Citrus Sinensis ID: 030178

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MATVRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGVVALVAKQMLLLFTNIDFFIYQL
ccccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHcccccccEEEEEEccEEEccccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEccccccccccHHHHHHHHHHHc
cccccEEEccccccEEEHcccccccccccccccccHHHHHHHHHHHHHccccEEccccccccccHHHHHHHHHccccccEEEEEEEccEEcccccccccccHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHccccEEEEEc
MATVRRmklgsqgleVSAQGlgcmgmsalygppkpepdMIALIRHAINSgitfldtsdiygphtneilLGKAFKGGFRERAELATKFGigivdgkygyhgdpaYVRAACEASLKRLDVDCIDLYYqhridtqtpIEVTVISLSLLpsfvklkcsILYCGVVALVAKQMLLLFTNIDFFIYQL
matvrrmklgsqgLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGVVALVAKQMLLLFTNIDFFIYQL
MATVRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGVVALVAKQMLLLFTNIDFFIYQL
********************LGCMGMSALY*******DMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGVVALVAKQMLLLFTNIDFFIY**
***VRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGVVALVAKQMLLLFTNIDFFIYQL
MATVRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGVVALVAKQMLLLFTNIDFFIYQL
***VRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGVVALVAKQMLLLFTNIDFFIYQL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATVRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGVVALVAKQMLLLFTNIDFFIYQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
P40691 307 Auxin-induced protein PCN N/A no 0.818 0.485 0.772 5e-63
A2XRZ0 351 Probable aldo-keto reduct N/A no 0.818 0.424 0.738 8e-62
Q7XT99 351 Probable aldo-keto reduct yes no 0.818 0.424 0.731 5e-61
P49249 306 IN2-2 protein OS=Zea mays N/A no 0.835 0.496 0.703 2e-60
Q93ZN2 345 Probable aldo-keto reduct yes no 0.818 0.431 0.718 5e-58
Q9ASZ9 345 Probable aldo-keto reduct no no 0.818 0.431 0.711 2e-57
F4HPY8 330 Probable aldo-keto reduct no no 0.818 0.451 0.706 5e-57
Q84M96 346 Probable aldo-keto reduct no no 0.818 0.430 0.706 1e-56
O22707 345 Probable aldo-keto reduct no no 0.818 0.431 0.711 2e-56
Q9C5B9 344 Probable aldo-keto reduct no no 0.818 0.433 0.718 1e-55
>sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function desciption
 Score =  239 bits (611), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 126/154 (81%), Gaps = 5/154 (3%)

Query: 4   VRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPH 63
           V R+KLGSQGLEVSAQGLGCMGMSA YGPPKPEPDMI LI HAINSGIT LDTSD+YGPH
Sbjct: 8   VPRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPEPDMIQLIHHAINSGITLLDTSDVYGPH 67

Query: 64  TNEILLGKAFKGGFRERAELATKFGIGIVD-----GKYGYHGDPAYVRAACEASLKRLDV 118
           TNEILLGKA KGG RER  LATKFGI + D     GK   HGDPAYVRAACEASLKRLD+
Sbjct: 68  TNEILLGKALKGGTRERVVLATKFGIVLGDEKKAEGKRAVHGDPAYVRAACEASLKRLDI 127

Query: 119 DCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLK 152
           DCIDLYYQHR+DT+ PIE+TV  L  L    KLK
Sbjct: 128 DCIDLYYQHRVDTRVPIEITVGELKKLVEEGKLK 161

Nicotiana tabacum (taxid: 4097)
>sp|A2XRZ0|AKR2_ORYSI Probable aldo-keto reductase 2 OS=Oryza sativa subsp. indica GN=OsI_15387 PE=3 SV=1 Back     alignment and function description
>sp|Q7XT99|AKR2_ORYSJ Probable aldo-keto reductase 2 OS=Oryza sativa subsp. japonica GN=Os04g0338000 PE=2 SV=2 Back     alignment and function description
>sp|P49249|IN22_MAIZE IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1 Back     alignment and function description
>sp|Q93ZN2|ALKR4_ARATH Probable aldo-keto reductase 4 OS=Arabidopsis thaliana GN=At1g60710 PE=1 SV=1 Back     alignment and function description
>sp|Q9ASZ9|ALKR5_ARATH Probable aldo-keto reductase 5 OS=Arabidopsis thaliana GN=At1g60730 PE=2 SV=1 Back     alignment and function description
>sp|F4HPY8|AKR6_ARATH Probable aldo-keto reductase 6 OS=Arabidopsis thaliana GN=At1g60750 PE=3 SV=1 Back     alignment and function description
>sp|Q84M96|ALKR2_ARATH Probable aldo-keto reductase 2 OS=Arabidopsis thaliana GN=AGD2 PE=1 SV=1 Back     alignment and function description
>sp|O22707|ALKR3_ARATH Probable aldo-keto reductase 3 OS=Arabidopsis thaliana GN=At1g60690 PE=3 SV=1 Back     alignment and function description
>sp|Q9C5B9|AKR1_ARATH Probable aldo-keto reductase 1 OS=Arabidopsis thaliana GN=At1g10810 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
255598502150 aldo/keto reductase, putative [Ricinus c 0.780 0.946 0.830 5e-64
255591425256 aldo/keto reductase, putative [Ricinus c 0.835 0.593 0.782 8e-64
255555136 342 aldo/keto reductase, putative [Ricinus c 0.835 0.444 0.776 6e-63
147767361 341 hypothetical protein VITISV_040294 [Viti 0.835 0.445 0.776 2e-62
225433674 341 PREDICTED: auxin-induced protein PCNT115 0.835 0.445 0.776 2e-62
359477987 324 PREDICTED: auxin-induced protein PCNT115 0.835 0.469 0.776 2e-62
359477985 358 PREDICTED: auxin-induced protein PCNT115 0.763 0.388 0.827 7e-62
728744 307 RecName: Full=Auxin-induced protein PCNT 0.818 0.485 0.772 3e-61
62526573 344 aldo/keto reductase AKR [Manihot esculen 0.829 0.438 0.754 4e-61
224069573 343 predicted protein [Populus trichocarpa] 0.835 0.443 0.745 6e-61
>gi|255598502|ref|XP_002537023.1| aldo/keto reductase, putative [Ricinus communis] gi|223517777|gb|EEF25360.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%)

Query: 1   MATVRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIY 60
           MA ++R+KLGSQGLEVSAQGLGCMGMSA YGPPKPEPDMIALI HAINSG+TFLDTSD+Y
Sbjct: 1   MAEMKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPEPDMIALIHHAINSGVTFLDTSDVY 60

Query: 61  GPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDC 120
           GPHTNEILLGKA KGG RE+ ELATKFGI   DGK G  GDPAYVRAACEASLKRL VDC
Sbjct: 61  GPHTNEILLGKALKGGMREKVELATKFGIIFQDGKRGIKGDPAYVRAACEASLKRLQVDC 120

Query: 121 IDLYYQHRIDTQTPIEVTVISL 142
           IDLYYQHRIDT  PIE+TV  L
Sbjct: 121 IDLYYQHRIDTSVPIEITVCPL 142

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255591425|ref|XP_002535506.1| aldo/keto reductase, putative [Ricinus communis] gi|223522847|gb|EEF26877.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255555136|ref|XP_002518605.1| aldo/keto reductase, putative [Ricinus communis] gi|223542204|gb|EEF43747.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147767361|emb|CAN68994.1| hypothetical protein VITISV_040294 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225433674|ref|XP_002266027.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477987|ref|XP_003632049.1| PREDICTED: auxin-induced protein PCNT115 isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477985|ref|XP_003632048.1| PREDICTED: auxin-induced protein PCNT115 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|728744|sp|P40691.1|A115_TOBAC RecName: Full=Auxin-induced protein PCNT115 gi|19799|emb|CAA39708.1| auxin-induced protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|62526573|gb|AAX84672.1| aldo/keto reductase AKR [Manihot esculenta] Back     alignment and taxonomy information
>gi|224069573|ref|XP_002303002.1| predicted protein [Populus trichocarpa] gi|222844728|gb|EEE82275.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
TAIR|locus:2036504 345 ATB2 [Arabidopsis thaliana (ta 0.818 0.431 0.718 1.1e-53
TAIR|locus:2036551 330 AT1G60750 [Arabidopsis thalian 0.818 0.451 0.706 4.9e-53
TAIR|locus:2036591 346 AT1G60680 "AT1G60680" [Arabido 0.818 0.430 0.706 1.7e-52
TAIR|locus:2036611 345 AT1G60690 "AT1G60690" [Arabido 0.818 0.431 0.711 5.6e-52
TAIR|locus:2196446 344 AT1G10810 "AT1G10810" [Arabido 0.818 0.433 0.718 9.2e-52
TIGR_CMR|GSU_3126 334 GSU_3126 "oxidoreductase, aldo 0.697 0.380 0.540 1.1e-30
TIGR_CMR|SPO_A0345 327 SPO_A0345 "oxidoreductase, ald 0.840 0.467 0.503 3e-30
POMBASE|SPAC1F7.12 340 yak3 "aldose reductase ARK13 f 0.692 0.370 0.454 1.8e-23
ASPGD|ASPL0000051701 339 AN10217 [Emericella nidulans ( 0.813 0.436 0.388 3.9e-21
ASPGD|ASPL0000072041 351 AN8733 [Emericella nidulans (t 0.741 0.384 0.394 2.1e-19
TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 555 (200.4 bits), Expect = 1.1e-53, P = 1.1e-53
 Identities = 107/149 (71%), Positives = 120/149 (80%)

Query:     4 VRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPH 63
             VRRMKLGSQGLEVSAQGLGCMG+SA YG PKPE + IALI HAI+SG+T LDTSDIYGP 
Sbjct:     7 VRRMKLGSQGLEVSAQGLGCMGLSAFYGAPKPENEAIALIHHAIHSGVTLLDTSDIYGPE 66

Query:    64 TNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDL 123
             TNE+LLGKA K G RE+ ELATKFGI   +GK    GDP YVRAACEASLKRLD+ CIDL
Sbjct:    67 TNEVLLGKALKDGVREKVELATKFGISYAEGKREVRGDPEYVRAACEASLKRLDIACIDL 126

Query:   124 YYQHRIDTQTPIEVTVISLSLLPSFVKLK 152
             YYQHR+DT+ PIE+T+  L  L    K+K
Sbjct:   127 YYQHRVDTRVPIEITMGELKKLVEEGKIK 155
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000072041 AN8733 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7XT99AKR2_ORYSJ1, ., 1, ., 1, ., -0.73150.81860.4245yesno
Q93ZN2ALKR4_ARATH1, ., 1, ., 1, ., -0.71810.81860.4318yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033541001
SubName- Full=Chromosome chr5 scaffold_67, whole genome shotgun sequence; (341 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
COG0667 316 COG0667, Tas, Predicted oxidoreductases (related t 2e-44
cd06660 285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 5e-42
pfam00248 277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 4e-30
COG4989 298 COG4989, COG4989, Predicted oxidoreductase [Genera 5e-17
PRK09912 346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 3e-16
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 6e-16
COG0656 280 COG0656, ARA1, Aldo/keto reductases, related to di 9e-16
PLN02587 314 PLN02587, PLN02587, L-galactose dehydrogenase 5e-15
PRK10625 346 PRK10625, tas, putative aldo-keto reductase; Provi 1e-09
PRK10376 290 PRK10376, PRK10376, putative oxidoreductase; Provi 2e-09
TIGR01293 317 TIGR01293, Kv_beta, voltage-dependent potassium ch 2e-09
PRK11565 275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 2e-05
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
 Score =  149 bits (377), Expect = 2e-44
 Identities = 55/135 (40%), Positives = 78/135 (57%), Gaps = 4/135 (2%)

Query: 8   KLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEI 67
           +LG  GL+VS  GLG M +       + E + I ++  A+++GI F DT+D+YG   +E 
Sbjct: 5   RLGRSGLKVSPLGLGTMTLGGDTDDEE-EAEAIEILDAALDAGINFFDTADVYGDGRSEE 63

Query: 68  LLGKAFKG-GFRERAELATKFGIGIVDGKY--GYHGDPAYVRAACEASLKRLDVDCIDLY 124
           +LG+A K  G R++  +ATK G    D      +     ++R A EASLKRL  D IDLY
Sbjct: 64  ILGEALKERGRRDKVVIATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLY 123

Query: 125 YQHRIDTQTPIEVTV 139
             HR D +TPIE T+
Sbjct: 124 QLHRPDPETPIEETL 138

Length = 316
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
COG0667 316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575 336 consensus Voltage-gated shaker-like K+ channel, su 100.0
PRK09912 346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
COG0656 280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
TIGR01293 317 Kv_beta voltage-dependent potassium channel beta s 100.0
PLN02587 314 L-galactose dehydrogenase 100.0
KOG1577 300 consensus Aldo/keto reductase family proteins [Gen 100.0
PRK10376 290 putative oxidoreductase; Provisional 100.0
PRK10625 346 tas putative aldo-keto reductase; Provisional 100.0
cd06660 285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
COG4989 298 Predicted oxidoreductase [General function predict 100.0
PF00248 283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
PRK11565 275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
PRK11172 267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
PRK14863 292 bifunctional regulator KidO; Provisional 100.0
KOG1576 342 consensus Predicted oxidoreductase [Energy product 100.0
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 100.0
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 96.5
PRK00208250 thiG thiazole synthase; Reviewed 92.09
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 91.56
PRK07379 400 coproporphyrinogen III oxidase; Provisional 89.13
PRK09058 449 coproporphyrinogen III oxidase; Provisional 89.11
PRK06294 370 coproporphyrinogen III oxidase; Provisional 88.63
PRK05660 378 HemN family oxidoreductase; Provisional 86.64
COG0635 416 HemN Coproporphyrinogen III oxidase and related Fe 86.53
PRK08446 350 coproporphyrinogen III oxidase; Provisional 86.1
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 85.06
COG1832140 Predicted CoA-binding protein [General function pr 84.37
COG1801263 Uncharacterized conserved protein [Function unknow 83.79
PRK13347 453 coproporphyrinogen III oxidase; Provisional 83.49
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 82.55
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 81.0
PRK05628 375 coproporphyrinogen III oxidase; Validated 80.26
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-43  Score=288.08  Aligned_cols=174  Identities=36%  Similarity=0.488  Sum_probs=156.4

Q ss_pred             ccceecCCCCcccCcceeccccCCCCCCCCCChHHHHHHHHHHHHcCCCeeeccCCCCCCcHHHHHHHhhccCC-CCCEE
Q 030178            4 VRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGF-RERAE   82 (182)
Q Consensus         4 m~~~~lg~~g~~vs~l~lGt~~~~~~~~~~~~~~~~~~~l~~a~~~G~~~~Dta~~Yg~g~~e~~lG~~l~~~~-r~~~~   82 (182)
                      |++++||++|++||+||||||.+|.. ....+.+++.++|++|+++|+|+||||+.||+|.+|+++|++|++.+ |++++
T Consensus         1 m~~r~lG~~gl~vs~lglG~~~~g~~-~~~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~g~sE~ilG~~l~~~~~Rd~vv   79 (316)
T COG0667           1 MKYRRLGRSGLKVSPLGLGTMTLGGD-TDDEEEAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEALKERGRRDKVV   79 (316)
T ss_pred             CCceecCCCCceecceeeeccccCCC-CCchhhhHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHHhccCCCCeEE
Confidence            88999999999999999999999764 22335557888999999999999999999999999999999999966 89999


Q ss_pred             EEeccCCCcCC-CCC-CCCCCHHHHHHHHHHHHHHhCCCccceEEeecCCCCCCHHHHHHHHHHHhHcCccccccceeec
Q 030178           83 LATKFGIGIVD-GKY-GYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGV  160 (182)
Q Consensus        83 i~tK~~~~~~~-~~~-~~~~~~~~i~~~~~~sL~~Lg~~~lDl~~lh~~d~~~~~~~~~~al~~l~~~G~ir~~~~~iGv  160 (182)
                      |+||++....+ .+. ....++++|+++++.||+|||+||||||++||||+.++.++++++|.+|+++|+||+    +|+
T Consensus        80 IaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~----iG~  155 (316)
T COG0667          80 IATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRY----IGV  155 (316)
T ss_pred             EEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeE----EEe
Confidence            99999887643 222 256899999999999999999999999999999999999999999999999999995    999


Q ss_pred             cchhHHHHHHHhcC-CCeeeecC
Q 030178          161 VALVAKQMLLLFTN-IDFFIYQL  182 (182)
Q Consensus       161 s~~~~~~~~~l~~~-~~~~~~q~  182 (182)
                      ||++++++.++.+. .+++.+|.
T Consensus       156 S~~~~~~i~~a~~~~~~~~~~Q~  178 (316)
T COG0667         156 SNYSAEQIAEALAVAAPIDSLQP  178 (316)
T ss_pred             cCCCHHHHHHHHHhcCCceeecc
Confidence            99999999999987 48888884

>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>COG1832 Predicted CoA-binding protein [General function prediction only] Back     alignment and domain information
>COG1801 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
3v0t_A 337 Crystal Structure Of Perakine Reductase, Founder Me 1e-36
3v0u_A 338 Crystal Structure Of Perakine Reductase, Founder Me 1e-36
3uyi_A 337 Crystal Structure Of Perakine Reductase, Founder Me 2e-36
3v0s_A 337 Crystal Structure Of Perakine Reductase, Founder Me 7e-36
1ynp_A 317 Aldo-keto Reductase Akr11c1 From Bacillus Haloduran 4e-17
1pyf_A 312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 7e-15
1pz1_A 333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 5e-13
3n6q_A 346 Crystal Structure Of Yghz From E. Coli Length = 346 8e-13
4aub_A 366 The Complex Structure Of The Bacterial Aldo-Keto Re 9e-13
3erp_A 353 Structure Of Idp01002, A Putative Oxidoreductase Fr 1e-12
3n2t_A 348 Structure Of The Glycerol Dehydrogenase Akr11b4 Fro 2e-09
3eb3_A 327 Voltage-Dependent K+ Channel Beta Subunit (W121a) I 4e-08
1zsx_A 347 Crystal Structure Of Human Potassium Channel Kv Bet 5e-08
1qrq_A 325 Structure Of A Voltage-Dependent K+ Channel Beta Su 6e-08
2a79_A 333 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 6e-08
3eau_A 327 Voltage-Dependent K+ Channel Beta Subunit In Comple 6e-08
3eb4_A 327 Voltage-Dependent K+ Channel Beta Subunit (I211r) I 6e-08
1exb_A 332 Structure Of The Cytoplasmic Beta Subunit-T1 Assemb 6e-08
3lut_A 367 A Structural Model For The Full-Length Shaker Potas 9e-08
4exa_A292 Crystal Structure Of The Pa4992, The Putative Aldo- 2e-07
1og6_A 298 Ydhf, An Aldo-keto Reductase From E.coli Complexed 5e-07
1lqa_A 346 Tas Protein From Escherichia Coli In Complex With N 7e-07
1ur3_M 319 Crystal Structure Of The Apo Form Of The E.Coli Ydh 1e-06
1gve_A 327 Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live 8e-05
3o0k_A 283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 1e-04
2bp1_B 360 Structure Of The Aflatoxin Aldehyde Reductase In Co 6e-04
2clp_A 347 Crystal Structure Of Human Aflatoxin B1 Aldehyde Re 9e-04
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure 
Iteration: 1

 Score =  148 bits (374), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/150 (56%), Positives = 101/150 (67%), Gaps = 4/150 (2%)
Query: 6   RMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPH-T 64
           R+KLG+QGLEVS  G GCMG+S  Y    PE   IA+I+ A N GITF DTSDIYG + +
Sbjct: 3   RVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGS 62
Query: 65  NEILLGKAFKGGFRERAELATKFGIGIVDGKYGY--HGDPAYVRAACEASLKRLDVDCID 122
           NE LLGKA K   RE+ ++ TKFGI  + G  G    G P YVR+ CEASLKRLDVD ID
Sbjct: 63  NEELLGKALKQLPREKIQVGTKFGIHEI-GFSGVKAKGTPDYVRSCCEASLKRLDVDYID 121
Query: 123 LYYQHRIDTQTPIEVTVISLSLLPSFVKLK 152
           L+Y HRIDT  PIE+T+  L  L    K+K
Sbjct: 122 LFYIHRIDTTVPIEITMGELKKLVEEGKIK 151
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 Back     alignment and structure
>pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 Back     alignment and structure
>pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 Back     alignment and structure
>pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 Back     alignment and structure
>pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 Back     alignment and structure
>pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 Back     alignment and structure
>pdb|4EXA|A Chain A, Crystal Structure Of The Pa4992, The Putative Aldo-keto Reductase From Pseudomona Aeruginosa Length = 292 Back     alignment and structure
>pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 Back     alignment and structure
>pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
1pyf_A 312 IOLS protein; beta-alpha barrel, aldo-keto reducta 2e-76
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 2e-75
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 1e-69
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 9e-68
1ynp_A 317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 4e-59
1ur3_M 319 Hypothetical oxidoreductase YDHF; NADP binding, al 9e-56
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 2e-36
3erp_A 353 Putative oxidoreductase; funded by the national in 3e-36
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 6e-36
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 4e-33
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 8e-32
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 1e-31
1lqa_A 346 TAS protein; TIM barrel, structure 2 function proj 9e-24
1vbj_A 281 Prostaglandin F synthase; TIM barrel, oxidoreducta 1e-08
1vp5_A 298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 2e-08
2wzm_A 283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 2e-08
1afs_A 323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 3e-08
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 6e-08
1hw6_A 278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 6e-08
1zgd_A 312 Chalcone reductase; polyketide, deoxychalcone, iso 7e-08
1s1p_A 331 Aldo-keto reductase family 1 member C3; TIM-barrel 9e-08
4gie_A 290 Prostaglandin F synthase; structural genomics, nia 2e-07
3f7j_A 276 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-07
3buv_A 326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 2e-07
3b3e_A 310 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-07
4f40_A 288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 2e-07
3up8_A 298 Putative 2,5-diketo-D-gluconic acid reductase B; n 5e-07
2bgs_A 344 Aldose reductase; holoenzyme, aldo/keto reductase, 6e-07
3h7r_A 331 Aldo-keto reductase; stress response, NADP, drough 7e-07
1mzr_A 296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 7e-07
1qwk_A 317 Aldose reductase, aldo-keto reductase family 1 mem 8e-07
3h7u_A 335 Aldo-keto reductase; stress response, NADP, drough 1e-06
3o3r_A 316 Aldo-keto reductase family 1, member B7; aldose re 1e-06
1mi3_A 322 Xylose reductase, XR; aldo-keto reductase, beta-al 1e-06
1us0_A 316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 1e-06
2ao0_A 324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 2e-06
3krb_A 334 Aldose reductase; ssgcid, SBRI, emerald biostructu 2e-06
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
 Score =  230 bits (588), Expect = 2e-76
 Identities = 47/140 (33%), Positives = 68/140 (48%), Gaps = 4/140 (2%)

Query: 1   MATVRRMKLGSQGLEVSAQGLGCMGMS-ALYGPPKPEPDMIALIRHAINSGITFLDTSDI 59
           M      KLG   L+V   GLG   +      P   E     L+R AI +G+T LDT+ I
Sbjct: 1   MKKA---KLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYI 57

Query: 60  YGPHTNEILLGKAFKGGFRERAELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVD 119
           YG   +E L+G+  +   RE   +ATK         + +   P +++ + + SLKRL+ D
Sbjct: 58  YGIGRSEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTD 117

Query: 120 CIDLYYQHRIDTQTPIEVTV 139
            IDL+Y H  D  TP +  V
Sbjct: 118 YIDLFYIHFPDEHTPKDEAV 137
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
1pyf_A 312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 100.0
1ynp_A 317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
3erp_A 353 Putative oxidoreductase; funded by the national in 100.0
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 100.0
1ur3_M 319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 100.0
3ln3_A 324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
1vbj_A 281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
3up8_A 298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
4gie_A 290 Prostaglandin F synthase; structural genomics, nia 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
3f7j_A 276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
2wzm_A 283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
1mi3_A 322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
1lqa_A 346 TAS protein; TIM barrel, structure 2 function proj 100.0
1hw6_A 278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
1afs_A 323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
1qwk_A 317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1zgd_A 312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
3o3r_A 316 Aldo-keto reductase family 1, member B7; aldose re 100.0
3b3e_A 310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3h7u_A 335 Aldo-keto reductase; stress response, NADP, drough 100.0
3buv_A 326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
1s1p_A 331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
4f40_A 288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
1us0_A 316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
1mzr_A 296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
3h7r_A 331 Aldo-keto reductase; stress response, NADP, drough 100.0
1vp5_A 298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
3krb_A 334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
4gac_A 324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
3b3d_A 314 YTBE protein, putative morphine dehydrogenase; ald 100.0
2bgs_A 344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
Probab=100.00  E-value=6.2e-45  Score=295.22  Aligned_cols=174  Identities=30%  Similarity=0.416  Sum_probs=152.6

Q ss_pred             ccceecCCCCcccCcceeccccCCCC--CCCCCChHHHHHHHHHHHHcCCCeeeccCCCCCCcHHHHHHHhhccCCCCCE
Q 030178            4 VRRMKLGSQGLEVSAQGLGCMGMSAL--YGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKGGFRERA   81 (182)
Q Consensus         4 m~~~~lg~~g~~vs~l~lGt~~~~~~--~~~~~~~~~~~~~l~~a~~~G~~~~Dta~~Yg~g~~e~~lG~~l~~~~r~~~   81 (182)
                      |+|++||++|++||+||||||++|..  |+ ..+++++.++++.|+++|||+||||+.||+|.+|+.+|++|+..+|+++
T Consensus         1 M~~~~lg~tg~~vs~lglGt~~~g~~~~~~-~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~G~sE~~lG~al~~~~R~~~   79 (312)
T 1pyf_A            1 MKKAKLGKSDLQVFPIGLGTNAVGGHNLYP-NLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDV   79 (312)
T ss_dssp             -CCEECTTSCCEECSBCEECTTSSCTTTCS-SCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGC
T ss_pred             CCeeecCCCCCcccCEeEeccccCCCCCCC-CCCHHHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHhhhcCCCeE
Confidence            89999999999999999999999754  43 2477889999999999999999999999999999999999988779999


Q ss_pred             EEEeccCCCcCCCCCCCCCCHHHHHHHHHHHHHHhCCCccceEEeecCCCCCCHHHHHHHHHHHhHcCccccccceeecc
Q 030178           82 ELATKFGIGIVDGKYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSILYCGVV  161 (182)
Q Consensus        82 ~i~tK~~~~~~~~~~~~~~~~~~i~~~~~~sL~~Lg~~~lDl~~lh~~d~~~~~~~~~~al~~l~~~G~ir~~~~~iGvs  161 (182)
                      +|+||++.....+.+....+++.+++++++||++||+||||+|++|||++..+++++|++|++|+++|+||+    ||||
T Consensus        80 ~i~TK~g~~~~~~~~~~~~~~~~i~~~~~~SL~rL~~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~----iGvS  155 (312)
T 1pyf_A           80 VIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRS----IGVS  155 (312)
T ss_dssp             EEEEEECEEEETTEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSC----EEEE
T ss_pred             EEEEEeCCCCCCCCCCCCCCHHHHHHHHHHHHHHhCCCcEEEEEeCCCCCCCCHHHHHHHHHHHHHCCCcCE----EEec
Confidence            999997622111111134789999999999999999999999999999998899999999999999999996    9999


Q ss_pred             chhHHHHHHHhcCCCeeeecC
Q 030178          162 ALVAKQMLLLFTNIDFFIYQL  182 (182)
Q Consensus       162 ~~~~~~~~~l~~~~~~~~~q~  182 (182)
                      ||++++++++++..+++.+|+
T Consensus       156 n~~~~~l~~~~~~~~~~~~Q~  176 (312)
T 1pyf_A          156 NFSLEQLKEANKDGLVDVLQG  176 (312)
T ss_dssp             SCCHHHHHHHTTTSCCCEEEE
T ss_pred             CCCHHHHHHHHhhCCceEEec
Confidence            999999999998766766663
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d3eaua1 326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 2e-28
d1pyfa_ 311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 1e-27
d1lqaa_ 346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 2e-27
d1pz1a_ 333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 1e-24
d1ur3m_ 298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 2e-21
d1s1pa_ 315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 3e-21
d1qwka_ 312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 2e-20
d1us0a_ 314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 5e-20
d1hqta_ 324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 6e-20
d1mi3a_ 319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 4e-18
d1afsa_ 319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 7e-18
d1vp5a_ 284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 9e-18
d1frba_ 315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 1e-17
d1gvea_ 324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 2e-16
d1mzra_ 274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-15
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-14
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Voltage-dependent K+ channel beta subunit
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  105 bits (262), Expect = 2e-28
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 4/124 (3%)

Query: 8   KLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEI 67
            LG  GL VS  GLG       +G    +     L+  A ++GI   DT+++Y     E+
Sbjct: 6   NLGKSGLRVSCLGLGTWVT---FGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEV 62

Query: 68  LLGKAFKGGFRERAELATKFGIGIVDGKYGYHG-DPAYVRAACEASLKRLDVDCIDLYYQ 126
           +LG   K     R+ L     I          G    ++    +ASL+RL ++ +D+ + 
Sbjct: 63  VLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFA 122

Query: 127 HRID 130
           +R D
Sbjct: 123 NRPD 126
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d1ur3m_ 298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d1pyfa_ 311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1pz1a_ 333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d3eaua1 326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1gvea_ 324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d1vp5a_ 284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1lqaa_ 346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d1afsa_ 319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1hw6a_ 262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1qwka_ 312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1s1pa_ 315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1mi3a_ 319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1us0a_ 314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1mzra_ 274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1hqta_ 324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1frba_ 315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1olta_ 441 Oxygen-independent coproporphyrinogen III oxidase 89.43
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 80.23
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Hypothetical oxidoreductase YdhF
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=9.6e-42  Score=272.07  Aligned_cols=166  Identities=27%  Similarity=0.378  Sum_probs=149.3

Q ss_pred             CccceecCCCCcccCcceeccccCCCCCCCCCChHHHHHHHHHHHHcCCCeeeccCCCCCCcHHHHHHHhhcc--CCCCC
Q 030178            3 TVRRMKLGSQGLEVSAQGLGCMGMSALYGPPKPEPDMIALIRHAINSGITFLDTSDIYGPHTNEILLGKAFKG--GFRER   80 (182)
Q Consensus         3 ~m~~~~lg~~g~~vs~l~lGt~~~~~~~~~~~~~~~~~~~l~~a~~~G~~~~Dta~~Yg~g~~e~~lG~~l~~--~~r~~   80 (182)
                      .|++++||++|++||+||||||++++ |  ..+++++.++|++|+++|||+||||+.||+|.+|+.+|++|+.  .+|++
T Consensus         1 ~m~~~~lg~~G~~vs~ig~G~~~~~~-~--~~~~~~~~~~l~~A~~~Gin~~DTA~~Yg~g~se~~lG~al~~~~~~r~~   77 (298)
T d1ur3m_           1 LVQRITIAPQGPEFSRFVMGYWRLMD-W--NMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALKLAPHLRER   77 (298)
T ss_dssp             CCCEEECSTTCCEEESSEEECTTTTT-T--TCCHHHHHHHHHHHHHHTCCEEECCSSTTTTTHHHHHHHHHHHCGGGTTT
T ss_pred             CCCceEeCCCCCEeCCEEEeCcccCC-C--CCCHHHHHHHHHHHHHcCCCEEEeccccCCccccccccccccccccchhh
Confidence            48999999999999999999999864 3  3578899999999999999999999999999999999999986  46999


Q ss_pred             EEEEeccCCCcCCC----CCCCCCCHHHHHHHHHHHHHHhCCCccceEEeecCCCCCCHHHHHHHHHHHhHcCccccccc
Q 030178           81 AELATKFGIGIVDG----KYGYHGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTVISLSLLPSFVKLKCSIL  156 (182)
Q Consensus        81 ~~i~tK~~~~~~~~----~~~~~~~~~~i~~~~~~sL~~Lg~~~lDl~~lh~~d~~~~~~~~~~al~~l~~~G~ir~~~~  156 (182)
                      ++|+||++......    ......+++.+++++++||++||++|||+|++|++++..+.+++|++|++++++|+||.   
T Consensus        78 ~~i~tK~g~~~~~~~~~~~~~~~~s~~~i~~~~~~SL~rL~~d~iDl~~lH~~d~~~~~~e~~~~l~~lk~~GkIr~---  154 (298)
T d1ur3m_          78 MEIVSKCGIATTAREENVIGHYITDRDHIIKSAEQSLINLATDHLDLLLIHRPDPLMDADEVADAFKHLHQSGKVRH---  154 (298)
T ss_dssp             CEEEEEECEECTTSTTCSSCEECCCHHHHHHHHHHHHHHHTCSCBSEEEECSCCTTCCHHHHHHHHHHHHHTTSBCC---
T ss_pred             hhhhhcccccccCCCcCcccCCCCCHHHHHHHHHhhhhhhccccccccccccccccchhHHHHHHHHHhhccCccee---
Confidence            99999998654321    12245789999999999999999999999999999999999999999999999999996   


Q ss_pred             eeeccchhHHHHHHHhcCC
Q 030178          157 YCGVVALVAKQMLLLFTNI  175 (182)
Q Consensus       157 ~iGvs~~~~~~~~~l~~~~  175 (182)
                       ||+|||++++++.+....
T Consensus       155 -iG~S~~~~~~~~~~~~~~  172 (298)
T d1ur3m_         155 -FGVSNFTPAQFALLQSRL  172 (298)
T ss_dssp             -EEEESCCHHHHHHHHTTC
T ss_pred             -ecCCCCcHHHHHHHHhhh
Confidence             999999999999988643
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure