Citrus Sinensis ID: 029939

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MASAAAAASSAPTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTGGRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVSAPYY
cHHHHHHHccccccccccccccccccccccccccHHHHHHcccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEEEccccc
cccccccHccccccccccccccccccccHHHHHHHHcccccccccEEccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHcccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcEcccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEEEcccc
masaaaaassaptiwltgqglggrstrlpfhwrnkkmeqrktggrisakfdlkpppyplnalephmskdtlefhwgkHHRAYVDNLNkqivgtelgdgkslEDVVIASynkgdllpafNNAAQAWnhdffwesmkpggggkpsgelLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVSAPYY
MASAAAaassaptiwltgqglggrstrlpfhwrnkkmeqrktggrisakfdlkppPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVSAPYY
MasaaaaassaPTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTGGRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWesmkpggggkpsgellgLIERDFGSfekfleefkaaaaTQFGSGWAWLVSAPYY
************TIWLTGQGLGGRSTRLPFHW************************************DTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM*********GELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVSA***
*******ASSAPTI**********************************KFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGG**KPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVSAPYY
***********PTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTGGRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVSAPYY
**************************RLP*HW**********GGRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVSAPYY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASAAAAASSAPTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTGGRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVSAPYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
Q9LU64 305 Superoxide dismutase [Fe] yes no 0.783 0.475 0.675 3e-60
P22302202 Superoxide dismutase [Fe] N/A no 0.724 0.663 0.777 5e-59
P28759248 Superoxide dismutase [Fe] no no 0.745 0.556 0.805 2e-56
P21276212 Superoxide dismutase [Fe] no no 0.718 0.627 0.776 5e-52
Q9FMX0263 Superoxide dismutase [Fe] no no 0.735 0.517 0.602 2e-45
Q5VSB7255 Superoxide dismutase [Fe] yes no 0.794 0.576 0.509 2e-39
Q8YSZ1200 Superoxide dismutase [Fe] yes no 0.708 0.655 0.586 2e-38
P77968199 Superoxide dismutase [Fe] N/A no 0.670 0.623 0.608 8e-38
P50061199 Superoxide dismutase [Fe] N/A no 0.708 0.658 0.556 3e-35
P31108192 Superoxide dismutase [Fe] yes no 0.675 0.651 0.557 4e-35
>sp|Q9LU64|SODF2_ARATH Superoxide dismutase [Fe] 2, chloroplastic OS=Arabidopsis thaliana GN=FSD2 PE=1 SV=1 Back     alignment and function desciption
 Score =  230 bits (587), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 106/157 (67%), Positives = 133/157 (84%), Gaps = 12/157 (7%)

Query: 34  NKKMEQRKTGGR-----------ISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAY 82
           N++M+ ++ G R           I+A F+LKPPPYPL+ALEPHMS++TL++HWGKHH+ Y
Sbjct: 26  NRRMQWKRNGKRRLGTKVAVSGVITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTY 85

Query: 83  VDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKP 142
           V+NLNKQI+GT+L D  SLE+VV+ SYNKG++LPAFNNAAQAWNH+FFWES++PGGGGKP
Sbjct: 86  VENLNKQILGTDL-DALSLEEVVLLSYNKGNMLPAFNNAAQAWNHEFFWESIQPGGGGKP 144

Query: 143 SGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWL 179
           +GELL LIERDFGSFE+FLE FK+AAA+ FGSGW WL
Sbjct: 145 TGELLRLIERDFGSFEEFLERFKSAAASNFGSGWTWL 181
Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems (By similarity). Plays important role in chloroplast development, particularly in the maintenance of thylakoids membranes. Seems to act as a heterodimer with FSD3.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|P22302|SODF_NICPL Superoxide dismutase [Fe], chloroplastic (Fragment) OS=Nicotiana plumbaginifolia GN=SODB PE=2 SV=1 Back     alignment and function description
>sp|P28759|SODF_SOYBN Superoxide dismutase [Fe], chloroplastic OS=Glycine max GN=SODB PE=2 SV=1 Back     alignment and function description
>sp|P21276|SODF1_ARATH Superoxide dismutase [Fe] 1, chloroplastic OS=Arabidopsis thaliana GN=FSD1 PE=1 SV=4 Back     alignment and function description
>sp|Q9FMX0|SODF3_ARATH Superoxide dismutase [Fe] 3, chloroplastic OS=Arabidopsis thaliana GN=FSD3 PE=1 SV=1 Back     alignment and function description
>sp|Q5VSB7|SODF2_ORYSJ Superoxide dismutase [Fe] 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0143000 PE=2 SV=1 Back     alignment and function description
>sp|Q8YSZ1|SODF_NOSS1 Superoxide dismutase [Fe] OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=sodB PE=3 SV=3 Back     alignment and function description
>sp|P77968|SODF_SYNY3 Superoxide dismutase [Fe] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sodB PE=1 SV=3 Back     alignment and function description
>sp|P50061|SODF_PLEBO Superoxide dismutase [Fe] OS=Plectonema boryanum GN=sodB PE=2 SV=1 Back     alignment and function description
>sp|P31108|SODF_LEGPH Superoxide dismutase [Fe] OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=sodB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
380085077 305 Fe superoxide dismutase [Jatropha curcas 0.848 0.514 0.761 1e-65
347597326282 Fe-superoxide dismutase [Phytolacca acin 0.951 0.624 0.662 4e-63
33413303249 superoxide dismutase [Fe] [Solanum lycop 0.972 0.722 0.651 6e-63
374307307 309 iron superoxide dismutase, partial [Litc 0.956 0.572 0.727 1e-62
350537593249 iron superoxide dismutase [Solanum lycop 0.972 0.722 0.646 2e-62
356499596 313 PREDICTED: superoxide dismutase [Fe], ch 0.951 0.562 0.644 6e-62
255539971 305 superoxide dismutase [fe], putative [Ric 0.956 0.580 0.727 1e-61
225454956 306 PREDICTED: superoxide dismutase [Fe], ch 0.929 0.562 0.662 3e-61
356534787 309 PREDICTED: superoxide dismutase [Fe], ch 0.805 0.482 0.726 1e-60
255635842217 unknown [Glycine max] 0.951 0.811 0.633 4e-60
>gi|380085077|gb|AFD34189.1| Fe superoxide dismutase [Jatropha curcas] Back     alignment and taxonomy information
 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 137/159 (86%), Gaps = 2/159 (1%)

Query: 22  GGRSTRLPFHWRNKKMEQRKTG-GRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHR 80
           G   T   F WR ++  +R+TG   ++AKF+LKPPPYPLNALEPHMSKDTLE+HWGKHHR
Sbjct: 21  GLSRTTSAFKWRKERHVRRQTGPAIVTAKFELKPPPYPLNALEPHMSKDTLEYHWGKHHR 80

Query: 81  AYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGG 140
           +YVDNLNKQIVGTEL D   LEDVVI +YNKGD+LPAFNNAAQAWNH+FFW  MKPGGGG
Sbjct: 81  SYVDNLNKQIVGTEL-DSLPLEDVVIVTYNKGDVLPAFNNAAQAWNHEFFWGCMKPGGGG 139

Query: 141 KPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWL 179
           K SGELL LIERDFGSF+KF+EEF++AAATQFGSGWAWL
Sbjct: 140 KRSGELLQLIERDFGSFKKFVEEFRSAAATQFGSGWAWL 178

Source: Jatropha curcas

Species: Jatropha curcas

Genus: Jatropha

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|347597326|gb|AEP14527.1| Fe-superoxide dismutase [Phytolacca acinosa] Back     alignment and taxonomy information
>gi|33413303|emb|CAE22480.1| superoxide dismutase [Fe] [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|374307307|gb|AEY78486.2| iron superoxide dismutase, partial [Litchi chinensis] Back     alignment and taxonomy information
>gi|350537593|ref|NP_001233789.1| iron superoxide dismutase [Solanum lycopersicum] gi|33439120|gb|AAQ18699.1| iron superoxide dismutase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356499596|ref|XP_003518624.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255539971|ref|XP_002511050.1| superoxide dismutase [fe], putative [Ricinus communis] gi|223550165|gb|EEF51652.1| superoxide dismutase [fe], putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225454956|ref|XP_002280522.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Vitis vinifera] gi|297744964|emb|CBI38556.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356534787|ref|XP_003535933.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255635842|gb|ACU18268.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
TAIR|locus:2176167 305 FSD2 "AT5G51100" [Arabidopsis 0.816 0.495 0.521 5.2e-42
TAIR|locus:2117273212 FSD1 "Fe superoxide dismutase 0.718 0.627 0.582 1.2e-40
TAIR|locus:2166953263 FSD3 "Fe superoxide dismutase 0.8 0.562 0.469 2.2e-34
UNIPROTKB|Q5VSB7255 LOC_Os06g05110 "Superoxide dis 0.821 0.596 0.410 6.4e-28
UNIPROTKB|Q0C4B8220 sodB "Superoxide dismutase" [H 0.789 0.663 0.429 9.4e-27
TIGR_CMR|CBU_1708193 CBU_1708 "superoxide dismutase 0.675 0.647 0.442 2.6e-24
UNIPROTKB|P0AGD3193 sodB [Escherichia coli K-12 (t 0.675 0.647 0.412 6.1e-23
TIGR_CMR|APH_0371206 APH_0371 "Fe superoxide dismut 0.697 0.626 0.425 1.6e-22
TIGR_CMR|SO_2881194 SO_2881 "superoxide dismutase, 0.675 0.644 0.412 2.6e-22
TIGR_CMR|CPS_3476194 CPS_3476 "superoxide dismutase 0.670 0.639 0.423 9e-22
TAIR|locus:2176167 FSD2 "AT5G51100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 445 (161.7 bits), Expect = 5.2e-42, P = 5.2e-42
 Identities = 85/163 (52%), Positives = 107/163 (65%)

Query:    28 LPFHWRNKKMEQRKTGGR-----------ISAKFDLKPPPYPLNALEPHMSKDTLEFHWG 76
             LP    N++M+ ++ G R           I+A F+LKPPPYPL+ALEPHMS++TL++HWG
Sbjct:    20 LPSQGPNRRMQWKRNGKRRLGTKVAVSGVITAGFELKPPPYPLDALEPHMSRETLDYHWG 79

Query:    77 KHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWXXXXX 136
             KHH+ YV+NLNKQI+GT+L D  SLE+VV+ SYNKG++LPAFNNAAQAWNH+FFW     
Sbjct:    80 KHHKTYVENLNKQILGTDL-DALSLEEVVLLSYNKGNMLPAFNNAAQAWNHEFFWESIQP 138

Query:   137 XXXXXXXXXXXXLIERDFGSXXXXXXXXXXXXXTQFGSGWAWL 179
                         LIERDFGS             + FGSGW WL
Sbjct:   139 GGGGKPTGELLRLIERDFGSFEEFLERFKSAAASNFGSGWTWL 181
GO:0004784 "superoxide dismutase activity" evidence=ISS;IDA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009295 "nucleoid" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009579 "thylakoid" evidence=IDA
GO:0042644 "chloroplast nucleoid" evidence=IDA
GO:0055114 "oxidation-reduction process" evidence=IDA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006399 "tRNA metabolic process" evidence=RCA
GO:0009658 "chloroplast organization" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0009411 "response to UV" evidence=IEP
TAIR|locus:2117273 FSD1 "Fe superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166953 FSD3 "Fe superoxide dismutase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VSB7 LOC_Os06g05110 "Superoxide dismutase [Fe] 2, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C4B8 sodB "Superoxide dismutase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1708 CBU_1708 "superoxide dismutase (fe)" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|P0AGD3 sodB [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0371 APH_0371 "Fe superoxide dismutase" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2881 SO_2881 "superoxide dismutase, Fe" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3476 CPS_3476 "superoxide dismutase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q88PD5SODF_PSEPK1, ., 1, 5, ., 1, ., 10.52670.67560.6313yesno
P0A2F4SODF_SALTY1, ., 1, 5, ., 1, ., 10.51140.67560.6476yesno
O30970SODF_RHOCA1, ., 1, 5, ., 1, ., 10.52230.70270.65yesno
P53641SODF_PSEAE1, ., 1, 5, ., 1, ., 10.54960.67560.6476yesno
Q9XD74SODF_RHIME1, ., 1, 5, ., 1, ., 10.51900.68640.635yesno
Q8YSZ1SODF_NOSS11, ., 1, 5, ., 1, ., 10.58640.70810.655yesno
P37369SODF_BORPE1, ., 1, 5, ., 1, ., 10.53480.66480.6406yesno
P84612SODF_PSEHT1, ., 1, 5, ., 1, ., 10.50380.67560.6510yesno
P22302SODF_NICPL1, ., 1, 5, ., 1, ., 10.77770.72430.6633N/Ano
P31108SODF_LEGPH1, ., 1, 5, ., 1, ., 10.55720.67560.6510yesno
P18655SODF_SYNE71, ., 1, 5, ., 1, ., 10.54960.70270.6467yesno
P09223SODF_PSEPU1, ., 1, 5, ., 1, ., 10.52670.67560.6313yesno
P19685SODF_COXBU1, ., 1, 5, ., 1, ., 10.55720.67560.6476yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.10.914
3rd Layer1.15.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
PLN02685 299 PLN02685, PLN02685, iron superoxide dismutase 2e-94
PLN02184212 PLN02184, PLN02184, superoxide dismutase [Fe] 3e-72
PLN02622261 PLN02622, PLN02622, iron superoxide dismutase 1e-62
COG0605204 COG0605, SodA, Superoxide dismutase [Inorganic ion 3e-59
PTZ00078193 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Pro 9e-44
PRK10543193 PRK10543, PRK10543, superoxide dismutase; Provisio 3e-43
pfam0008182 pfam00081, Sod_Fe_N, Iron/manganese superoxide dis 1e-34
PRK10925206 PRK10925, PRK10925, superoxide dismutase; Provisio 9e-30
PLN02471231 PLN02471, PLN02471, superoxide dismutase [Mn] 2e-18
pfam02777106 pfam02777, Sod_Fe_C, Iron/manganese superoxide dis 2e-17
>gnl|CDD|215369 PLN02685, PLN02685, iron superoxide dismutase Back     alignment and domain information 
 Score =  276 bits (706), Expect = 2e-94
 Identities = 127/182 (69%), Positives = 145/182 (79%), Gaps = 8/182 (4%)

Query: 1   MASAAAAASSAPTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTG--GRISAKFDLKPPPYP 58
             +A  A+ S     L  QG   R       W+ K+    +    G I+AKF+LKPPPYP
Sbjct: 1   AVTATPASLSLSPALLPSQGPSRRM-----QWKGKRRTCTRKAVSGVITAKFELKPPPYP 55

Query: 59  LNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAF 118
           L+ALEPHMS++TLE+HWGKHHRAYVDNLNKQIVGTEL DG SLEDVV+ +YNKGD+LPAF
Sbjct: 56  LDALEPHMSRETLEYHWGKHHRAYVDNLNKQIVGTEL-DGMSLEDVVLITYNKGDMLPAF 114

Query: 119 NNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAW 178
           NNAAQAWNH+FFWESMKPGGGGKPSGELL LIERDFGSFE+F+EEFK+AAATQFGSGWAW
Sbjct: 115 NNAAQAWNHEFFWESMKPGGGGKPSGELLQLIERDFGSFERFVEEFKSAAATQFGSGWAW 174

Query: 179 LV 180
           L 
Sbjct: 175 LA 176

Length = 299
>gnl|CDD|177838 PLN02184, PLN02184, superoxide dismutase [Fe] Back     alignment and domain information
>gnl|CDD|166263 PLN02622, PLN02622, iron superoxide dismutase Back     alignment and domain information
>gnl|CDD|223678 COG0605, SodA, Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|185432 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Provisional Back     alignment and domain information
>gnl|CDD|182534 PRK10543, PRK10543, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|200985 pfam00081, Sod_Fe_N, Iron/manganese superoxide dismutases, alpha-hairpin domain Back     alignment and domain information
>gnl|CDD|182843 PRK10925, PRK10925, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|215262 PLN02471, PLN02471, superoxide dismutase [Mn] Back     alignment and domain information
>gnl|CDD|202388 pfam02777, Sod_Fe_C, Iron/manganese superoxide dismutases, C-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
PLN02685 299 iron superoxide dismutase 100.0
PLN02184212 superoxide dismutase [Fe] 100.0
COG0605204 SodA Superoxide dismutase [Inorganic ion transport 100.0
PRK10543193 superoxide dismutase; Provisional 100.0
PRK10925206 superoxide dismutase; Provisional 100.0
PLN02622261 iron superoxide dismutase 100.0
PTZ00078193 Superoxide dismutase [Fe]; Provisional 100.0
PLN02471231 superoxide dismutase [Mn] 100.0
KOG0876234 consensus Manganese superoxide dismutase [Inorgani 100.0
PF0008182 Sod_Fe_N: Iron/manganese superoxide dismutases, al 99.97
PF02777106 Sod_Fe_C: Iron/manganese superoxide dismutases, C- 99.64
>PLN02685 iron superoxide dismutase Back     alignment and domain information 
Probab=100.00  E-value=4.6e-51  Score=355.66  Aligned_cols=171  Identities=75%  Similarity=1.287  Sum_probs=148.5

Q ss_pred             cccCCCeeeeeCCCCCCCCCccccccccccc-cccccC-CccccceeeCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q 029939            7 AASSAPTIWLTGQGLGGRSTRLPFHWRNKKM-EQRKTG-GRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVD   84 (185)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~-~~~~~~f~lp~LpY~~~aLeP~IS~~tl~~H~~khh~~YV~   84 (185)
                      |..|-+...+..||   .|.|  .||..||+ |..+.. ..+.++|+||+|||+|++|||+||++||++||+|||++||+
T Consensus         7 ~~~~~~~~~~~~~~---~~~~--~~~~~~~~~~~~~~~~~~~~~~~~Lp~LpY~y~aLEP~IS~etmelHh~kHhq~YV~   81 (299)
T PLN02685          7 ASLSLSPALLPSQG---PSRR--MQWKGKRRTCTRKAVSGVITAKFELKPPPYPLDALEPHMSRETLEYHWGKHHRAYVD   81 (299)
T ss_pred             cchhhccccCcccC---Cccc--chhhhhhhhhhhhccccccccceecCCCCCCcccchhhcCHHHHHHHHHHHHHHHHH
Confidence            34455556677775   3444  58998877 655555 34578899999999999999999999999999999999999


Q ss_pred             HHHHhhhccccCCCCCHHHHHHHhhcCCCCcchhcchhhhhhhhhhhhccCCCCCCCCcHHHHHHHHhhcCCHHHHHHHH
Q 029939           85 NLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEF  164 (185)
Q Consensus        85 ~LN~~l~~t~~~~~~~l~~ii~~~~~~~~~~~ifN~ag~~~NH~ffw~~L~P~~~~~P~g~L~~aI~~sFGS~d~fk~~F  164 (185)
                      |||++++++++ +++++++|+..+....+...+||+|||+|||+|||+||+|+++++|++.|+++|+++|||||+||++|
T Consensus        82 ~LN~al~~t~l-~~~sl~eii~~~~~~~~~~~ifNnaggh~NH~fFWe~L~P~ggg~P~g~L~~aI~~~FGS~d~FK~~F  160 (299)
T PLN02685         82 NLNKQIVGTEL-DGMSLEDVVLITYNKGDMLPAFNNAAQAWNHEFFWESMKPGGGGKPSGELLQLIERDFGSFERFVEEF  160 (299)
T ss_pred             HHHHHHcCchh-hcCCHHHHHHHhhccchhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHhCCHHHHHHHH
Confidence            99999999888 88999999876655555556999999999999999999998878899999999999999999999999


Q ss_pred             HHHHhcCCCccEEEEEEcC
Q 029939          165 KAAAATQFGSGWAWLVSAP  183 (185)
Q Consensus       165 ~~aA~s~fGSGWvWLv~d~  183 (185)
                      +++|.++|||||+|||+++
T Consensus       161 ~~aA~s~fGSGWvWLV~~~  179 (299)
T PLN02685        161 KSAAATQFGSGWAWLAYKA  179 (299)
T ss_pred             HHHHhhCCCCeEEEEEEcc
Confidence            9999999999999999974

>PLN02184 superoxide dismutase [Fe] Back     alignment and domain information
>COG0605 SodA Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10543 superoxide dismutase; Provisional Back     alignment and domain information
>PRK10925 superoxide dismutase; Provisional Back     alignment and domain information
>PLN02622 iron superoxide dismutase Back     alignment and domain information
>PTZ00078 Superoxide dismutase [Fe]; Provisional Back     alignment and domain information
>PLN02471 superoxide dismutase [Mn] Back     alignment and domain information
>KOG0876 consensus Manganese superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00081 Sod_Fe_N: Iron/manganese superoxide dismutases, alpha-hairpin domain Note: SCOP classifies the two domains separately Back     alignment and domain information
>PF02777 Sod_Fe_C: Iron/manganese superoxide dismutases, C-terminal domain Note: SCOP classifies the two domains separately Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
1unf_X238 The Crystal Structure Of The Eukaryotic Fesod From 2e-46
1my6_A199 The 1.6 A Structure Of Fe-superoxide Dismutase From 7e-25
3h1s_A195 Crystal Structure Of Superoxide Dismutase From Fran 2e-22
3tqj_A210 Structure Of The Superoxide Dismutase (Fe) (Sodb) F 4e-22
3sdp_A195 The 2.1 Angstroms Resolution Structure Of Iron Supe 5e-22
1dt0_A197 Cloning, Sequence, And Crystallographic Structure O 1e-21
1isa_A192 Structure-Function In E. Coli Iron Superoxide Dismu 2e-21
2nyb_A192 Crystal Structure Of E.Coli Iron Superoxide Dismuta 6e-21
1za5_A192 Q69h-Fesod Length = 192 1e-20
3js4_A227 Crystal Structure Of Iron Superoxide Dismutase From 2e-20
3lio_A192 X-Ray Structure Of The Iron Superoxide Dismutase Fr 1e-19
2cw2_A226 Crystal Structure Of Superoxide Dismutase From P. M 1e-19
2w7w_A194 The Crystal Structure Of Iron Superoxide Dismutase 7e-18
2a03_A206 Superoxide Dismutase Protein From Plasmodium Berghe 2e-17
2bpi_A206 Stucture Of Iron Dependent Superoxide Dismutase Fro 4e-17
2goj_A197 The Crystal Structure Of The Enzyme Fe-Superoxide D 4e-17
1qnn_A191 Cambialistic Superoxide Dismutase From Porphyromona 1e-16
1ues_A191 Crystal Structure Of Porphyromonas Gingivalis Sod L 1e-16
2awp_A198 Crystal Structure Of Plasmodium Knowlesi Structure 1e-16
1xuq_A212 Crystal Structure Of Soda-1 (Ba4499) From Bacillus 5e-15
3tjt_A208 Crystal Structure Analysis Of The Superoxide Dismut 1e-14
4f2n_A230 Crystal Structure Of Iron Superoxide Dismutase From 4e-14
1vew_A205 Manganese Superoxide Dismutase From Escherichia Col 1e-13
1en4_A205 Crystal Structure Analysis Of The E. Coli Manganese 1e-13
1i0h_A205 Crystal Structure Of The E. Coli Manganese Superoxi 1e-13
1en6_A205 Crystal Structure Analysis Of The E. Coli Manganese 1e-13
1y67_A229 Crystal Structure Of Manganese Superoxide Dismutase 2e-13
2rcv_A202 Crystal Structure Of The Bacillus Subtilis Superoxi 2e-13
3cei_A213 Crystal Structure Of Superoxide Dismutase From Heli 2e-13
1en5_A205 Crystal Structure Analysis Of The E. Coli Manganese 4e-13
2cdy_A231 Manganese Superoxide Dismutase (Mn-Sod) From Deinoc 4e-13
3kky_A211 Structure Of Manganese Superoxide Dismutase From De 4e-13
4h3e_A241 Crystal Structure Of A Putative Iron Superoxide Dis 1e-12
1i08_A205 Crystal Structure Analysis Of The H30a Mutant Of Ma 1e-12
1jr9_A202 Crystal Structure Of Manganese Superoxide Dismutase 3e-12
3mds_A203 Maganese Superoxide Dismutase From Thermus Thermoph 4e-12
3esf_A197 Crystal Structure Of The Enzyme Fe-Superoxide Dismu 1e-11
2gpc_A194 The Crystal Structure Of The Enzyme Fe-Superoxide D 1e-10
1gv3_A248 The 2.0 Angstrom Resolution Structure Of The Cataly 9e-10
1xre_A217 Crystal Structure Of Soda-2 (Ba5696) From Bacillus 2e-09
1var_A198 Mitochondrial Manganese Superoxide Dismutase Varian 7e-09
1ja8_A198 Kinetic Analysis Of Product Inhibition In Human Man 8e-09
3c3s_A198 Role Of A Glutamate Bridge Spanning The Dimeric Int 9e-09
1em1_A198 X-Ray Crystal Structure For Human Manganese Superox 9e-09
2qka_A196 Structural And Kinetic Study Of The Differences Bet 9e-09
1msd_A198 Comparison Of The Crystal Structures Of Genetically 9e-09
3c3t_A198 Role Of A Glutamate Bridge Spanning The Dimeric Int 9e-09
1pl4_A198 Crystal Structure Of Human Mnsod Y166f Mutant Lengt 9e-09
1n0j_A199 The Structure Of Human Mitochondrial Mn3+ Superoxid 9e-09
1qnm_A198 Human Manganese Superoxide Dismutase Mutant Q143n L 9e-09
2qkc_A196 Structural And Kinetic Study Of The Differences Bet 9e-09
1ap5_A198 Tyr34->phe Mutant Of Human Mitochondrial Manganese 2e-08
2cw3_A280 X-Ray Structure Of Pmsod2, Superoxide Dismutase Fro 3e-08
1zte_A198 Contribution To Structure And Catalysis Of Tyrosine 3e-08
1kkc_A221 Crystal Structure Of Aspergillus Fumigatus Mnsod Le 4e-08
2gds_A198 Interrupting The Hydrogen Bonding Network At The Ac 6e-08
1pm9_A198 Crystal Structure Of Human Mnsod H30n, Y166f Mutant 6e-08
1luw_A198 Catalytic And Structural Effects Of Amino-Acid Subs 6e-08
1zuq_A198 Contribution To Structure And Catalysis Of Tyrosine 6e-08
2adp_A198 Nitrated Human Manganese Superoxide Dismutase Lengt 7e-08
1zsp_A198 Contribution To Structure And Catalysis Of Tyrosine 8e-08
2p4k_A198 Contribution To Structure And Catalysis Of Tyrosine 9e-08
1n0n_A199 Catalytic And Structural Effects Of Amino-Acid Subs 1e-07
1xil_A198 Hydrogen Bonding In Human Manganese Superoxide Dism 1e-07
1szx_A198 Role Of Hydrogen Bonding In The Active Site Of Huma 2e-07
1xdc_A198 Hydrogen Bonding In Human Manganese Superoxide Dism 3e-07
1ma1_A205 Structure And Properties Of The Atypical Iron Super 4e-07
1ar4_A201 X-Ray Structure Analysis Of The Cambialistic Supero 5e-07
1wb8_A210 Iron Superoxide Dismutase (Fe-Sod) From The Hyperth 2e-06
3dc6_A198 Crystal Structure Of A Manganese Superoxide Dismuta 3e-06
1wb7_A210 Iron Superoxide Dismutase (Fe-Sod) From The Hyperth 4e-06
3dc5_A195 Crystal Structure Of A Manganese Superoxide Dismuta 6e-06
3evk_A222 Crystal Structure Of The Metal-Bound Superoxide Dis 1e-05
1gn3_A207 H145q Mutant Of Mycobacterium Tuberculosis Iron-Sup 5e-05
1gn4_A207 H145e Mutant Of Mycobacterium Tuberculosis Iron-Sup 5e-05
1ids_A207 X-Ray Structure Analysis Of The Iron-Dependent Supe 5e-05
1gn6_A207 G152a Mutant Of Mycobacterium Tuberculosis Iron-Sup 6e-05
3ak1_A214 Superoxide Dismutase From Aeropyrum Pernix K1, Apo- 1e-04
4ffk_A223 X-Ray Structure Of Iron Superoxide Dismutase From A 1e-04
1gn2_A207 S123c Mutant Of The Iron-Superoxide Dismutase From 1e-04
3qvn_A206 Crystal Structure Of Cytosolic Mnsod3 From Candida 2e-04
1b06_A210 Superoxide Dismutase From Sulfolobus Acidocaldarius 2e-04
>pdb|1UNF|X Chain X, The Crystal Structure Of The Eukaryotic Fesod From Vigna Unguiculata Suggests A New Enzymatic Mechanism Length = 238 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (459), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 86/139 (61%), Positives = 99/139 (71%), Gaps = 1/139 (0%)
Query: 41  KTGGRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKS 100
           K G +++AKF+LKPPPYPLN LEP MS+ TLEFHWGKHHR YV+NL KQ+VGTEL DGKS
Sbjct: 10  KEGPKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTEL-DGKS 68
Query: 101 LEDVVIASYNKGDLLPAFNNAAQAWNHDFFWXXXXXXXXXXXXXXXXXLIERDFGSXXXX 160
           LE++++ +YNKGD+LPAFNNAAQ WNHDFFW                 LIERDFGS    
Sbjct: 69  LEEIIVTAYNKGDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELLELIERDFGSFEKF 128
Query: 161 XXXXXXXXXTQFGSGWAWL 179
                    TQFGSGWAWL
Sbjct: 129 LDEFKAAAATQFGSGWAWL 147
>pdb|1MY6|A Chain A, The 1.6 A Structure Of Fe-superoxide Dismutase From The Thermophilic Cyanobacterium Thermosynechococcus Elongatus : Correlation Of Epr And Structural Characteristics Length = 199 Back     alignment and structure
>pdb|3H1S|A Chain A, Crystal Structure Of Superoxide Dismutase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 195 Back     alignment and structure
>pdb|3TQJ|A Chain A, Structure Of The Superoxide Dismutase (Fe) (Sodb) From Coxiella Burnetii Length = 210 Back     alignment and structure
>pdb|3SDP|A Chain A, The 2.1 Angstroms Resolution Structure Of Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 195 Back     alignment and structure
>pdb|1DT0|A Chain A, Cloning, Sequence, And Crystallographic Structure Of Recombinant Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 197 Back     alignment and structure
>pdb|1ISA|A Chain A, Structure-Function In E. Coli Iron Superoxide Dismutase: Comparisons With The Manganese Enzyme From T. Thermophilus Length = 192 Back     alignment and structure
>pdb|2NYB|A Chain A, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e At 1.1 Angstrom Resolution Length = 192 Back     alignment and structure
>pdb|1ZA5|A Chain A, Q69h-Fesod Length = 192 Back     alignment and structure
>pdb|3JS4|A Chain A, Crystal Structure Of Iron Superoxide Dismutase From Anaplasma Phagocytophilum Length = 227 Back     alignment and structure
>pdb|3LIO|A Chain A, X-Ray Structure Of The Iron Superoxide Dismutase From Pseudoalteromonas Haloplanktis (Crystal Form I) Length = 192 Back     alignment and structure
>pdb|2CW2|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Marinus Length = 226 Back     alignment and structure
>pdb|2W7W|A Chain A, The Crystal Structure Of Iron Superoxide Dismutase From Aliivibrio Salmonicida. Length = 194 Back     alignment and structure
>pdb|2A03|A Chain A, Superoxide Dismutase Protein From Plasmodium Berghei Length = 206 Back     alignment and structure
>pdb|2BPI|A Chain A, Stucture Of Iron Dependent Superoxide Dismutase From P. Falciparum. Length = 206 Back     alignment and structure
>pdb|2GOJ|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Plasmodium Falciparum Length = 197 Back     alignment and structure
>pdb|1QNN|A Chain A, Cambialistic Superoxide Dismutase From Porphyromonas Gingivalis Length = 191 Back     alignment and structure
>pdb|1UES|A Chain A, Crystal Structure Of Porphyromonas Gingivalis Sod Length = 191 Back     alignment and structure
>pdb|2AWP|A Chain A, Crystal Structure Of Plasmodium Knowlesi Structure Of Iron Super-Oxide Dismutase Length = 198 Back     alignment and structure
>pdb|1XUQ|A Chain A, Crystal Structure Of Soda-1 (Ba4499) From Bacillus Anthracis At 1.8a Resolution. Length = 212 Back     alignment and structure
>pdb|3TJT|A Chain A, Crystal Structure Analysis Of The Superoxide Dismutase From Clostridium Difficile Length = 208 Back     alignment and structure
>pdb|4F2N|A Chain A, Crystal Structure Of Iron Superoxide Dismutase From Leishmania Major Length = 230 Back     alignment and structure
>pdb|1VEW|A Chain A, Manganese Superoxide Dismutase From Escherichia Coli Length = 205 Back     alignment and structure
>pdb|1EN4|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146h Mutant Length = 205 Back     alignment and structure
>pdb|1I0H|A Chain A, Crystal Structure Of The E. Coli Manganese Superoxide Dismutase Mutant Y174f At 1.35 Angstroms Resolution. Length = 205 Back     alignment and structure
>pdb|1EN6|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146l Mutant Length = 205 Back     alignment and structure
>pdb|1Y67|A Chain A, Crystal Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans Length = 229 Back     alignment and structure
>pdb|2RCV|A Chain A, Crystal Structure Of The Bacillus Subtilis Superoxide Dismutase Length = 202 Back     alignment and structure
>pdb|3CEI|A Chain A, Crystal Structure Of Superoxide Dismutase From Helicobacter Pylori Length = 213 Back     alignment and structure
>pdb|1EN5|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Y34f Mutant Length = 205 Back     alignment and structure
>pdb|2CDY|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus Radiodurans Length = 231 Back     alignment and structure
>pdb|3KKY|A Chain A, Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans In The Orthorhombic Space Group P212121: A Case Study Of Mistaken Identity Length = 211 Back     alignment and structure
>pdb|4H3E|A Chain A, Crystal Structure Of A Putative Iron Superoxide Dismutase From Trypanosoma Cruzi Bound To Iron Length = 241 Back     alignment and structure
>pdb|1I08|A Chain A, Crystal Structure Analysis Of The H30a Mutant Of Manganese Superoxide Dismutase From E. Coli Length = 205 Back     alignment and structure
>pdb|1JR9|A Chain A, Crystal Structure Of Manganese Superoxide Dismutases From Bacillus Halodenitrificans Length = 202 Back     alignment and structure
>pdb|3MDS|A Chain A, Maganese Superoxide Dismutase From Thermus Thermophilus Length = 203 Back     alignment and structure
>pdb|3ESF|A Chain A, Crystal Structure Of The Enzyme Fe-Superoxide Dismutase Tbsodb2 From Trypanosoma Brucei Length = 197 Back     alignment and structure
>pdb|2GPC|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Trypanosoma Cruzi Length = 194 Back     alignment and structure
>pdb|1GV3|A Chain A, The 2.0 Angstrom Resolution Structure Of The Catalytic Portion Of A Cyanobacterial Membrane-Bound Manganese Superoxide Dismutase Length = 248 Back     alignment and structure
>pdb|1XRE|A Chain A, Crystal Structure Of Soda-2 (Ba5696) From Bacillus Anthracis At 1.8a Resolution. Length = 217 Back     alignment and structure
>pdb|1VAR|A Chain A, Mitochondrial Manganese Superoxide Dismutase Variant With Ile 58 Replaced By Thr Length = 198 Back     alignment and structure
>pdb|1JA8|A Chain A, Kinetic Analysis Of Product Inhibition In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|3C3S|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1EM1|A Chain A, X-Ray Crystal Structure For Human Manganese Superoxide Dismutase, Q143a Length = 198 Back     alignment and structure
>pdb|2QKA|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>pdb|1MSD|A Chain A, Comparison Of The Crystal Structures Of Genetically Engineered Human Manganese Superoxide Dismutase And Manganese Superoxide Dismutase From Thermus Thermophilus. Differences In Dimer-Dimer Interactions. Length = 198 Back     alignment and structure
>pdb|3C3T|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1PL4|A Chain A, Crystal Structure Of Human Mnsod Y166f Mutant Length = 198 Back     alignment and structure
>pdb|1N0J|A Chain A, The Structure Of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals A Novel Tetrameric Interface Of Two 4-Helix Bundles Length = 199 Back     alignment and structure
>pdb|1QNM|A Chain A, Human Manganese Superoxide Dismutase Mutant Q143n Length = 198 Back     alignment and structure
>pdb|2QKC|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>pdb|1AP5|A Chain A, Tyr34->phe Mutant Of Human Mitochondrial Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|2CW3|A Chain A, X-Ray Structure Of Pmsod2, Superoxide Dismutase From Perkinsus Marinus Length = 280 Back     alignment and structure
>pdb|1ZTE|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Suerpoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1KKC|A Chain A, Crystal Structure Of Aspergillus Fumigatus Mnsod Length = 221 Back     alignment and structure
>pdb|2GDS|A Chain A, Interrupting The Hydrogen Bonding Network At The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1PM9|A Chain A, Crystal Structure Of Human Mnsod H30n, Y166f Mutant Length = 198 Back     alignment and structure
>pdb|1LUW|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His 30 In Human Manganese Superoxide Dismutase: Insertion Of Val Cgamma Into The Substrate Access Channel Length = 198 Back     alignment and structure
>pdb|1ZUQ|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|2ADP|A Chain A, Nitrated Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1ZSP|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|2P4K|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1N0N|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His30 In Human Manganese Superoxide Dismutase Length = 199 Back     alignment and structure
>pdb|1XIL|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3- Fluorotyrosine Length = 198 Back     alignment and structure
>pdb|1SZX|A Chain A, Role Of Hydrogen Bonding In The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1XDC|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3- Fluorotyrosine Length = 198 Back     alignment and structure
>pdb|1MA1|A Chain A, Structure And Properties Of The Atypical Iron Superoxide Dismutase From Methanobacterium Thermoautotrophicum Length = 205 Back     alignment and structure
>pdb|1AR4|A Chain A, X-Ray Structure Analysis Of The Cambialistic Superoxide Dismutase From Propionibacterium Shermanii Active With Fe Or Mn Length = 201 Back     alignment and structure
>pdb|1WB8|A Chain A, Iron Superoxide Dismutase (Fe-Sod) From The Hyperthermophile Sulfolobus Solfataricus. 2.3 A Resolution Structure Of Recombinant Protein With A Covalently Modified Tyrosin In The Active Site. Length = 210 Back     alignment and structure
>pdb|3DC6|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 198 Back     alignment and structure
>pdb|1WB7|A Chain A, Iron Superoxide Dismutase (Fe-Sod) From The Hyperthermophile Sulfolobus Solfataricus. Crystal Structure Of The Y41f Mutant. Length = 210 Back     alignment and structure
>pdb|3DC5|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 195 Back     alignment and structure
>pdb|3EVK|A Chain A, Crystal Structure Of The Metal-Bound Superoxide Dismutase From Pyrobaculum Aerophilum Length = 222 Back     alignment and structure
>pdb|1GN3|A Chain A, H145q Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>pdb|1GN4|A Chain A, H145e Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>pdb|1IDS|A Chain A, X-Ray Structure Analysis Of The Iron-Dependent Superoxide Dismutase From Mycobacterium Tuberculosis At 2.0 Angstroms Resolutions Reveals Novel Dimer-Dimer Interactions Length = 207 Back     alignment and structure
>pdb|1GN6|A Chain A, G152a Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>pdb|3AK1|A Chain A, Superoxide Dismutase From Aeropyrum Pernix K1, Apo-Form Length = 214 Back     alignment and structure
>pdb|4FFK|A Chain A, X-Ray Structure Of Iron Superoxide Dismutase From Acidilobus Saccharovorans Length = 223 Back     alignment and structure
>pdb|1GN2|A Chain A, S123c Mutant Of The Iron-Superoxide Dismutase From Mycobacterium Tuberculosis. Length = 207 Back     alignment and structure
>pdb|3QVN|A Chain A, Crystal Structure Of Cytosolic Mnsod3 From Candida Albicans Length = 206 Back     alignment and structure
>pdb|1B06|A Chain A, Superoxide Dismutase From Sulfolobus Acidocaldarius Length = 210 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
1unf_X238 Iron superoxide dismutase; oxidoreductase, eukaryo 6e-86
1my6_A199 Iron (III) superoxide dismutase; iron speroxide di 7e-79
3js4_A227 Superoxide dismutase; niaid, ssgcid, seattle struc 6e-77
3lio_A192 Iron superoxide dismutase; cold adaptation, flexib 4e-76
2nyb_A192 Superoxide dismutase [FE]; iron superoxide dismuta 5e-76
2awp_A198 Iron super-oxide dismutase; structural genomics, s 1e-75
1uer_A191 SOD, superoxide dismutase; metal-specific, cambial 2e-75
1dt0_A197 Superoxide dismutase; pseudomonas ovalis, oxidored 3e-75
3tqj_A210 Superoxide dismutase [FE]; oxidoreductase; 2.00A { 3e-75
2cw2_A226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A 2e-73
3h1s_A195 Superoxide dismutase; SOBD, csgid, oxidoreductase, 3e-73
3cei_A213 Superoxide dismutase; oxidoreductase; 2.40A {Helic 4e-73
4f2n_A230 Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em 2e-71
2gpc_A194 Iron superoxide dismutase; alpha+beta structure, o 2e-71
2rcv_A202 Superoxide dismutase [MN]; bacillus subtilis,super 1e-68
2cw3_A280 Pmsod2, iron superoxide dismutase; oxidoreductase; 3e-68
3kky_A211 Mnsod, superoxide dismutase [MN]; manganese, ME bi 1e-67
1gv3_A248 Manganese superoxide dismutase; anabaena PCC 7120, 1e-66
1xre_A217 SODA-2, superoxide dismutase; spine, oxidoreductas 3e-65
1mng_A203 Manganese superoxide dismutase; oxidoreductase(sup 5e-63
1ix9_A205 Mnsod, superoxide dismutase; manganese superoxide 2e-61
4ffk_A223 Superoxide dismutase; oxidoreductase, superoxide a 4e-57
1ma1_A205 Superoxide dismutase; metal specificity, azide inh 6e-57
1b06_A210 Protein (superoxide dismutase); oxidoreductase; 2. 8e-57
1pl4_A198 Superoxide dismutase [MN], mitochondrial; oxidored 1e-56
1ids_A207 Iron superoxide dismutase; 2.00A {Mycobacterium tu 2e-56
3rn4_A215 Superoxide dismutase [MN], mitochondrial; mitochon 1e-54
1bsm_A201 Superoxide dismutase; oxidoreductase; 1.35A {Propi 2e-54
3dc5_A195 Superoxide dismutase [MN] 2; alpha hairpin N domai 5e-54
3ak2_A214 Superoxide dismutase [MN/FE]; cambialistic, oxidor 6e-54
1coj_A212 Protein (superoxide dismutase); oxidoreductase; 1. 3e-52
1kkc_A221 Mnsod, manganese superoxide dismutase; homotetrame 3e-51
3qvn_A206 Manganese-containing superoxide dismutase; Mn supe 7e-50
>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Length = 238 Back     alignment and structure
 Score =  251 bits (644), Expect = 6e-86
 Identities = 113/140 (80%), Positives = 127/140 (90%), Gaps = 1/140 (0%)

Query: 41  KTGGRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKS 100
           K G +++AKF+LKPPPYPLN LEP MS+ TLEFHWGKHHR YV+NL KQ+VGTEL DGKS
Sbjct: 10  KEGPKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTEL-DGKS 68

Query: 101 LEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKF 160
           LE++++ +YNKGD+LPAFNNAAQ WNHDFFWE MKPGGGGKPSGELL LIERDFGSFEKF
Sbjct: 69  LEEIIVTAYNKGDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELLELIERDFGSFEKF 128

Query: 161 LEEFKAAAATQFGSGWAWLV 180
           L+EFKAAAATQFGSGWAWL 
Sbjct: 129 LDEFKAAAATQFGSGWAWLA 148
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Length = 199 Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} Length = 227 Back     alignment and structure
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Length = 192 Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Length = 192 Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Length = 198 Back     alignment and structure
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Length = 191 Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 Length = 197 Back     alignment and structure
>3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} Length = 210 Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Length = 226 Back     alignment and structure
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} Length = 195 Back     alignment and structure
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Length = 213 Back     alignment and structure
>4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} Length = 230 Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Length = 194 Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Length = 202 Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Length = 280 Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Length = 211 Back     alignment and structure
>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Length = 248 Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Length = 217 Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Length = 203 Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A Length = 205 Back     alignment and structure
>4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} Length = 223 Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Length = 205 Back     alignment and structure
>1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Length = 210 Back     alignment and structure
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Length = 198 Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Length = 207 Back     alignment and structure
>3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* Length = 215 Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Length = 201 Back     alignment and structure
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Length = 195 Back     alignment and structure
>3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A Length = 214 Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Length = 212 Back     alignment and structure
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Length = 221 Back     alignment and structure
>3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} Length = 206 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
1uer_A191 SOD, superoxide dismutase; metal-specific, cambial 100.0
3h1s_A195 Superoxide dismutase; SOBD, csgid, oxidoreductase, 100.0
1my6_A199 Iron (III) superoxide dismutase; iron speroxide di 100.0
2awp_A198 Iron super-oxide dismutase; structural genomics, s 100.0
3tqj_A210 Superoxide dismutase [FE]; oxidoreductase; 2.00A { 100.0
1mng_A203 Manganese superoxide dismutase; oxidoreductase(sup 100.0
3lio_A192 Iron superoxide dismutase; cold adaptation, flexib 100.0
2nyb_A192 Superoxide dismutase [FE]; iron superoxide dismuta 100.0
1dt0_A197 Superoxide dismutase; pseudomonas ovalis, oxidored 100.0
1unf_X238 Iron superoxide dismutase; oxidoreductase, eukaryo 100.0
3kky_A211 Mnsod, superoxide dismutase [MN]; manganese, ME bi 100.0
1xre_A217 SODA-2, superoxide dismutase; spine, oxidoreductas 100.0
2rcv_A202 Superoxide dismutase [MN]; bacillus subtilis,super 100.0
4f2n_A230 Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em 100.0
2gpc_A194 Iron superoxide dismutase; alpha+beta structure, o 100.0
4h3e_A241 Fesod, superoxide dismutase; structural genomics, 100.0
3js4_A227 Superoxide dismutase; niaid, ssgcid, seattle struc 100.0
1gv3_A248 Manganese superoxide dismutase; anabaena PCC 7120, 100.0
3cei_A213 Superoxide dismutase; oxidoreductase; 2.40A {Helic 100.0
1ix9_A205 Mnsod, superoxide dismutase; manganese superoxide 100.0
3tjt_A208 Superoxide dismutase; metal ION binding, rossmann 100.0
2cw2_A226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A 100.0
1pl4_A198 Superoxide dismutase [MN], mitochondrial; oxidored 100.0
3dc5_A195 Superoxide dismutase [MN] 2; alpha hairpin N domai 100.0
4ffk_A223 Superoxide dismutase; oxidoreductase, superoxide a 100.0
1ids_A207 Iron superoxide dismutase; 2.00A {Mycobacterium tu 100.0
1b06_A210 Protein (superoxide dismutase); oxidoreductase; 2. 100.0
3qvn_A206 Manganese-containing superoxide dismutase; Mn supe 100.0
3rn4_A215 Superoxide dismutase [MN], mitochondrial; mitochon 100.0
1bsm_A201 Superoxide dismutase; oxidoreductase; 1.35A {Propi 100.0
1ma1_A205 Superoxide dismutase; metal specificity, azide inh 100.0
3ak2_A214 Superoxide dismutase [MN/FE]; cambialistic, oxidor 100.0
1kkc_A221 Mnsod, manganese superoxide dismutase; homotetrame 100.0
2cw3_A280 Pmsod2, iron superoxide dismutase; oxidoreductase; 100.0
1coj_A212 Protein (superoxide dismutase); oxidoreductase; 1. 100.0
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Back     alignment and structure
Probab=100.00  E-value=3.3e-52  Score=342.59  Aligned_cols=130  Identities=49%  Similarity=0.886  Sum_probs=122.3

Q ss_pred             cceeeCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhhhccccCCCCCHHHHHHHhhcCCCCcchhcchhhhhhh
Q 029939           48 AKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNH  127 (185)
Q Consensus        48 ~~f~lp~LpY~~~aLeP~IS~~tl~~H~~khh~~YV~~LN~~l~~t~~~~~~~l~~ii~~~~~~~~~~~ifN~ag~~~NH  127 (185)
                      |+|+||+|||+|++|||+||++||++||+|||++||+|||++++++++ +++++++++....     ..+||||||++||
T Consensus         1 m~~~Lp~Lpy~~~aLep~is~~tm~~Hh~kHh~~YV~~lN~~~~~~~~-~~~~~~~ii~~~~-----~~i~nn~gg~~NH   74 (191)
T 1uer_A            1 MTHELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEF-ENADLNTIVQKSE-----GGIFNNAGQTLNH   74 (191)
T ss_dssp             CCCCCCCCSSCTTTTTTTTCHHHHHHHTTTHHHHHHHHHHHHTTTSTT-TTCCHHHHHHHCC-----HHHHHHHHHHHHH
T ss_pred             CCccCCCCCCCccccccccCHHHHHHHHHHHHHHHHHHHHHHHhhhhh-hcCCHHHHHHHHH-----HHHHHHHHHHHHH
Confidence            579999999999999999999999999999999999999999999888 8899999886532     1699999999999


Q ss_pred             hhhhhccCCCCCCCCcHHHHHHHHhhcCCHHHHHHHHHHHHhcCCCccEEEEEEcC
Q 029939          128 DFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVSAP  183 (185)
Q Consensus       128 ~ffw~~L~P~~~~~P~g~L~~aI~~sFGS~d~fk~~F~~aA~s~fGSGWvWLv~d~  183 (185)
                      +|||+||+|+++++|+++|+++|+++|||||+||++|+++|.++|||||+|||+|+
T Consensus        75 ~~fw~~L~P~gg~~P~g~L~~aI~~~FGS~d~fk~~f~~aa~~~fGSGW~WLv~~~  130 (191)
T 1uer_A           75 NLYFTQFRPGKGGAPKGKLGEAIDKQFGSFEKFKEEFNTAGTTLFGSGWVWLASDA  130 (191)
T ss_dssp             HHHHHTBCTTCCSCCCHHHHHHHHHHHSSHHHHHHHHHHHHHHCCSSEEEEEEECT
T ss_pred             HHHHHhcCCCCCCCCCHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCeEEEEEECC
Confidence            99999999987778999999999999999999999999999999999999999985
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} Back     alignment and structure
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Back     alignment and structure
>3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Back     alignment and structure
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Back     alignment and structure
>4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Back     alignment and structure
>4h3e_A Fesod, superoxide dismutase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Trypanosoma cruzi} Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A Back     alignment and structure
>3tjt_A Superoxide dismutase; metal ION binding, rossmann fold, oxidoreductase; 1.80A {Clostridium difficile} Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Back     alignment and structure
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Back     alignment and structure
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Back     alignment and structure
>4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Back     alignment and structure
>1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Back     alignment and structure
>3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} Back     alignment and structure
>3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* 4e4e_A* Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A Back     alignment and structure
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d1unfx191 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD 3e-36
d1jr9a190 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) 9e-32
d1gv3a1102 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD 2e-30
d1ix9a190 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) 4e-30
d1my6a188 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) 2e-29
d1mnga192 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) 8e-29
d1p7ga192 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD 2e-28
d1uera184 a.2.11.1 (A:1-84) Cambialistic superoxide dismutas 2e-28
d2nyba182 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) 4e-28
d1kkca184 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) 2e-27
d1bsma186 a.2.11.1 (A:1-86) Cambialistic superoxide dismutas 2e-27
d1ma1a188 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) 1e-26
d2p4ka183 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) 5e-26
d1wb8a189 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) 8e-26
d1coja189 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) 9e-26
d1idsa184 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) 1e-25
d1unfx2134 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSO 2e-15
d1ma1a2113 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD 2e-13
d1my6a2110 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD 5e-13
d2nyba2110 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD 1e-12
d1wb8a2116 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD 6e-12
d1gv3a2111 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSO 6e-12
d1jr9a2111 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD 7e-12
d1mnga2111 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD 1e-11
d1bsma2115 d.44.1.1 (A:87-201) Cambialistic superoxide dismut 2e-11
d1ix9a2115 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD 3e-11
d1p7ga2119 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSO 3e-11
d1coja2122 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD 3e-11
d1y67a2116 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD 3e-11
d1idsa2114 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD 4e-11
d2p4ka2115 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD 4e-11
d1uera2107 d.44.1.1 (A:85-191) Cambialistic superoxide dismut 5e-11
d1dt0a2114 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD 6e-11
d1kkca2116 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD 1e-10
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 91 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Fe,Mn superoxide dismutase (SOD), N-terminal domain
family: Fe,Mn superoxide dismutase (SOD), N-terminal domain
domain: Fe superoxide dismutase (FeSOD)
species: Cowpea (Vigna unguiculata) [TaxId: 3917]

 Score =  119 bits (300), Expect = 3e-36
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 1/92 (1%)

Query: 45  RISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDV 104
           +++AKF+LKPPPYPLN LEP MS+ TLEFHWGKHHR YV+NL KQ+VGTEL DGKSLE++
Sbjct: 1   KVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTEL-DGKSLEEI 59

Query: 105 VIASYNKGDLLPAFNNAAQAWNHDFFWESMKP 136
           ++ +YNKGD+LPAFNNAAQ WNHDFFWE MKP
Sbjct: 60  IVTAYNKGDILPAFNNAAQVWNHDFFWECMKP 91
>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 90 Back     information, alignment and structure
>d1gv3a1 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 102 Back     information, alignment and structure
>d1ix9a1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 90 Back     information, alignment and structure
>d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 88 Back     information, alignment and structure
>d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 92 Back     information, alignment and structure
>d1p7ga1 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 92 Back     information, alignment and structure
>d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 84 Back     information, alignment and structure
>d2nyba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Length = 82 Back     information, alignment and structure
>d1kkca1 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Length = 84 Back     information, alignment and structure
>d1bsma1 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 86 Back     information, alignment and structure
>d1ma1a1 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 88 Back     information, alignment and structure
>d2p4ka1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 89 Back     information, alignment and structure
>d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 89 Back     information, alignment and structure
>d1idsa1 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 84 Back     information, alignment and structure
>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 134 Back     information, alignment and structure
>d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 113 Back     information, alignment and structure
>d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 110 Back     information, alignment and structure
>d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Length = 110 Back     information, alignment and structure
>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 116 Back     information, alignment and structure
>d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 111 Back     information, alignment and structure
>d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 111 Back     information, alignment and structure
>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 111 Back     information, alignment and structure
>d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 115 Back     information, alignment and structure
>d1ix9a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1p7ga2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 119 Back     information, alignment and structure
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 122 Back     information, alignment and structure
>d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} Length = 116 Back     information, alignment and structure
>d1idsa2 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 114 Back     information, alignment and structure
>d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 107 Back     information, alignment and structure
>d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} Length = 114 Back     information, alignment and structure
>d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Length = 116 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d1unfx191 Fe superoxide dismutase (FeSOD) {Cowpea (Vigna ung 100.0
d1my6a188 Fe superoxide dismutase (FeSOD) {Thermosynechococc 100.0
d1uera184 Cambialistic superoxide dismutase {Porphyromonas g 100.0
d2nyba182 Fe superoxide dismutase (FeSOD) {Escherichia coli 100.0
d1mnga192 Mn superoxide dismutase (MnSOD) {Thermus thermophi 100.0
d1gv3a1102 Mn superoxide dismutase (MnSOD) {Anabaena sp. [Tax 100.0
d1jr9a190 Mn superoxide dismutase (MnSOD) {Bacillus halodeni 100.0
d1ix9a190 Mn superoxide dismutase (MnSOD) {Escherichia coli 99.98
d1p7ga192 Fe superoxide dismutase (FeSOD) {Archaeon Pyrobacu 99.98
d1bsma186 Cambialistic superoxide dismutase {Propionibacteri 99.97
d1kkca184 Mn superoxide dismutase (MnSOD) {Aspergillus fumig 99.97
d2p4ka183 Mn superoxide dismutase (MnSOD) {Human (Homo sapie 99.97
d1ma1a188 Fe superoxide dismutase (FeSOD) {Archaeon Methanob 99.97
d1idsa184 Fe superoxide dismutase (FeSOD) {Mycobacterium tub 99.97
d1wb8a189 Fe superoxide dismutase (FeSOD) {Archaeon Sulfolob 99.97
d1coja189 Fe superoxide dismutase (FeSOD) {Aquifex pyrophilu 99.89
d2p4ka2115 Mn superoxide dismutase (MnSOD) {Human (Homo sapie 99.7
d1wb8a2116 Fe superoxide dismutase (FeSOD) {Archaeon Sulfolob 99.68
d1ma1a2113 Fe superoxide dismutase (FeSOD) {Archaeon Methanob 99.68
d1mnga2111 Mn superoxide dismutase (MnSOD) {Thermus thermophi 99.67
d2nyba2110 Fe superoxide dismutase (FeSOD) {Escherichia coli 99.66
d1p7ga2119 Fe superoxide dismutase (FeSOD) {Archaeon Pyrobacu 99.66
d1gv3a2111 Mn superoxide dismutase (MnSOD) {Anabaena sp. [Tax 99.66
d1idsa2114 Fe superoxide dismutase (FeSOD) {Mycobacterium tub 99.65
d1unfx2134 Fe superoxide dismutase (FeSOD) {Cowpea (Vigna ung 99.65
d1my6a2110 Fe superoxide dismutase (FeSOD) {Thermosynechococc 99.65
d1bsma2115 Cambialistic superoxide dismutase {Propionibacteri 99.63
d1kkca2116 Mn superoxide dismutase (MnSOD) {Aspergillus fumig 99.63
d1jr9a2111 Mn superoxide dismutase (MnSOD) {Bacillus halodeni 99.62
d1dt0a2114 Fe superoxide dismutase (FeSOD) {Pseudomonas ovali 99.62
d1uera2107 Cambialistic superoxide dismutase {Porphyromonas g 99.62
d1ix9a2115 Mn superoxide dismutase (MnSOD) {Escherichia coli 99.6
d1y67a2116 Mn superoxide dismutase (MnSOD) {Deinococcus radio 99.58
d1coja2122 Fe superoxide dismutase (FeSOD) {Aquifex pyrophilu 99.42
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Fe,Mn superoxide dismutase (SOD), N-terminal domain
family: Fe,Mn superoxide dismutase (SOD), N-terminal domain
domain: Fe superoxide dismutase (FeSOD)
species: Cowpea (Vigna unguiculata) [TaxId: 3917]

Probab=100.00  E-value=4e-37  Score=224.27  Aligned_cols=91  Identities=77%  Similarity=1.436  Sum_probs=82.5

Q ss_pred             ccccceeeCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhhhccccCCCCCHHHHHHHhhcCCCCcchhcchhhh
Q 029939           45 RISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQA  124 (185)
Q Consensus        45 ~~~~~f~lp~LpY~~~aLeP~IS~~tl~~H~~khh~~YV~~LN~~l~~t~~~~~~~l~~ii~~~~~~~~~~~ifN~ag~~  124 (185)
                      +++++|+||+|||+|++|||+||++||++||+|||++||++||+++++++. +.+++++++...........+||||||+
T Consensus         1 ~~~~kf~Lp~LPY~y~aLeP~Is~~tm~~H~~KHH~~YV~~lN~~l~~~~~-~~~~l~~~~~~~~~~~~~~~~~Nn~gg~   79 (91)
T d1unfx1           1 KVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTEL-DGKSLEEIIVTAYNKGDILPAFNNAAQV   79 (91)
T ss_dssp             CCSSSCCCCCCSSCTTTTTTTSCHHHHHHHTTTHHHHHHHHHHHHC--CTT-TTCCHHHHHHHHHGGGSCCTHHHHHHHH
T ss_pred             CCcceeeCCCCCCCccccccccCHHHHHHHHHHHHHHHHHHHHHHHHHhhh-hhchHHHHHHHhhccccHHHHHhcchhH
Confidence            467899999999999999999999999999999999999999999999888 8899999998776666666799999999


Q ss_pred             hhhhhhhhccCC
Q 029939          125 WNHDFFWESMKP  136 (185)
Q Consensus       125 ~NH~ffw~~L~P  136 (185)
                      |||+|||+||+|
T Consensus        80 ~NHslfW~~m~P   91 (91)
T d1unfx1          80 WNHDFFWECMKP   91 (91)
T ss_dssp             HHHHHHHHTBCT
T ss_pred             hhHHHHHhccCc
Confidence            999999999987
>d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2nyba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gv3a1 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Back     information, alignment and structure
>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1ix9a1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p7ga1 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1bsma1 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1kkca1 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2p4ka1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ma1a1 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1idsa1 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p7ga2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Back     information, alignment and structure
>d1idsa2 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Back     information, alignment and structure
>d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} Back     information, alignment and structure
>d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ix9a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure