Citrus Sinensis ID: 029935

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQE
ccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccEEEEcccccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHcccEEEEccccccccccHHHHHHHccccc
cccHccHHHHHHHHHccccEcHHHHHHHHHHHHHHHHHcccEEEEcccEEEEccccccHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHHHHHHccccEEEcccccccHHHHHHccHHHHHHHHcccHHHHHHHHHHHcccccEEEEcccEEEEccccccccccHHHHHHcccccc
MPSQADLDRQIEHlmqckplpeqeVNILCEQARAILVEEwnvqpvkcpvtvcgdihgQFHDLVELFRiggnapdtnylfmgdyvdrgyYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFclhgglspsldtldNIRALDRIQE
MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRItilrgnhesrqitQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGlspsldtldnirALDRIQE
MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQE
**************MQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNI********
***QADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQ*
MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQE
****ADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
P48579 305 Serine/threonine-protein N/A no 0.994 0.603 0.940 1e-100
Q9ZSE4 306 Serine/threonine-protein N/A no 1.0 0.604 0.929 1e-100
Q07098 306 Serine/threonine-protein yes no 1.0 0.604 0.908 2e-97
Q07099 306 Serine/threonine-protein yes no 1.0 0.604 0.902 1e-96
Q0DBD3 306 Serine/threonine-protein yes no 1.0 0.604 0.891 4e-95
A2YEB4 306 Serine/threonine-protein N/A no 1.0 0.604 0.891 4e-95
O04951 307 Serine/threonine-protein no no 0.994 0.599 0.880 8e-95
Q0E2S4 307 Serine/threonine-protein yes no 1.0 0.602 0.887 2e-93
A2X2G3 307 Serine/threonine-protein N/A no 1.0 0.602 0.887 2e-93
Q9XGH7 312 Serine/threonine-protein N/A no 0.989 0.586 0.830 8e-88
>sp|P48579|PP2A_HELAN Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1 Back     alignment and function desciption
 Score =  363 bits (931), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 180/185 (97%), Gaps = 1/185 (0%)

Query: 1   MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFH 60
           MPSQ+DLDRQIEHLM CKPLPE EV  LC+QAR ILVEEWNVQPVKCPVTVCGDIHGQFH
Sbjct: 1   MPSQSDLDRQIEHLMDCKPLPE-EVRTLCDQARTILVEEWNVQPVKCPVTVCGDIHGQFH 59

Query: 61  DLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI 120
           DL+ELFRIGG+APDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI
Sbjct: 60  DLLELFRIGGSAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI 119

Query: 121 TQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRAL 180
           TQVYGF+DECLRKYGNANVWKHFTDLFDYLPLTALIESQ+FCLHGGLSPSLDTLDNIRAL
Sbjct: 120 TQVYGFFDECLRKYGNANVWKHFTDLFDYLPLTALIESQIFCLHGGLSPSLDTLDNIRAL 179

Query: 181 DRIQE 185
           DRIQE
Sbjct: 180 DRIQE 184

Helianthus annuus (taxid: 4232)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q9ZSE4|PP2A_HEVBR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1 Back     alignment and function description
>sp|Q07098|PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1 Back     alignment and function description
>sp|Q07099|PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=2 SV=1 Back     alignment and function description
>sp|Q0DBD3|PP2A1_ORYSJ Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1 Back     alignment and function description
>sp|A2YEB4|PP2A1_ORYSI Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1 Back     alignment and function description
>sp|O04951|PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1 Back     alignment and function description
>sp|Q0E2S4|PP2A3_ORYSJ Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1 Back     alignment and function description
>sp|A2X2G3|PP2A3_ORYSI Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2 Back     alignment and function description
>sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
224119184 306 predicted protein [Populus trichocarpa] 1.0 0.604 0.951 1e-100
255540839 306 protein phsophatase-2a, putative [Ricinu 1.0 0.604 0.956 1e-100
359488758 306 PREDICTED: serine/threonine-protein phos 1.0 0.604 0.951 1e-100
224133358 306 predicted protein [Populus trichocarpa] 1.0 0.604 0.945 1e-100
356500864 306 PREDICTED: serine/threonine-protein phos 1.0 0.604 0.945 1e-100
449458049 306 PREDICTED: serine/threonine-protein phos 1.0 0.604 0.951 1e-100
225456598 306 PREDICTED: serine/threonine-protein phos 1.0 0.604 0.929 2e-99
356498091 306 PREDICTED: serine/threonine-protein phos 1.0 0.604 0.935 3e-99
7248359 306 type 2A protein phosphatase-1 [Vicia fab 1.0 0.604 0.935 4e-99
449434857 306 PREDICTED: serine/threonine-protein phos 1.0 0.604 0.935 9e-99
>gi|224119184|ref|XP_002318007.1| predicted protein [Populus trichocarpa] gi|222858680|gb|EEE96227.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/185 (95%), Positives = 179/185 (96%)

Query: 1   MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFH 60
           MPS  DLDRQIEHLMQCKPL E EV  LCEQARA+LVEEWNVQPVKCPVTVCGDIHGQFH
Sbjct: 1   MPSHVDLDRQIEHLMQCKPLAEAEVKALCEQARAVLVEEWNVQPVKCPVTVCGDIHGQFH 60

Query: 61  DLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI 120
           DLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI
Sbjct: 61  DLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI 120

Query: 121 TQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRAL 180
           TQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQ+FCLHGGLSPSLDTLDNIR+L
Sbjct: 121 TQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQIFCLHGGLSPSLDTLDNIRSL 180

Query: 181 DRIQE 185
           DRIQE
Sbjct: 181 DRIQE 185

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255540839|ref|XP_002511484.1| protein phsophatase-2a, putative [Ricinus communis] gi|223550599|gb|EEF52086.1| protein phsophatase-2a, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359488758|ref|XP_003633814.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Vitis vinifera] gi|296087750|emb|CBI35006.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224133358|ref|XP_002321547.1| predicted protein [Populus trichocarpa] gi|222868543|gb|EEF05674.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356500864|ref|XP_003519250.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|449458049|ref|XP_004146760.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225456598|ref|XP_002267386.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Vitis vinifera] gi|147784485|emb|CAN74947.1| hypothetical protein VITISV_000262 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356498091|ref|XP_003517887.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|7248359|dbj|BAA92697.1| type 2A protein phosphatase-1 [Vicia faba] Back     alignment and taxonomy information
>gi|449434857|ref|XP_004135212.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Cucumis sativus] gi|449478494|ref|XP_004155333.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
TAIR|locus:2194626 306 PP2A-2 "protein phosphatase 2A 1.0 0.604 0.908 3.5e-91
TAIR|locus:2025976 306 PP2A-1 "AT1G59830" [Arabidopsi 1.0 0.604 0.902 1.2e-90
TAIR|locus:2020598 307 PP2A "AT1G69960" [Arabidopsis 0.994 0.599 0.880 1.6e-88
TAIR|locus:2076451 313 PP2A-4 "protein phosphatase 2A 1.0 0.591 0.807 1.5e-81
TAIR|locus:2041579 313 PP2A-3 "AT2G42500" [Arabidopsi 1.0 0.591 0.807 2.5e-81
ASPGD|ASPL0000005337 329 pphA [Emericella nidulans (tax 0.967 0.544 0.843 5.2e-81
UNIPROTKB|Q6P365 309 ppp2ca "Serine/threonine-prote 0.972 0.582 0.816 6.6e-81
ZFIN|ZDB-GENE-050417-441 309 ppp2ca "protein phosphatase 2 0.972 0.582 0.816 6.6e-81
DICTYBASE|DDB_G0290263 306 pho2a "protein phosphatase 2A 0.972 0.588 0.827 8.5e-81
UNIPROTKB|P67774 309 PPP2CA "Serine/threonine-prote 0.972 0.582 0.816 8.5e-81
TAIR|locus:2194626 PP2A-2 "protein phosphatase 2A-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 909 (325.0 bits), Expect = 3.5e-91, P = 3.5e-91
 Identities = 168/185 (90%), Positives = 178/185 (96%)

Query:     1 MPSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFH 60
             MPS  DLDRQIE LM+CKPL E +V  LC+QARAILVEE+NVQPVKCPVTVCGDIHGQF+
Sbjct:     1 MPSNGDLDRQIEQLMECKPLSEADVRTLCDQARAILVEEYNVQPVKCPVTVCGDIHGQFY 60

Query:    61 DLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQI 120
             DL+ELFRIGGNAPDTNYLFMGDYVDRGYYSVETV+LLVALKVRYRDR+TILRGNHESRQI
Sbjct:    61 DLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQI 120

Query:   121 TQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRAL 180
             TQVYGFYDECLRKYGNANVWK+FTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIR+L
Sbjct:   121 TQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSL 180

Query:   181 DRIQE 185
             DRIQE
Sbjct:   181 DRIQE 185
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA;RCA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
GO:0005623 "cell" evidence=IMP
GO:0006470 "protein dephosphorylation" evidence=IMP
GO:0009903 "chloroplast avoidance movement" evidence=IMP
GO:0034613 "cellular protein localization" evidence=IMP
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
TAIR|locus:2025976 PP2A-1 "AT1G59830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020598 PP2A "AT1G69960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076451 PP2A-4 "protein phosphatase 2A-4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041579 PP2A-3 "AT2G42500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000005337 pphA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P365 ppp2ca "Serine/threonine-protein phosphatase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-441 ppp2ca "protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290263 pho2a "protein phosphatase 2A subunit C" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P67774 PPP2CA "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P11611PP2AB_RABIT3, ., 1, ., 3, ., 1, 60.80550.97290.5825yesno
P48463PP2AA_CHICK3, ., 1, ., 3, ., 1, 60.80550.97290.5825yesno
Q9HFQ2PP2A1_EMENI3, ., 1, ., 3, ., 1, 60.84350.96750.5440yesno
P23594PP2A1_YEAST3, ., 1, ., 3, ., 1, 60.72060.96750.4850yesno
P23636PP2A2_SCHPO3, ., 1, ., 3, ., 1, 60.75690.97830.5621yesno
P62716PP2AB_RAT3, ., 1, ., 3, ., 1, 60.80550.97290.5825yesno
P62714PP2AB_HUMAN3, ., 1, ., 3, ., 1, 60.80550.97290.5825yesno
P62715PP2AB_MOUSE3, ., 1, ., 3, ., 1, 60.80550.97290.5825yesno
Q0DBD3PP2A1_ORYSJ3, ., 1, ., 3, ., 1, 60.89181.00.6045yesno
P23696PP2A_DROME3, ., 1, ., 3, ., 1, 60.79780.98910.5922yesno
Q9ZSE4PP2A_HEVBR3, ., 1, ., 3, ., 1, 60.92971.00.6045N/Ano
P63331PP2AA_RAT3, ., 1, ., 3, ., 1, 60.81660.97290.5825yesno
Q0E2S4PP2A3_ORYSJ3, ., 1, ., 3, ., 1, 60.88701.00.6026yesno
Q07098PP2A2_ARATH3, ., 1, ., 3, ., 1, 60.90811.00.6045yesno
Q07099PP2A1_ARATH3, ., 1, ., 3, ., 1, 60.90271.00.6045yesno
A2YEB4PP2A1_ORYSI3, ., 1, ., 3, ., 1, 60.89181.00.6045N/Ano
P67777PP2AA_RABIT3, ., 1, ., 3, ., 1, 60.81660.97290.5825yesno
P67776PP2AA_PIG3, ., 1, ., 3, ., 1, 60.81660.97290.5825yesno
P67775PP2AA_HUMAN3, ., 1, ., 3, ., 1, 60.81660.97290.5825yesno
A2X2G3PP2A3_ORYSI3, ., 1, ., 3, ., 1, 60.88701.00.6026N/Ano
P48579PP2A_HELAN3, ., 1, ., 3, ., 1, 60.94050.99450.6032N/Ano
Q0P594PP2AB_BOVIN3, ., 1, ., 3, ., 1, 60.81110.97290.5825yesno
Q9XZE5PP2AA_DICDI3, ., 1, ., 3, ., 1, 60.82770.97290.5882yesno
P11493PP2AB_PIG3, ., 1, ., 3, ., 1, 60.82550.92970.5870yesno
P67774PP2AA_BOVIN3, ., 1, ., 3, ., 1, 60.81660.97290.5825yesno
P63330PP2AA_MOUSE3, ., 1, ., 3, ., 1, 60.81660.97290.5825yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.946
3rd Layer3.1.30.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
cd07415 285 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos 1e-134
PTZ00239 303 PTZ00239, PTZ00239, serine/threonine protein phosp 6e-94
smart00156 271 smart00156, PP2Ac, Protein phosphatase 2A homologu 6e-82
cd07414 293 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li 8e-70
cd07416 305 cd07416, MPP_PP2B, PP2B, metallophosphatase domain 5e-68
PTZ00480 320 PTZ00480, PTZ00480, serine/threonine-protein phosp 6e-58
cd07419 311 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho 4e-53
cd07417 316 cd07417, MPP_PP5_C, PP5, C-terminal metallophospha 9e-52
PTZ00244 294 PTZ00244, PTZ00244, serine/threonine-protein phosp 5e-47
cd00144225 cd00144, MPP_PPP_family, phosphoprotein phosphatas 7e-46
cd07418 377 cd07418, MPP_PP7, PP7, metallophosphatase domain 5e-37
cd07420 321 cd07420, MPP_RdgC, Drosophila melanogaster RdgC an 3e-30
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 3e-30
COG0639155 COG0639, ApaH, Diadenosine tetraphosphatase and re 3e-12
cd07425208 cd07425, MPP_Shelphs, Shewanella-like phosphatases 5e-06
cd07413222 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 1e-05
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 6e-05
cd07421 304 cd07421, MPP_Rhilphs, Rhilph phosphatases, metallo 8e-05
PHA02239235 PHA02239, PHA02239, putative protein phosphatase 2e-04
cd07424207 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos 0.001
cd07422 257 cd07422, MPP_ApaH, Escherichia coli ApaH and relat 0.001
>gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information 
 Score =  376 bits (968), Expect = e-134
 Identities = 140/180 (77%), Positives = 161/180 (89%)

Query: 6   DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVEL 65
           DLD+ IE L +C+ LPE EV  LCE+A+ ILV+E NVQ V+ PVTVCGDIHGQF+DL+EL
Sbjct: 1   DLDKWIEQLKKCELLPESEVKSLCEKAKEILVKESNVQRVRSPVTVCGDIHGQFYDLLEL 60

Query: 66  FRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYG 125
           FR+GG+ PDTNYLF+GDYVDRGYYSVET  LL+ALKVRY DRIT+LRGNHESRQITQVYG
Sbjct: 61  FRVGGDPPDTNYLFLGDYVDRGYYSVETFLLLLALKVRYPDRITLLRGNHESRQITQVYG 120

Query: 126 FYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQE 185
           FYDECLRKYGNANVWK+ TDLFDYLPL ALI++Q+FC+HGGLSPS+DTLD IRA+DR QE
Sbjct: 121 FYDECLRKYGNANVWKYCTDLFDYLPLAALIDNQIFCVHGGLSPSIDTLDQIRAIDRFQE 180

PP2A-like family of phosphoprotein phosphatases (PPP's) including PP4 and PP6. PP2A (Protein phosphatase 2A) is a critical regulator of many cellular activities. PP2A comprises about 1% of total cellular proteins. PP2A, together with protein phosphatase 1 (PP1), accounts for more than 90% of all serine/threonine phosphatase activities in most cells and tissues. The PP2A subunit in addition to having a catalytic domain homologous to PP1, has a unique C-terminal tail, containing a motif that is conserved in the catalytic subunits of all PP2A-like phosphatases including PP4 and PP6, and has an important role in PP2A regulation. The PP2A-like family of phosphatases all share a similar heterotrimeric architecture, that includes: a 65kDa scaffolding subunit (A), a 36kDa catalytic subunit (C), and one of 18 regulatory subunits (B). The PPP (phosphoprotein phosphatase) family, to which PP2A belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 285
>gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163656 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163664 cd07421, MPP_Rhilphs, Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|107154 PHA02239, PHA02239, putative protein phosphatase Back     alignment and domain information
>gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163665 cd07422, MPP_ApaH, Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
KOG0372 303 consensus Serine/threonine specific protein phosph 100.0
cd07420 321 MPP_RdgC Drosophila melanogaster RdgC and related 100.0
KOG0373 306 consensus Serine/threonine specific protein phosph 100.0
cd07415 285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 100.0
PTZ00239 303 serine/threonine protein phosphatase 2A; Provision 100.0
cd07416 305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 100.0
PTZ00480 320 serine/threonine-protein phosphatase; Provisional 100.0
cd07414 293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 100.0
PTZ00244 294 serine/threonine-protein phosphatase PP1; Provisio 100.0
smart00156 271 PP2Ac Protein phosphatase 2A homologues, catalytic 100.0
KOG0374 331 consensus Serine/threonine specific protein phosph 100.0
cd07417 316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 100.0
cd07418 377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 100.0
cd07419 311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 100.0
KOG0371 319 consensus Serine/threonine protein phosphatase 2A, 100.0
KOG0375 517 consensus Serine-threonine phosphatase 2B, catalyt 100.0
TIGR00668 279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 99.96
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 99.96
KOG0377 631 consensus Protein serine/threonine phosphatase RDG 99.96
cd07422 257 MPP_ApaH Escherichia coli ApaH and related protein 99.96
PRK00166 275 apaH diadenosine tetraphosphatase; Reviewed 99.95
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 99.95
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 99.95
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 99.95
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 99.94
PHA02239235 putative protein phosphatase 99.94
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 99.94
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 99.92
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 99.91
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.9
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.83
PRK09453182 phosphodiesterase; Provisional 99.45
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.44
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 99.39
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 99.38
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 99.29
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 99.25
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.25
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 99.03
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 98.99
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 98.99
PRK11340271 phosphodiesterase YaeI; Provisional 98.93
cd00838131 MPP_superfamily metallophosphatase superfamily, me 98.91
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 98.9
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.81
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 98.81
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 98.76
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 98.69
cd07396 267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 98.65
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 98.63
PHA02546 340 47 endonuclease subunit; Provisional 98.6
PRK04036504 DNA polymerase II small subunit; Validated 98.58
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 98.54
PRK11148 275 cyclic 3',5'-adenosine monophosphate phosphodieste 98.49
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 98.49
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 98.48
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 98.46
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 98.44
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 98.43
COG0622172 Predicted phosphoesterase [General function predic 98.42
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 98.42
cd00844 262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 98.41
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 98.36
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 98.35
COG1409 301 Icc Predicted phosphohydrolases [General function 98.35
PRK10966 407 exonuclease subunit SbcD; Provisional 98.33
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 98.32
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 98.29
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 98.28
COG2129226 Predicted phosphoesterases, related to the Icc pro 98.24
COG1408284 Predicted phosphohydrolases [General function pred 98.15
COG2908237 Uncharacterized protein conserved in bacteria [Fun 98.13
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 98.13
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 98.12
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 98.07
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 98.06
cd00839 294 MPP_PAPs purple acid phosphatases of the metalloph 98.03
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 97.99
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 97.97
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 97.94
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 97.85
cd00845 252 MPP_UshA_N_like Escherichia coli UshA-like family, 97.77
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 97.76
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 97.64
COG1407235 Predicted ICC-like phosphoesterases [General funct 97.53
cd07410 277 MPP_CpdB_N Escherichia coli CpdB and related prote 97.51
PLN02533 427 probable purple acid phosphatase 97.45
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 97.31
COG1768230 Predicted phosphohydrolase [General function predi 97.26
cd07378 277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 97.22
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 97.18
cd07408 257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 97.15
KOG1432 379 consensus Predicted DNA repair exonuclease SIA1 [G 97.13
cd07412 288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 97.0
PF06874 640 FBPase_2: Firmicute fructose-1,6-bisphosphatase; I 96.83
KOG3662 410 consensus Cell division control protein/predicted 96.77
cd07411 264 MPP_SoxB_N Thermus thermophilus SoxB and related p 96.7
cd07409 281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 96.54
cd07406 257 MPP_CG11883_N Drosophila melanogaster CG11883 and 96.43
cd00842 296 MPP_ASMase acid sphingomyelinase and related prote 96.41
TIGR00282 266 metallophosphoesterase, MG_246/BB_0505 family. A m 96.36
PF0832195 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 96.21
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 96.02
cd07405 285 MPP_UshA_N Escherichia coli UshA and related prote 95.79
cd07382 255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 94.93
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 94.9
cd08162 313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 94.85
KOG2863 456 consensus RNA lariat debranching enzyme [RNA proce 94.71
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 94.52
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 94.51
COG3855 648 Fbp Uncharacterized protein conserved in bacteria 94.42
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 94.0
cd07407 282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 93.88
KOG2476 528 consensus Uncharacterized conserved protein [Funct 93.83
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 93.82
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 93.8
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 93.37
PTZ00422 394 glideosome-associated protein 50; Provisional 93.29
KOG1378 452 consensus Purple acid phosphatase [Carbohydrate tr 93.19
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 93.17
KOG2679 336 consensus Purple (tartrate-resistant) acid phospha 92.66
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 92.33
KOG3325183 consensus Membrane coat complex Retromer, subunit 92.19
COG0639155 ApaH Diadenosine tetraphosphatase and related seri 91.93
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 91.81
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 91.63
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 91.5
PTZ00235 291 DNA polymerase epsilon subunit B; Provisional 91.41
KOG3947 305 consensus Phosphoesterases [General function predi 90.95
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 89.87
KOG3339211 consensus Predicted glycosyltransferase [General f 85.21
PF06874 640 FBPase_2: Firmicute fructose-1,6-bisphosphatase; I 83.19
>KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-47  Score=298.95  Aligned_cols=180  Identities=72%  Similarity=1.250  Sum_probs=176.2

Q ss_pred             HHHHHHHHHHcCCCCCHHHHHHHHHHHHHhhcccCcceecCCCEEEEeCCCCCHHHHHHHHHhcCCCCCCeEEEeccccC
Q 029935            6 DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYVD   85 (185)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~~~~~~~i~vigDIHG~~~~l~~ll~~~~~~~~~~lv~lGD~vd   85 (185)
                      .+++.++++.+++.+++.|+..||.++.++|.+|+++..++.|+.|+|||||++.+|..+++.-+..+...++|||||||
T Consensus         2 dldr~ie~L~~~~li~E~eV~~LC~~~~eiL~~E~NV~~i~tPvtvcGDIHGQf~Dllelf~igG~~~~t~YLFLGDyVD   81 (303)
T KOG0372|consen    2 DLDRQIEQLRRCELIAESEVKALCAKVREILVEESNVQRIDTPVTVCGDIHGQFYDLLELFRIGGDVPETNYLFLGDYVD   81 (303)
T ss_pred             cHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhcCCCceecCCCcEEeecccchHHHHHHHHHhCCCCCCCceEeecchhc
Confidence            37899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcHHHHHHHHHHHHhCCCcEEEEcCCCchhhhhhhhCCHHHHHHHhCCHHHHHHHHHHhhcCCceEEEcCcEEEEec
Q 029935           86 RGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHG  165 (185)
Q Consensus        86 rG~~~~e~l~~l~~l~~~~p~~v~~l~GNHE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~~i~~~~l~vHa  165 (185)
                      ||..|+|++-+|..+|.+||+++++||||||...+.+.|||+.||.++||+...|+...+.|+.||+++++++++|||||
T Consensus        82 RG~~SvEt~lLLl~lK~rYP~ritLiRGNHEsRqitqvYGFY~EclrKYG~~~vWr~c~eiFdyL~l~aiid~kifCVHG  161 (303)
T KOG0372|consen   82 RGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSANVWRYCTEIFDYLSLAAIIDGKIFCVHG  161 (303)
T ss_pred             cccchHHHHHHHHHHhhcCcceeEEeeccchhhhhhhhhhHHHHHHHHcCChHHHHHHHHHHHhhhHhheecCcEEEEcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCHHHhhccccCCC
Q 029935          166 GLSPSLDTLDNIRALDRIQE  185 (185)
Q Consensus       166 Gi~p~~~~~~~i~~i~R~~~  185 (185)
                      |++|+++.++||+.+.|.++
T Consensus       162 GlSP~i~~lDqIr~lDR~~E  181 (303)
T KOG0372|consen  162 GLSPSIQTLDQIRVLDRKQE  181 (303)
T ss_pred             CCCcchhhHHHHHHhhcccc
Confidence            99999999999999999875

>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG0371 consensus Serine/threonine protein phosphatase 2A, catalytic subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0375 consensus Serine-threonine phosphatase 2B, catalytic subunit [General function prediction only] Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>PF08321 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 This domain is specific to the PPP5 subfamily of serine/threonine phosphatases Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3855 Fbp Uncharacterized protein conserved in bacteria [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG3325 consensus Membrane coat complex Retromer, subunit VPS29/PEP11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>PTZ00235 DNA polymerase epsilon subunit B; Provisional Back     alignment and domain information
>KOG3947 consensus Phosphoesterases [General function prediction only] Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG3339 consensus Predicted glycosyltransferase [General function prediction only] Back     alignment and domain information
>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
3p71_C 304 Crystal Structure Of The Complex Of Lcmt-1 And Pp2a 1e-86
2nyl_C 293 Crystal Structure Of Protein Phosphatase 2a (Pp2a) 1e-86
2ie4_C 309 Structure Of The Protein Phosphatase 2a Core Enzyme 2e-86
2ie3_C 309 Structure Of The Protein Phosphatase 2a Core Enzyme 2e-86
3c5w_C 310 Complex Between Pp2a-Specific Methylesterase Pme-1 2e-86
2iae_C 309 Crystal Structure Of A Protein Phosphatase 2a (Pp2a 4e-86
3fga_C 309 Structural Basis Of Pp2a And Sgo Interaction Length 5e-86
2o8a_A 329 Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng 7e-46
1jk7_A 323 Crystal Structure Of The Tumor-Promoter Okadaic Aci 7e-46
1fjm_A 330 Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor 7e-46
4g9j_A 331 Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P 8e-46
3v4y_A 306 Crystal Structure Of The First Nuclear Pp1 Holoenzy 9e-46
3egg_A 329 Crystal Structure Of A Complex Between Protein Phos 9e-46
3n5u_B 300 Crystal Structure Of An Rb C-Terminal Peptide Bound 9e-46
1u32_A 293 Crystal Structure Of A Protein Phosphatase-1: Calci 1e-45
3e7a_A 299 Crystal Structure Of Protein Phosphatase-1 Bound To 1e-45
1s70_A 330 Complex Between Protein Ser/thr Phosphatase-1 (delt 3e-45
1aui_A 521 Human Calcineurin Heterodimer Length = 521 5e-44
2p6b_A 383 Crystal Structure Of Human Calcineurin In Complex W 1e-43
1mf8_A 373 Crystal Structure Of Human Calcineurin Complexed Wi 1e-43
3ll8_A 357 Crystal Structure Of Calcineurin In Complex With Ak 1e-43
1m63_A 372 Crystal Structure Of Calcineurin-Cyclophilin-Cyclos 1e-43
1tco_A 375 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-43
2jog_A 327 Structure Of The Calcineurin-Nfat Complex Length = 2e-43
1wao_1 477 Pp5 Structure Length = 477 1e-29
1s95_A 333 Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 1e-29
3h60_A 315 Catalytic Domain Of Human SerineTHREONINE PHOSPHATA 2e-29
3icf_A 335 Structure Of Protein SerineTHREONINE PHOSPHATASE FR 8e-27
>pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 Back     alignment and structure 
Iteration: 1

 Score =  315 bits (806), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 147/180 (81%), Positives = 166/180 (92%)
Query: 6   DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVEL 65
           +LD+ IE L +CK L E +V  LCE+A+ IL +E NVQ V+CPVTVCGD+HGQFHDL+EL
Sbjct: 9   ELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMEL 68
Query: 66  FRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYG 125
           FRIGG +PDTNYLFMGDYVDRGYYSVETVTLLVALKVRYR+RITILRGNHESRQITQVYG
Sbjct: 69  FRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYG 128
Query: 126 FYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQE 185
           FYDECLRKYGNANVWK+FTDLFDYLPLTAL++ Q+FCLHGGLSPS+DTLD+IRALDR+QE
Sbjct: 129 FYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQE 188
>pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 Back     alignment and structure
>pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 Back     alignment and structure
>pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 Back     alignment and structure
>pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 Back     alignment and structure
>pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 Back     alignment and structure
>pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 Back     alignment and structure
>pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 Back     alignment and structure
>pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 Back     alignment and structure
>pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 Back     alignment and structure
>pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 Back     alignment and structure
>pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 Back     alignment and structure
>pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 Back     alignment and structure
>pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 Back     alignment and structure
>pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 Back     alignment and structure
>pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 Back     alignment and structure
>pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 Back     alignment and structure
>pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 Back     alignment and structure
>pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 Back     alignment and structure
>pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 Back     alignment and structure
>pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 Back     alignment and structure
>pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 Back     alignment and structure
>pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 Back     alignment and structure
>pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 Back     alignment and structure
>pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
2ie4_C 309 PP2A-alpha;, serine/threonine-protein phosphatase 1e-128
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 1e-126
1fjm_A 330 Protein serine/threonine phosphatase-1 (alpha ISO 1e-121
3e7a_A 299 PP-1A, serine/threonine-protein phosphatase PP1-al 1e-120
3h63_A 315 Serine/threonine-protein phosphatase 5; metalloenz 1e-119
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 1e-119
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 1e-116
3icf_A 335 PPT, serine/threonine-protein phosphatase T; IRO m 1e-116
2z72_A 342 Protein-tyrosine-phosphatase; cold-active enzyme, 7e-19
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 3e-11
2dfj_A 280 Diadenosinetetraphosphatase; helices and strands m 3e-11
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 2e-10
1nnw_A 252 Hypothetical protein; structural genomics, PSI, pr 7e-05
3qfm_A 270 SAPH, putative uncharacterized protein; sandwich f 3e-04
3rqz_A 246 Metallophosphoesterase; PSI-biology, midwest cente 5e-04
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
 Score =  360 bits (927), Expect = e-128
 Identities = 147/184 (79%), Positives = 166/184 (90%)

Query: 2   PSQADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHD 61
               +LD+ IE L +CK L E +V  LCE+A+ IL +E NVQ V+CPVTVCGD+HGQFHD
Sbjct: 5   VFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHD 64

Query: 62  LVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQIT 121
           L+ELFRIGG +PDTNYLFMGDYVDRGYYSVETVTLLVALKVRYR+RITILRGNHESRQIT
Sbjct: 65  LMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQIT 124

Query: 122 QVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALD 181
           QVYGFYDECLRKYGNANVWK+FTDLFDYLPLTAL++ Q+FCLHGGLSPS+DTLD+IRALD
Sbjct: 125 QVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALD 184

Query: 182 RIQE 185
           R+QE
Sbjct: 185 RLQE 188
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Length = 252 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
3e7a_A 299 PP-1A, serine/threonine-protein phosphatase PP1-al 100.0
2ie4_C 309 PP2A-alpha;, serine/threonine-protein phosphatase 100.0
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 100.0
1fjm_A 330 Protein serine/threonine phosphatase-1 (alpha ISO 100.0
3h63_A 315 Serine/threonine-protein phosphatase 5; metalloenz 100.0
3icf_A 335 PPT, serine/threonine-protein phosphatase T; IRO m 100.0
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 100.0
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 100.0
2z72_A 342 Protein-tyrosine-phosphatase; cold-active enzyme, 99.95
2dfj_A 280 Diadenosinetetraphosphatase; helices and strands m 99.95
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 99.92
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.87
3rqz_A 246 Metallophosphoesterase; PSI-biology, midwest cente 99.78
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.78
3qfm_A 270 SAPH, putative uncharacterized protein; sandwich f 99.77
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 99.48
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 99.32
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.3
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 99.24
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 99.2
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 99.18
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.17
3ck2_A176 Conserved uncharacterized protein (predicted phosp 99.12
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.05
3d03_A 274 Phosphohydrolase; glycerophosphodiesterase, metall 98.89
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 98.87
2q8u_A 336 Exonuclease, putative; structural genomics, joint 98.82
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 98.79
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 98.74
3rl5_A 296 Metallophosphoesterase mpped2; alpha-beta fold, me 98.74
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 98.72
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 98.55
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 98.48
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 98.35
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 98.33
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 98.32
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 97.9
1ute_A 313 Protein (II purple acid phosphatase); tartrate res 97.9
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 97.76
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 97.33
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 97.13
3qfk_A 527 Uncharacterized protein; structural genomics, cent 97.05
1t71_A 281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 96.99
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 96.85
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 96.63
2z06_A 252 Putative uncharacterized protein TTHA0625; metal b 96.61
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 96.49
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 96.42
1t70_A 255 Phosphatase; crystal, X-RAY crystallography, struc 96.36
3jyf_A 339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 95.87
3gve_A 341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 95.81
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 95.64
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 94.19
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 93.39
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 93.39
3e0j_A476 DNA polymerase subunit delta-2; DNA polymerase del 86.77
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
Probab=100.00  E-value=4.8e-45  Score=298.86  Aligned_cols=179  Identities=46%  Similarity=0.959  Sum_probs=171.1

Q ss_pred             HHHHHHHHHHcCC--------CCCHHHHHHHHHHHHHhhcccCcceecCCCEEEEeCCCCCHHHHHHHHHhcCCCCCCeE
Q 029935            6 DLDRQIEHLMQCK--------PLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNY   77 (185)
Q Consensus         6 ~~~~~~~~~~~~~--------~~~~~~~~~l~~~~~~~l~~~~~~~~~~~~i~vigDIHG~~~~l~~ll~~~~~~~~~~l   77 (185)
                      .++++++++++..        +++++++..||++|+++|.++|++++.++|++|||||||++++|.++++..+..+.+.+
T Consensus         7 ~~d~~i~~l~~~~~~~~~~~~~l~~~~~~~l~~~~~~il~~ep~ll~~~~~i~viGDIHG~~~~L~~ll~~~g~~~~~~~   86 (299)
T 3e7a_A            7 NLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNY   86 (299)
T ss_dssp             CHHHHHHHHHTTTTSCTTCCCCCCHHHHHHHHHHHHHHHHHSCSEEEECSSEEEECBCTTCHHHHHHHHHHHCSTTSSCE
T ss_pred             CHHHHHHHHHhccccCCCcccCCCHHHHHHHHHHHHHHHHhCCCeeecCCCEEEEecCCCCHHHHHHHHHHhCCCCCccE
Confidence            3889999987654        79999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeccccCCCCCcHHHHHHHHHHHHhCCCcEEEEcCCCchhhhhhhhCCHHHHHHHhCCHHHHHHHHHHhhcCCceEEEc
Q 029935           78 LFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIE  157 (185)
Q Consensus        78 v~lGD~vdrG~~~~e~l~~l~~l~~~~p~~v~~l~GNHE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~~i~  157 (185)
                      ||||||||||++|.|++.++.+++..+|.++++||||||.+.++..++|..++.++| ...+|+.+.++|++||+++.++
T Consensus        87 vfLGD~VDrG~~s~evl~lL~~lk~~~p~~v~~lrGNHE~~~i~~~ygF~~e~~~ky-~~~l~~~~~~~f~~LPlaaii~  165 (299)
T 3e7a_A           87 LFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIVD  165 (299)
T ss_dssp             EECSCCSSSSSCHHHHHHHHHHHHHHSTTTEEECCCTTSSHHHHHHHSHHHHHHHHS-CHHHHHHHHHHHTTCCCEEEET
T ss_pred             EeCCcccCCCCCcHHHHHHHHHHHhhCCCcEEEEecCchhhhhcccccchHHHHHHh-hHHHHHHHHHHHhhCCceEEEC
Confidence            999999999999999999999999999999999999999999999999999999999 6789999999999999999999


Q ss_pred             CcEEEEecCCCCCCCCHHHhhccccCCC
Q 029935          158 SQVFCLHGGLSPSLDTLDNIRALDRIQE  185 (185)
Q Consensus       158 ~~~l~vHaGi~p~~~~~~~i~~i~R~~~  185 (185)
                      ++++|||||++|++.++++|++|+||++
T Consensus       166 ~~il~vHGGlsp~~~~l~~i~~i~R~~~  193 (299)
T 3e7a_A          166 EKIFCCHGGLSPDLQSMEQIRRIMRPTD  193 (299)
T ss_dssp             TTEEEESSCCCTTCCCTHHHHTCCSSCC
T ss_pred             CeEEEEcCccCcccCCHHHHHhccCCCc
Confidence            9999999999999999999999999974
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d3c5wc1 288 d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt 1e-78
d1auia_ 473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 1e-71
d1jk7a_ 294 d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human 3e-65
d1s95a_ 324 d.159.1.3 (A:) Serine/threonine protein phosphatas 9e-65
d1g5ba_219 d.159.1.3 (A:) lambda ser/thr protein phosphatase 3e-12
d1nnwa_ 251 d.159.1.5 (A:) Hypothetical protein PF1291 {Archae 1e-10
d1su1a_184 d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia 2e-06
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  234 bits (597), Expect = 1e-78
 Identities = 147/180 (81%), Positives = 166/180 (92%)

Query: 6   DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVEL 65
           +LD+ IE L +CK L E +V  LCE+A+ IL +E NVQ V+CPVTVCGD+HGQFHDL+EL
Sbjct: 4   ELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMEL 63

Query: 66  FRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYG 125
           FRIGG +PDTNYLFMGDYVDRGYYSVETVTLLVALKVRYR+RITILRGNHESRQITQVYG
Sbjct: 64  FRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYG 123

Query: 126 FYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRALDRIQE 185
           FYDECLRKYGNANVWK+FTDLFDYLPLTAL++ Q+FCLHGGLSPS+DTLD+IRALDR+QE
Sbjct: 124 FYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQE 183
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d3c5wc1 288 Protein phosphatase 2A catalytic subunit alpha iso 100.0
d1jk7a_ 294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 100.0
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 100.0
d1s95a_ 324 Serine/threonine protein phosphatase 5, PP5 {Human 100.0
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 99.92
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.86
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.61
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 99.47
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 99.44
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 99.23
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 99.15
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 99.12
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.11
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.69
d3d03a1 271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 98.59
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 98.53
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 98.42
d2nxfa1 320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 98.25
d2qfra2 312 Plant purple acid phosphatase, catalytic domain {K 97.54
d1utea_ 302 Mammalian purple acid phosphatase {Pig (Sus scrofa 97.39
d2z1aa2 302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 95.71
d1usha2 337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 95.23
d3c9fa2 322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 91.71
d1gg4a1135 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 88.19
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-46  Score=305.28  Aligned_cols=181  Identities=81%  Similarity=1.368  Sum_probs=176.0

Q ss_pred             hHHHHHHHHHHcCCCCCHHHHHHHHHHHHHhhcccCcceecCCCEEEEeCCCCCHHHHHHHHHhcCCCCCCeEEEecccc
Q 029935            5 ADLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLVELFRIGGNAPDTNYLFMGDYV   84 (185)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~~~~~~~i~vigDIHG~~~~l~~ll~~~~~~~~~~lv~lGD~v   84 (185)
                      -+++++++++++++++|++++.+||++|+++|++||+++.++.+++|||||||++++|.++++..+.++..++|||||||
T Consensus         3 ~~~d~~i~~~~~~~~l~~~~i~~L~~~a~~il~~e~~l~~i~~pv~VvGDlHG~~~DL~~if~~~g~p~~~~ylFLGDYV   82 (288)
T d3c5wc1           3 KELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYV   82 (288)
T ss_dssp             HHHHHHHHHHTTTCCCCHHHHHHHHHHHHHHHHTSCSEEEECSSEEEECBCTTCHHHHHHHHHHHCCTTTSCEEECSCCC
T ss_pred             hHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHhCCCEEEeCCCeEEEeeCCCCHHHHHHHHHhcCCCccceEEecCccc
Confidence            36899999999999999999999999999999999999999999999999999999999999999998889999999999


Q ss_pred             CCCCCcHHHHHHHHHHHHhCCCcEEEEcCCCchhhhhhhhCCHHHHHHHhCCHHHHHHHHHHhhcCCceEEEcCcEEEEe
Q 029935           85 DRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLH  164 (185)
Q Consensus        85 drG~~~~e~l~~l~~l~~~~p~~v~~l~GNHE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~~i~~~~l~vH  164 (185)
                      |||+.|.||+.++..+|..+|++++++|||||...++..++|..++..+|+...+|+.+.++|++||+++.++++++|||
T Consensus        83 DRG~~slEvl~lL~alKi~~P~~v~lLRGNHE~~~~~~~~gF~~E~~~ky~~~~i~~~~~~~F~~LPlaaiI~~~i~cvH  162 (288)
T d3c5wc1          83 DRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLH  162 (288)
T ss_dssp             CSSSSHHHHHHHHHHHHHHCTTTEEECCCTTSSHHHHHHHSHHHHHHHHHSSSHHHHHHHHHHTTSCSEEEETTTEEEES
T ss_pred             CCCCcceeHHHHHHHHHhhCCCeEEEeccCCcccccccccCcchhhhhhcCcHHHHHHHHHHHhhccceEEecCeEEEec
Confidence            99999999999999999999999999999999999999999999999999988999999999999999999999999999


Q ss_pred             cCCCCCCCCHHHhhccccCCC
Q 029935          165 GGLSPSLDTLDNIRALDRIQE  185 (185)
Q Consensus       165 aGi~p~~~~~~~i~~i~R~~~  185 (185)
                      ||++|....+++|+.|.|+.+
T Consensus       163 GGi~~~~~~~~~i~~i~r~~~  183 (288)
T d3c5wc1         163 GGLSPSIDTLDHIRALDRLQE  183 (288)
T ss_dssp             SCCCTTCSSHHHHHHSCCSSS
T ss_pred             ccccCCccchhhHhhcccccC
Confidence            999999999999999999863
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1gg4a1 c.59.1.1 (A:313-447) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure