 3e7a_A 87 LFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIVD 165 (299)
T ss_dssp EECSCCSSSSSCHHHHHHHHHHHHHHSTTTEEECCCTTSSHHHHHHHSHHHHHHHHS-CHHHHHHHHHHHTTCCCEEEET
T ss_pred EeCCcccCCCCCcHHHHHHHHHHHhhCCCcEEEEecCchhhhhcccccchHHHHHHh-hHHHHHHHHHHHhhCCceEEEC
Confidence 999999999999999999999999999999999999999999999999999999999 6789999999999999999999
Q ss_pred CcEEEEecCCCCCCCCHHHhhccccCCC
Q 029935 158 SQVFCLHGGLSPSLDTLDNIRALDRIQE 185 (185)
Q Consensus 158 ~~~l~vHaGi~p~~~~~~~i~~i~R~~~ 185 (185)
++++|||||++|++.++++|++|+||++
T Consensus 166 ~~il~vHGGlsp~~~~l~~i~~i~R~~~ 193 (299)
T 3e7a_A 166 EKIFCCHGGLSPDLQSMEQIRRIMRPTD 193 (299)
T ss_dssp TTEEEESSCCCTTCCCTHHHHTCCSSCC
T ss_pred CeEEEEcCccCcccCCHHHHHhccCCCc
Confidence 9999999999999999999999999974
|
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* | Back alignment and structure |
|---|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A | Back alignment and structure |
|---|
| >1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A | Back alignment and structure |
|---|
| >3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A | Back alignment and structure |
|---|
| >2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 | Back alignment and structure |
|---|
| >1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A | Back alignment and structure |
|---|
| >3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* | Back alignment and structure |
|---|
| >1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A | Back alignment and structure |
|---|
| >1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A | Back alignment and structure |
|---|
| >2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 | Back alignment and structure |
|---|
| >3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A | Back alignment and structure |
|---|
| >3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A | Back alignment and structure |
|---|
| >2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A | Back alignment and structure |
|---|
| >3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* | Back alignment and structure |
|---|
| >1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A | Back alignment and structure |
|---|
| >3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* | Back alignment and structure |
|---|
| >2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 | Back alignment and structure |
|---|
| >2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C | Back alignment and structure |
|---|
| >3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* | Back alignment and structure |
|---|
| >4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* | Back alignment and structure |
|---|
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* | Back alignment and structure |
|---|
| >1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* | Back alignment and structure |
|---|
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 | Back alignment and structure |
|---|
| >3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A | Back alignment and structure |
|---|
| >3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 | Back alignment and structure |
|---|
| >2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 | Back alignment and structure |
|---|
| >4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* | Back alignment and structure |
|---|
| >2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A | Back alignment and structure |
|---|
| >3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* | Back alignment and structure |
|---|
| >3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* | Back alignment and structure |
|---|
| >1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 | Back alignment and structure |
|---|
| >3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 | Back alignment and structure |
|---|
| >4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A | Back alignment and structure |
|---|
| >2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 185 | ||||
| d3c5wc1 | 288 | d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt | 1e-78 | |
| d1auia_ | 473 | d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc | 1e-71 | |
| d1jk7a_ | 294 | d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human | 3e-65 | |
| d1s95a_ | 324 | d.159.1.3 (A:) Serine/threonine protein phosphatas | 9e-65 | |
| d1g5ba_ | 219 | d.159.1.3 (A:) lambda ser/thr protein phosphatase | 3e-12 | |
| d1nnwa_ | 251 | d.159.1.5 (A:) Hypothetical protein PF1291 {Archae | 1e-10 | |
| d1su1a_ | 184 | d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia | 2e-06 |
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-dependent phosphatases superfamily: Metallo-dependent phosphatases family: Protein serine/threonine phosphatase domain: Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha species: Human (Homo sapiens) [TaxId: 9606]
Score = 234 bits (597), Expect = 1e-78
Identities = 147/180 (81%), Positives = 166/180 (92%)
Query: 6 DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVEL 65
+LD+ IE L +CK L E +V LCE+A+ IL +E NVQ V+CPVTVCGD+HGQFHDL+EL
Sbjct: 4 ELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMEL 63
Query: 66 FRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYG 125
FRIGG +PDTNYLFMGDYVDRGYYSVETVTLLVALKVRYR+RITILRGNHESRQITQVYG
Sbjct: 64 FRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYG 123
Query: 126 FYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQE 185
FYDECLRKYGNANVWK+FTDLFDYLPLTAL++ Q+FCLHGGLSPS+DTLD+IRALDR+QE
Sbjct: 124 FYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQE 183
|
| >d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 | Back information, alignment and structure |
|---|
| >d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 | Back information, alignment and structure |
|---|
| >d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 | Back information, alignment and structure |
|---|
| >d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 | Back information, alignment and structure |
|---|
| >d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| d3c5wc1 | 288 | Protein phosphatase 2A catalytic subunit alpha iso | 100.0 | |
| d1jk7a_ | 294 | Protein phosphatase-1 (PP-1) {Human (Homo sapiens) | 100.0 | |
| d1auia_ | 473 | Protein phosphatase-2B (PP-2B, calcineurin A subun | 100.0 | |
| d1s95a_ | 324 | Serine/threonine protein phosphatase 5, PP5 {Human | 100.0 | |
| d1g5ba_ | 219 | lambda ser/thr protein phosphatase {Bacteriophage | 99.92 | |
| d1nnwa_ | 251 | Hypothetical protein PF1291 {Archaeon Pyrococcus f | 99.86 | |
| d1uf3a_ | 228 | Hypothetical protein TT1561 {Thermus thermophilus | 99.61 | |
| d1su1a_ | 184 | Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 | 99.47 | |
| d1s3la_ | 165 | Putative phosphodiesterase MJ0936 {Methanococcus j | 99.44 | |
| d1z2wa1 | 182 | Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus | 99.23 | |
| d2a22a1 | 193 | Vacuolar protein sorting 29, VPS29 {Cryptosporidiu | 99.15 | |
| d3ck2a1 | 173 | Uncharacterized protein SP1879 {Streptococcus pneu | 99.12 | |
| d2yvta1 | 257 | Uncharacterized protein Aq_1956 {Aquifex aeolicus | 99.11 | |
| d1ii7a_ | 333 | Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 98.69 | |
| d3d03a1 | 271 | Glycerophosphodiesterase GpdQ {Enterobacter aeroge | 98.59 | |
| d2hy1a1 | 256 | Rv0805 cyclic nucleotide phosphodiesterase {Mycoba | 98.53 | |
| d1xm7a_ | 188 | Hypothetical protein aq_1666 {Aquifex aeolicus [Ta | 98.42 | |
| d2nxfa1 | 320 | Uncharacterized C17orf48 homolog zgc:64213 {Zebraf | 98.25 | |
| d2qfra2 | 312 | Plant purple acid phosphatase, catalytic domain {K | 97.54 | |
| d1utea_ | 302 | Mammalian purple acid phosphatase {Pig (Sus scrofa | 97.39 | |
| d2z1aa2 | 302 | 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term | 95.71 | |
| d1usha2 | 337 | 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term | 95.23 | |
| d3c9fa2 | 322 | 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term | 91.71 | |
| d1gg4a1 | 135 | UDP-murNac-tripeptide D-alanyl-D-alanine-adding en | 88.19 |
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-dependent phosphatases superfamily: Metallo-dependent phosphatases family: Protein serine/threonine phosphatase domain: Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.1e-46 Score=305.28 Aligned_cols=181 Identities=81% Similarity=1.368 Sum_probs=176.0
Q ss_pred hHHHHHHHHHHcCCCCCHHHHHHHHHHHHHhhcccCcceecCCCEEEEeCCCCCHHHHHHHHHhcCCCCCCeEEEecccc
Q 029935 5 ADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYV 84 (185)
Q Consensus 5 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~~~~~~~i~vigDIHG~~~~l~~ll~~~~~~~~~~lv~lGD~v 84 (185)
-+++++++++++++++|++++.+||++|+++|++||+++.++.+++|||||||++++|.++++..+.++..++|||||||
T Consensus 3 ~~~d~~i~~~~~~~~l~~~~i~~L~~~a~~il~~e~~l~~i~~pv~VvGDlHG~~~DL~~if~~~g~p~~~~ylFLGDYV 82 (288)
T d3c5wc1 3 KELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYV 82 (288)
T ss_dssp HHHHHHHHHHTTTCCCCHHHHHHHHHHHHHHHHTSCSEEEECSSEEEECBCTTCHHHHHHHHHHHCCTTTSCEEECSCCC
T ss_pred hHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHhCCCEEEeCCCeEEEeeCCCCHHHHHHHHHhcCCCccceEEecCccc
Confidence 36899999999999999999999999999999999999999999999999999999999999999998889999999999
Q ss_pred CCCCCcHHHHHHHHHHHHhCCCcEEEEcCCCchhhhhhhhCCHHHHHHHhCCHHHHHHHHHHhhcCCceEEEcCcEEEEe
Q 029935 85 DRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLH 164 (185)
Q Consensus 85 drG~~~~e~l~~l~~l~~~~p~~v~~l~GNHE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~~i~~~~l~vH 164 (185)
|||+.|.||+.++..+|..+|++++++|||||...++..++|..++..+|+...+|+.+.++|++||+++.++++++|||
T Consensus 83 DRG~~slEvl~lL~alKi~~P~~v~lLRGNHE~~~~~~~~gF~~E~~~ky~~~~i~~~~~~~F~~LPlaaiI~~~i~cvH 162 (288)
T d3c5wc1 83 DRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLH 162 (288)
T ss_dssp CSSSSHHHHHHHHHHHHHHCTTTEEECCCTTSSHHHHHHHSHHHHHHHHHSSSHHHHHHHHHHTTSCSEEEETTTEEEES
T ss_pred CCCCcceeHHHHHHHHHhhCCCeEEEeccCCcccccccccCcchhhhhhcCcHHHHHHHHHHHhhccceEEecCeEEEec
Confidence 99999999999999999999999999999999999999999999999999988999999999999999999999999999
Q ss_pred cCCCCCCCCHHHhhccccCCC
Q 029935 165 GGLSPSLDTLDNIRALDRIQE 185 (185)
Q Consensus 165 aGi~p~~~~~~~i~~i~R~~~ 185 (185)
||++|....+++|+.|.|+.+
T Consensus 163 GGi~~~~~~~~~i~~i~r~~~ 183 (288)
T d3c5wc1 163 GGLSPSIDTLDHIRALDRLQE 183 (288)
T ss_dssp SCCCTTCSSHHHHHHSCCSSS
T ss_pred ccccCCccchhhHhhcccccC
Confidence 999999999999999999863
|
| >d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} | Back information, alignment and structure |
|---|
| >d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1gg4a1 c.59.1.1 (A:313-447) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|