Citrus Sinensis ID: 030144

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MIQLRFLKSPLLSSSNILSNFSPKPRTGTLLPHPVTKFKPLSQMDSYSTTTTSSSSSSSKLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGGFQAALSKS
ccEEEcccccccccccEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEEEcccccccEEEEccccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccEEcccccEEEEccEEEEEEEccccccccccc
ccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHccccccccccccccHHHHHccccccEEEEEEEccccccccEEEEccHHHHHHHHHHHHHHccccEEEEEEccccccHccHHHHHHHHccccEEEEcccccccccEEEccccEEEEccEEEEEEEccccccccccc
miqlrflkspllsssnilsnfspkprtgtllphpvtkfkplsqmdsysttttssssssskLLFRQTFEKESSTYTYLLAdvnhpdkpallidpvdktvdRDLNVIKELGLKLVYAMNThvhadhvtgtglikskvpgvKSIISkasgskadlhvehgdkvsfgDLFLEVCIVGGFQAALSKS
miqlrflkspllsssnilsnfspkprtgtllphpVTKFKPLSQMDSysttttssssssskLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHvtgtglikskvPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGGFQAALSKS
MIQLRFlkspllsssnilsnfspkPRTGTLLPHPVTKFKPLSQMDsysttttsssssssKLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVksiiskasgskaDLHVEHGDKVSFGDLFLEVCIVGGFQAALSKS
**********************************************************************SSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVKSIISKA****ADLHVEHGDKVSFGDLFLEVCIVGGFQA*****
********SP***************************************************LFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGG*QAA****
MIQLRFLKSPLLSSSNILSNFSPKPRTGTLLPHPVTKFKPLSQ*******************FRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGGFQAALSKS
*I****LK**************************VTKFKPLS****************SKLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGG********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQLRFLKSPLLSSSNILSNFSPKPRTGTLLPHPVTKFKPLSQMDSYSTTTTSSSSSSSKLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGGFQAALSKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
Q9C8L4 294 Hydroxyacylglutathione hy yes no 0.653 0.404 0.789 4e-49
Q9DCM0 254 Protein ETHE1, mitochondr yes no 0.631 0.452 0.538 6e-32
Q3T094 254 Protein ETHE1, mitochondr yes no 0.615 0.440 0.526 3e-31
O95571 254 Protein ETHE1, mitochondr yes no 0.631 0.452 0.521 6e-31
B1WUT9 257 Hydroxyacylglutathione hy no no 0.483 0.342 0.336 8e-06
Q7NG34 252 Hydroxyacylglutathione hy yes no 0.472 0.341 0.326 0.0001
B7K3R6 257 Hydroxyacylglutathione hy no no 0.538 0.381 0.302 0.0002
B7KEB4 257 Hydroxyacylglutathione hy no no 0.543 0.385 0.305 0.0003
Q8YZ99 257 Hydroxyacylglutathione hy no no 0.549 0.389 0.317 0.0003
Q10Y41 257 Hydroxyacylglutathione hy yes no 0.549 0.389 0.299 0.0003
>sp|Q9C8L4|GLO2O_ARATH Hydroxyacylglutathione hydrolase 3, mitochondrial OS=Arabidopsis thaliana GN=GLY3 PE=1 SV=3 Back     alignment and function desciption
 Score =  193 bits (491), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 94/119 (78%), Positives = 105/119 (88%)

Query: 60  KLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTH 119
           KLLFRQ FE ESST+TYLLADV+HPDKPALLIDPVDKTVDRDL +I ELGLKL+YAMNTH
Sbjct: 51  KLLFRQLFENESSTFTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTH 110

Query: 120 VHADHVTGTGLIKSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGGFQAA 178
           VHADHVTGTGL+K+K+PGVKS+ISKASGSKADL +E GDKVS GD++LEV    G  A 
Sbjct: 111 VHADHVTGTGLLKTKLPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAG 169
Thiolesterase that catalyzes the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 6
>sp|Q9DCM0|ETHE1_MOUSE Protein ETHE1, mitochondrial OS=Mus musculus GN=Ethe1 PE=1 SV=2 Back     alignment and function description
>sp|Q3T094|ETHE1_BOVIN Protein ETHE1, mitochondrial OS=Bos taurus GN=ETHE1 PE=2 SV=1 Back     alignment and function description
>sp|O95571|ETHE1_HUMAN Protein ETHE1, mitochondrial OS=Homo sapiens GN=ETHE1 PE=1 SV=2 Back     alignment and function description
>sp|B1WUT9|GLO2_CYAA5 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain ATCC 51142) GN=gloB PE=3 SV=1 Back     alignment and function description
>sp|Q7NG34|GLO2_GLOVI Hydroxyacylglutathione hydrolase OS=Gloeobacter violaceus (strain PCC 7421) GN=gloB PE=3 SV=1 Back     alignment and function description
>sp|B7K3R6|GLO2_CYAP8 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 8801) GN=gloB PE=3 SV=1 Back     alignment and function description
>sp|B7KEB4|GLO2_CYAP7 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 7424) GN=gloB PE=3 SV=1 Back     alignment and function description
>sp|Q8YZ99|GLO2_NOSS1 Hydroxyacylglutathione hydrolase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gloB PE=3 SV=1 Back     alignment and function description
>sp|Q10Y41|GLO2_TRIEI Hydroxyacylglutathione hydrolase OS=Trichodesmium erythraeum (strain IMS101) GN=gloB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
224056583251 predicted protein [Populus trichocarpa] 0.642 0.466 0.854 3e-51
255558692 301 glyoxalase II, putative [Ricinus communi 0.879 0.531 0.701 2e-50
414881078 322 TPA: hypothetical protein ZEAMMB73_62878 0.884 0.5 0.609 1e-49
414881079 295 TPA: hydroxyacylglutathione hydrolase 3 0.884 0.545 0.609 1e-49
357135856 302 PREDICTED: hydroxyacylglutathione hydrol 0.741 0.447 0.712 2e-49
388499798 288 unknown [Lotus japonicus] 0.653 0.413 0.815 3e-49
242058271 296 hypothetical protein SORBIDRAFT_03g03062 0.681 0.418 0.758 3e-49
225446805269 PREDICTED: hydroxyacylglutathione hydrol 0.653 0.442 0.815 5e-49
302143529258 unnamed protein product [Vitis vinifera] 0.653 0.461 0.815 6e-49
449456532 295 PREDICTED: hydroxyacylglutathione hydrol 0.895 0.552 0.674 9e-49
>gi|224056583|ref|XP_002298922.1| predicted protein [Populus trichocarpa] gi|222846180|gb|EEE83727.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (94%)

Query: 53  SSSSSSSKLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKL 112
           ++SS SSKL FRQ FEKESSTYTYLLADV+HPDKPALLIDPVDKTVDRDL+++KELGLKL
Sbjct: 5   TASSQSSKLFFRQLFEKESSTYTYLLADVSHPDKPALLIDPVDKTVDRDLSLVKELGLKL 64

Query: 113 VYAMNTHVHADHVTGTGLIKSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEV 169
           +YA+NTHVHADH+TGTGLIK+K PGVKSIISKASGSKAD+ VE GDKVSFGDLFLEV
Sbjct: 65  IYALNTHVHADHITGTGLIKTKSPGVKSIISKASGSKADILVEPGDKVSFGDLFLEV 121

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255558692|ref|XP_002520370.1| glyoxalase II, putative [Ricinus communis] gi|223540417|gb|EEF41986.1| glyoxalase II, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|414881078|tpg|DAA58209.1| TPA: hypothetical protein ZEAMMB73_628784 [Zea mays] Back     alignment and taxonomy information
>gi|414881079|tpg|DAA58210.1| TPA: hydroxyacylglutathione hydrolase 3 [Zea mays] Back     alignment and taxonomy information
>gi|357135856|ref|XP_003569524.1| PREDICTED: hydroxyacylglutathione hydrolase 3, mitochondrial-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|388499798|gb|AFK37965.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|242058271|ref|XP_002458281.1| hypothetical protein SORBIDRAFT_03g030620 [Sorghum bicolor] gi|241930256|gb|EES03401.1| hypothetical protein SORBIDRAFT_03g030620 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|225446805|ref|XP_002279121.1| PREDICTED: hydroxyacylglutathione hydrolase 3, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143529|emb|CBI22090.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449456532|ref|XP_004146003.1| PREDICTED: hydroxyacylglutathione hydrolase 3, mitochondrial-like [Cucumis sativus] gi|449503644|ref|XP_004162105.1| PREDICTED: hydroxyacylglutathione hydrolase 3, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
TAIR|locus:2024922 294 GLY3 "AT1G53580" [Arabidopsis 0.796 0.493 0.589 2e-40
UNIPROTKB|E2RFL0 254 ETHE1 "Uncharacterized protein 0.582 0.417 0.5 9.7e-25
ZFIN|ZDB-GENE-040426-2503 279 ethe1 "ethylmalonic encephalop 0.543 0.354 0.553 9.7e-25
MGI|MGI:1913321 254 Ethe1 "ethylmalonic encephalop 0.582 0.417 0.509 2e-24
UNIPROTKB|I3LLM9125 LOC100523003 "Uncharacterized 0.554 0.808 0.504 3.3e-24
UNIPROTKB|Q3T094 254 ETHE1 "Protein ETHE1, mitochon 0.582 0.417 0.490 4.2e-24
RGD|1311034 254 Ethe1 "ethylmalonic encephalop 0.582 0.417 0.5 4.2e-24
UNIPROTKB|O95571 254 ETHE1 "Protein ETHE1, mitochon 0.582 0.417 0.5 5.3e-24
UNIPROTKB|H9L167107 ETHE1 "Uncharacterized protein 0.560 0.953 0.480 8e-21
FB|FBgn0050022 279 CG30022 [Drosophila melanogast 0.598 0.390 0.410 4.4e-20
TAIR|locus:2024922 GLY3 "AT1G53580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 430 (156.4 bits), Expect = 2.0e-40, P = 2.0e-40
 Identities = 86/146 (58%), Positives = 100/146 (68%)

Query:    32 PHPVTKFKPLSQMDXXXXXXXXXXXXXXKLLFRQTFEKESSTYTYLLADVNHPDKPALLI 91
             P P+ +  P + +               KLLFRQ FE ESST+TYLLADV+HPDKPALLI
Sbjct:    24 PRPL-RSPPPTFLRSVMGSSSSFSSSSSKLLFRQLFENESSTFTYLLADVSHPDKPALLI 82

Query:    92 DPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVXXXXXXXXXXXXD 151
             DPVDKTVDRDL +I ELGLKL+YAMNTHVHADHVTGTGL+K+K+PGV            D
Sbjct:    83 DPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKASGSKAD 142

Query:   152 LHVEHGDKVSFGDLFLEVCIVGGFQA 177
             L +E GDKVS GD++LEV    G  A
Sbjct:   143 LFLEPGDKVSIGDIYLEVRATPGHTA 168
GO:0004416 "hydroxyacylglutathione hydrolase activity" evidence=ISS
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IDA
GO:0047951 "glutathione thiolesterase activity" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP
GO:0009960 "endosperm development" evidence=IMP
GO:0048316 "seed development" evidence=IMP
GO:0050313 "sulfur dioxygenase activity" evidence=IDA
GO:0055114 "oxidation-reduction process" evidence=IDA
UNIPROTKB|E2RFL0 ETHE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2503 ethe1 "ethylmalonic encephalopathy 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1913321 Ethe1 "ethylmalonic encephalopathy 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLM9 LOC100523003 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T094 ETHE1 "Protein ETHE1, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1311034 Ethe1 "ethylmalonic encephalopathy 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O95571 ETHE1 "Protein ETHE1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H9L167 ETHE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0050022 CG30022 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C8L4GLO2O_ARATH3, ., 1, ., 2, ., 60.78990.65380.4047yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.20.766
3rd Layer3.1.2.60.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
PLN02962 251 PLN02962, PLN02962, hydroxyacylglutathione hydrola 1e-78
smart00849177 smart00849, Lactamase_B, Metallo-beta-lactamase su 4e-09
TIGR03413 248 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrol 6e-09
COG0491252 COG0491, GloB, Zn-dependent hydrolases, including 7e-09
PLN02469 258 PLN02469, PLN02469, hydroxyacylglutathione hydrola 2e-08
pfam00753148 pfam00753, Lactamase_B, Metallo-beta-lactamase sup 1e-05
>gnl|CDD|178547 PLN02962, PLN02962, hydroxyacylglutathione hydrolase Back     alignment and domain information 
 Score =  234 bits (598), Expect = 1e-78
 Identities = 103/119 (86%), Positives = 115/119 (96%)

Query: 51  TTSSSSSSSKLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGL 110
           ++SSSSSSSKLLFRQ FEKESSTYTYLLADV+HPDKPALLIDPVDKTVDRDL+++KELGL
Sbjct: 1   SSSSSSSSSKLLFRQLFEKESSTYTYLLADVSHPDKPALLIDPVDKTVDRDLSLVKELGL 60

Query: 111 KLVYAMNTHVHADHVTGTGLIKSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEV 169
           KL+YAMNTHVHADHVTGTGL+K+K+PGVKSIISKASGSKADL VE GDK+ FGDL+LEV
Sbjct: 61  KLIYAMNTHVHADHVTGTGLLKTKLPGVKSIISKASGSKADLFVEPGDKIYFGDLYLEV 119

Length = 251
>gnl|CDD|214854 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|234201 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|223565 COG0491, GloB, Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>gnl|CDD|178088 PLN02469, PLN02469, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|216099 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
PLN02962 251 hydroxyacylglutathione hydrolase 99.95
PLN02469 258 hydroxyacylglutathione hydrolase 99.92
PLN02398 329 hydroxyacylglutathione hydrolase 99.92
PRK10241 251 hydroxyacylglutathione hydrolase; Provisional 99.91
TIGR03413 248 GSH_gloB hydroxyacylglutathione hydrolase. Members 99.89
KOG0813 265 consensus Glyoxylase [General function prediction 99.86
KOG0814 237 consensus Glyoxylase [General function prediction 99.83
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 99.78
COG0491252 GloB Zn-dependent hydrolases, including glyoxylase 99.75
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 99.73
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 99.71
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 99.59
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 99.53
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 99.49
PRK11539 755 ComEC family competence protein; Provisional 99.36
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.32
TIGR00361662 ComEC_Rec2 DNA internalization-related competence 99.28
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 99.24
PRK02126 334 ribonuclease Z; Provisional 99.21
COG1237 259 Metal-dependent hydrolases of the beta-lactamase s 99.21
PRK04286 298 hypothetical protein; Provisional 99.19
PRK11244 250 phnP carbon-phosphorus lyase complex accessory pro 99.17
TIGR02108 302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 99.14
PRK00685 228 metal-dependent hydrolase; Provisional 99.13
TIGR03307238 PhnP phosphonate metabolism protein PhnP. This fam 99.12
COG2333 293 ComEC Predicted hydrolase (metallo-beta-lactamase 99.1
PRK02113252 putative hydrolase; Provisional 99.1
PF14597199 Lactamase_B_5: Metallo-beta-lactamase superfamily; 99.1
PRK05184 302 pyrroloquinoline quinone biosynthesis protein PqqB 99.04
PRK00055 270 ribonuclease Z; Reviewed 99.03
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 98.99
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 98.98
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 98.94
COG1782 637 Predicted metal-dependent RNase, consists of a met 98.9
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 98.77
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary 98.56
COG1235 269 PhnP Metal-dependent hydrolases of the beta-lactam 98.44
KOG1135 764 consensus mRNA cleavage and polyadenylation factor 98.39
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 98.35
KOG1136 501 consensus Predicted cleavage and polyadenylation s 98.33
COG1234 292 ElaC Metal-dependent hydrolases of the beta-lactam 98.32
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 98.23
COG2220 258 Predicted Zn-dependent hydrolases of the beta-lact 98.18
TIGR02650 277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 97.91
KOG1137 668 consensus mRNA cleavage and polyadenylation factor 97.65
KOG4736 302 consensus Uncharacterized conserved protein [Funct 97.59
COG2248 304 Predicted hydrolase (metallo-beta-lactamase superf 97.55
KOG2121 746 consensus Predicted metal-dependent hydrolase (bet 96.87
PF02112 335 PDEase_II: cAMP phosphodiesterases class-II; Inter 95.9
KOG1361 481 consensus Predicted hydrolase involved in interstr 94.76
PF1369163 Lactamase_B_4: tRNase Z endonuclease 94.31
PF14234 285 DUF4336: Domain of unknown function (DUF4336) 91.43
KOG3592 934 consensus Microtubule-associated proteins [Cytoske 90.86
COG5212 356 PDE1 Low-affinity cAMP phosphodiesterase [Signal t 85.08
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information 
Probab=99.95  E-value=1.8e-27  Score=191.44  Aligned_cols=127  Identities=81%  Similarity=1.152  Sum_probs=110.2

Q ss_pred             ccCCCceEEEEEeeCCCccEEEEEEecCCCCCceEEEcCCCCChHHHHHHHHHcCCcccEEEcCCCChhhcCChHHHHHh
Q 030144           55 SSSSSKLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSK  134 (182)
Q Consensus        55 ~~~~~~~~i~~~~~~~~~~n~yli~~~~~~~~~~ilID~G~~~~~~l~~~l~~~~~~i~~IilTH~H~DH~ggl~~l~~~  134 (182)
                      ++..++|.|+++.....++||||+.++...+++++|||||....+.+++.+++.+++|++|++||.|+||++|+..|+++
T Consensus         5 ~~~~~~m~~~~~~~~~~~~~~Yll~d~~~~~~~avlIDP~~~~~~~~l~~l~~~g~~i~~Il~TH~H~DHigg~~~l~~~   84 (251)
T PLN02962          5 SSSSSKLLFRQLFEKESSTYTYLLADVSHPDKPALLIDPVDKTVDRDLSLVKELGLKLIYAMNTHVHADHVTGTGLLKTK   84 (251)
T ss_pred             CCCCCceEEEEeecCCceeEEEEEEeCCCCCCEEEEECCCCCcHHHHHHHHHHCCCeeEEEEcCCCCchhHHHHHHHHHH
Confidence            34456799999999999999999987410146899999996557888999999999999999999999999999999998


Q ss_pred             CCCCEEEecCCCCCCCceEcCCCCEEEeCCeEEEEEEcCCCCCCCCC
Q 030144          135 VPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGGFQAALSK  181 (182)
Q Consensus       135 ~p~~~v~~~~~~~~~~~~~~~~g~~~~~g~~~l~vi~tPGHT~g~~~  181 (182)
                      ++++++++++......+..+++|+++.+|+..+++++|||||+||++
T Consensus        85 ~~~a~v~~~~~~~~~~d~~l~~g~~i~~g~~~l~vi~tPGHT~g~v~  131 (251)
T PLN02962         85 LPGVKSIISKASGSKADLFVEPGDKIYFGDLYLEVRATPGHTAGCVT  131 (251)
T ss_pred             CCCCeEEeccccCCCCCEEeCCCCEEEECCEEEEEEECCCCCcCcEE
Confidence            88999999877655566778999999999999999999999999974

>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>KOG0813 consensus Glyoxylase [General function prediction only] Back     alignment and domain information
>KOG0814 consensus Glyoxylase [General function prediction only] Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>KOG1135 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>KOG1136 consensus Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>KOG1137 consensus mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG4736 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2121 consensus Predicted metal-dependent hydrolase (beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>KOG1361 consensus Predicted hydrolase involved in interstrand cross-link repair [Replication, recombination and repair] Back     alignment and domain information
>PF13691 Lactamase_B_4: tRNase Z endonuclease Back     alignment and domain information
>PF14234 DUF4336: Domain of unknown function (DUF4336) Back     alignment and domain information
>KOG3592 consensus Microtubule-associated proteins [Cytoskeleton] Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2gcu_A 245 X-Ray Structure Of Gene Product From Arabidopsis Th 5e-42
3r2u_A 466 2.1 Angstrom Resolution Crystal Structure Of Metall 7e-04
>pdb|2GCU|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At1g53580 Length = 245 Back     alignment and structure 
Iteration: 1

 Score =  166 bits (421), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 83/119 (69%), Positives = 93/119 (78%)
Query: 60  KLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTH 119
           KLLFRQ FE ESST+TYLLADV+HPDKPALLIDPVDKTVDRDL +I ELGLKL+YAMNTH
Sbjct: 2   KLLFRQLFENESSTFTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTH 61
Query: 120 VHADHVTGTGLIKSKVPGVXXXXXXXXXXXXDLHVEHGDKVSFGDLFLEVCIVGGFQAA 178
           VHADHVTGTGL+K+K+PGV            DL +E GDKVS GD++LEV    G  A 
Sbjct: 62  VHADHVTGTGLLKTKLPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAG 120
>pdb|3R2U|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp. Aureus Col Length = 466 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2gcu_A 245 Putative hydroxyacylglutathione hydrolase 3; ethyl 5e-50
4efz_A 298 Metallo-beta-lactamase family protein; structural 1e-32
3r2u_A 466 Metallo-beta-lactamase family protein; structural 3e-27
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 4e-25
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 2e-18
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 2e-14
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 3e-14
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 3e-12
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 1e-11
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 2e-10
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 2e-09
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 2e-09
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 4e-09
1sml_A 269 Protein (penicillinase); metallo-beta-lactamase, a 2e-06
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 9e-06
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 1e-05
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 2e-05
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 7e-05
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 2e-04
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 3e-04
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 4e-04
3hnn_A 262 Putative diflavin flavoprotein A 5; PSI-2, protein 5e-04
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 5e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 6e-04
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Length = 245 Back     alignment and structure
 Score =  160 bits (407), Expect = 5e-50
 Identities = 92/110 (83%), Positives = 103/110 (93%)

Query: 60  KLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTH 119
           KLLFRQ FE ESST+TYLLADV+HPDKPALLIDPVDKTVDRDL +I ELGLKL+YAMNTH
Sbjct: 2   KLLFRQLFENESSTFTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTH 61

Query: 120 VHADHVTGTGLIKSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEV 169
           VHADHVTGTGL+K+K+PGVKS+ISKASGSKADL +E GDKVS GD++LEV
Sbjct: 62  VHADHVTGTGLLKTKLPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEV 111
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Length = 298 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Length = 210 Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Length = 258 Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Length = 260 Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Length = 254 Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Length = 294 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263 Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Length = 289 Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Length = 311 Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Length = 207 Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Length = 269 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Length = 228 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Length = 303 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Length = 223 Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} Length = 219 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
2gcu_A 245 Putative hydroxyacylglutathione hydrolase 3; ethyl 99.93
4efz_A 298 Metallo-beta-lactamase family protein; structural 99.93
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 99.93
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 99.92
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 99.91
3r2u_A 466 Metallo-beta-lactamase family protein; structural 99.91
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.9
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 99.89
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 99.89
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 99.88
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 99.86
4ax1_B 303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 99.86
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 99.85
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 99.85
1sml_A 269 Protein (penicillinase); metallo-beta-lactamase, a 99.85
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 99.84
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 99.83
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 99.83
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 99.83
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 99.82
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein 99.82
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 99.82
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 99.8
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 99.8
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 99.8
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 99.8
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 99.78
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 99.78
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 99.78
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 99.77
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.77
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.77
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 99.76
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 99.76
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 99.75
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 99.73
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 99.73
2p97_A201 Hypothetical protein; putative metal-dependent hyd 99.73
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 99.71
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 99.71
1ztc_A221 Hypothetical protein TM0894; structural genomics, 99.69
3esh_A280 Protein similar to metal-dependent hydrolase; stru 99.69
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 99.69
1zkp_A 268 Hypothetical protein BA1088; zinc binding protein, 99.65
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.63
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 99.61
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 99.38
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.55
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.55
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 99.55
3g1p_A 258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 99.52
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.48
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 99.48
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 99.48
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 99.47
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 99.46
2az4_A 429 Hypothetical protein EF2904; structural genomics, 99.44
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.41
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.39
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.36
3kl7_A235 Putative metal-dependent hydrolase; structural gen 99.28
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 99.26
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 99.18
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 99.14
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 99.07
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 99.05
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 99.04
3rpc_A 264 Possible metal-dependent hydrolase; structural gen 98.98
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 98.94
1vjn_A 220 Zn-dependent hydrolase of metallo-beta-lactamase s 98.85
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 98.73
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
Probab=99.93  E-value=2.7e-25  Score=177.03  Aligned_cols=122  Identities=77%  Similarity=1.136  Sum_probs=105.6

Q ss_pred             ceEEEEEeeCCCccEEEEEEecCCCCCceEEEcCCCCChHHHHHHHHHcCCcccEEEcCCCChhhcCChHHHHHhCCCCE
Q 030144           60 KLLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVK  139 (182)
Q Consensus        60 ~~~i~~~~~~~~~~n~yli~~~~~~~~~~ilID~G~~~~~~l~~~l~~~~~~i~~IilTH~H~DH~ggl~~l~~~~p~~~  139 (182)
                      +|.|+++.....++|+|||.++...+++++|||||....+.+.+.+++.+++|++|++||.|+||++|+..|++.+++++
T Consensus         2 ~m~~~~~~~~~~~~~~yli~~~~~~~~~~ilID~g~~~~~~~~~~l~~~g~~i~~Il~TH~H~DH~gg~~~l~~~~~~~~   81 (245)
T 2gcu_A            2 KLLFRQLFENESSTFTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVK   81 (245)
T ss_dssp             CEEEEEEEETTTTEEEEEEEETTSTTCEEEEESCBGGGHHHHHHHHHHHTCEEEEEECSSCCSSSCBSHHHHHHHSTTCE
T ss_pred             CcEEEEeecCCCceEEEEEEcCCCCCCcEEEEeCCCchHHHHHHHHHHCCCeeeEEEeCCCChhhhhhHHHHHHhCCCCe
Confidence            48899999999999999998730001589999999754678899999999999999999999999999999998677999


Q ss_pred             EEecCCCCCCCceEcCCCCEEEeCCeEEEEEEcCCCCCCCCC
Q 030144          140 SIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGGFQAALSK  181 (182)
Q Consensus       140 v~~~~~~~~~~~~~~~~g~~~~~g~~~l~vi~tPGHT~g~~~  181 (182)
                      ||+++.+.......+++|+.+.+|+.++++++|||||+||++
T Consensus        82 v~~~~~~~~~~~~~~~~g~~~~~g~~~i~v~~tpGHt~g~~~  123 (245)
T 2gcu_A           82 SVISKASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVT  123 (245)
T ss_dssp             EEEEGGGCCCCSEEECTTCEEEETTEEEEEEECCSSSTTCEE
T ss_pred             EEecccccccCCEEcCCCCEEEECCEEEEEEECCCCCCCCEE
Confidence            999987654456778999999999999999999999999974
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d1xm8a_ 254 d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathio 5e-12
d1qh5a_ 260 d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathio 2e-10
d1vmea2 250 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, 8e-06
d1znba_230 d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroi 9e-05
d2q0ia1 298 d.157.1.14 (A:1-298) Quinolone signal response pro 1e-04
d1ycga2 249 d.157.1.3 (A:2-250) Nitric oxide reductase N-termi 4e-04
d1p9ea_ 294 d.157.1.5 (A:) Methyl parathion hydrolase {Pseudom 0.004
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Glyoxalase II (hydroxyacylglutathione hydrolase)
domain: Glyoxalase II (hydroxyacylglutathione hydrolase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 60.3 bits (145), Expect = 5e-12
 Identities = 26/104 (25%), Positives = 43/104 (41%), Gaps = 6/104 (5%)

Query: 74  YTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLI-- 131
           Y Y+L D         ++DP +   +  ++ +K  G  L Y +NTH H DH  G   +  
Sbjct: 13  YAYILHD--EDTGTVGVVDPSE--AEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKD 68

Query: 132 KSKVPGVKSIISKASGSKADLHVEHGDKVSFGDLFLEVCIVGGF 175
           +     + S + K      D+ ++ GDK  F    + V    G 
Sbjct: 69  RYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGH 112
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 260 Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 250 Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Length = 230 Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Length = 298 Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Length = 249 Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Length = 294 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.94
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.94
d2qeda1 251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.93
d2aioa1266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.9
d2gmna1 264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 99.89
d1k07a_ 262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 99.86
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 99.85
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 99.79
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 99.78
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 99.78
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 99.75
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 99.72
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.72
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.71
d1vmea2250 ROO-like flavoprotein TM0755, N-terminal domain {T 99.71
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 99.67
d1p9ea_ 294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 99.67
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 99.67
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 99.61
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 99.61
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.57
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 99.45
d1zkpa1 244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.4
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.36
d1wraa1 305 Teichoic acid phosphorylcholine esterase Pce (LytD 99.33
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 99.26
d2cbna1 305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 98.94
d1y44a1 307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 98.93
d1xtoa_ 304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 98.81
d2e7ya1 280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 98.79
d1vjna_209 Hypothetical protein TM0207 {Thermotoga maritima [ 98.13
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Glyoxalase II (hydroxyacylglutathione hydrolase)
domain: Glyoxalase II (hydroxyacylglutathione hydrolase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.94  E-value=1.8e-26  Score=183.14  Aligned_cols=115  Identities=25%  Similarity=0.356  Sum_probs=100.4

Q ss_pred             eEEEEEeeCCCccEEEEEEecCCCCCceEEEcCCCCChHHHHHHHHHcCCcccEEEcCCCChhhcCChHHHHHhCCCCEE
Q 030144           61 LLFRQTFEKESSTYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIKSKVPGVKS  140 (182)
Q Consensus        61 ~~i~~~~~~~~~~n~yli~~~~~~~~~~ilID~G~~~~~~l~~~l~~~~~~i~~IilTH~H~DH~ggl~~l~~~~p~~~v  140 (182)
                      |+|..+.. ..+|++|||.++.  ++++++||||.  .+.+++.+++.++++.+|++||.|+||++|+..|.+++ ++++
T Consensus         1 M~i~~ip~-~~dNy~Yli~d~~--t~~avvIDPg~--~~~i~~~l~~~~~~l~~Il~TH~H~DH~~g~~~l~~~~-~~~v   74 (254)
T d1xm8a_           1 MQIELVPC-LKDNYAYILHDED--TGTVGVVDPSE--AEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRY-GAKV   74 (254)
T ss_dssp             CEEEEEEE-TTTEEEEEEECTT--TCCEEEECCSS--HHHHHHHHHHHTCCCCEEECSSCCHHHHTTHHHHHHHH-CCEE
T ss_pred             CEEEEEee-eccEEEEEEEECC--CCEEEEECCCC--cHHHHHHHHHCCCceeEEecccCcccccCchHHHHhhc-CCcE
Confidence            56666643 6778899998864  67899999994  78899999999999999999999999999999999998 8999


Q ss_pred             EecCCCC---CCCceEcCCCCEEEeCCeEEEEEEcCCCCCCCCC
Q 030144          141 IISKASG---SKADLHVEHGDKVSFGDLFLEVCIVGGFQAALSK  181 (182)
Q Consensus       141 ~~~~~~~---~~~~~~~~~g~~~~~g~~~l~vi~tPGHT~g~~~  181 (182)
                      +++..+.   ...+..+++|+.+.+|+.++++++|||||+||++
T Consensus        75 ~~~~~~~~~~~~~~~~l~dgd~i~lg~~~i~vl~TPGHT~ghi~  118 (254)
T d1xm8a_          75 IGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHIS  118 (254)
T ss_dssp             EEEGGGGGGSTTEEEEECTTCEEEETTEEEEEEECCSSSSSCEE
T ss_pred             EecccccccCCCCCEEecCCCeeeecCcEEEEeeccCCCCCceE
Confidence            9887643   3456889999999999999999999999999975
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure