Citrus Sinensis ID: 030208

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MEPVKEEEEVYSWREVNLPALSPTAAAEPELERETGERRRGRDILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGKGTSPSCIPCF
ccccccccccccEEEEEcccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcHHHHHHHHHHHccccEEEEccccccccccEEcccHHHHHHHHcccccEEEEccccccccccccc
cccccccHHEcccEEEEcccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHccccEEEEEccccHHHHHHHHccHHHHHHHccccccEEEEccccccccccccc
mepvkeeeevyswrevnlpalsptaaaepeleretgerrrgRDILiavdhgpnskhAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQgsvgeyclhhcktapiivvpgkgtspscipcf
mepvkeeeevyswrevnlpalsptaaaepeleretgerrrgRDILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTApiivvpgkgtspscipcf
MEPVKEEEEVYSWREVNLPALSPTAAAepeleretgerrrgrDILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGKGTSPSCIPCF
********************************************LIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGK**********
*******************************************ILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVV**********PCF
**********YSWREVNLPALSPT**************RRGRDILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGKG*********
*****EEEEVYSWREVNLPALSPTAAAE**********RRGRDILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGKGTS*SC**C*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPVKEEEEVYSWREVNLPALSPTAAAEPELERETGERRRGRDILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGKGTSPSCIPCF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q8LGG8175 Universal stress protein no no 0.386 0.4 0.357 1e-06
P72745108 Universal stress protein N/A no 0.491 0.824 0.28 0.0001
>sp|Q8LGG8|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%)

Query: 107 VRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPII 166
           V  +A I  GD   VIC+E +R++P  +V+GSRG G  Q V  G+V  +C+ H +   + 
Sbjct: 101 VGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMT 160

Query: 167 VVPGKGTSPS 176
           +      +PS
Sbjct: 161 IKRNADETPS 170

Arabidopsis thaliana (taxid: 3702)
>sp|P72745|Y1101_SYNY3 Universal stress protein Slr1101 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1101 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
449462226177 PREDICTED: uncharacterized protein LOC10 0.883 0.903 0.782 4e-70
255543701180 conserved hypothetical protein [Ricinus 0.933 0.938 0.783 7e-65
45720184178 putative universal stress protein [Cicer 0.977 0.994 0.758 7e-65
351725895177 uncharacterized protein LOC100306377 [Gl 0.972 0.994 0.741 2e-64
388522921178 unknown [Lotus japonicus] 0.977 0.994 0.735 4e-64
357467311178 Universal stress protein A-like protein 0.977 0.994 0.735 4e-64
224080359177 predicted protein [Populus trichocarpa] 0.933 0.954 0.777 5e-64
195626300186 pathogen induced protein 2-4 [Zea mays] 0.944 0.919 0.734 7e-64
325975910177 universal stress protein [Salvia miltior 0.911 0.932 0.761 3e-63
284433778199 response to dessication RD2 [Jatropha cu 0.939 0.854 0.761 3e-63
>gi|449462226|ref|XP_004148842.1| PREDICTED: uncharacterized protein LOC101210790 [Cucumis sativus] gi|449515579|ref|XP_004164826.1| PREDICTED: uncharacterized LOC101210790 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 145/161 (90%), Gaps = 1/161 (0%)

Query: 11  YSWREVNLPALSPTAAAEPELERETGERRRGRDILIAVDHGPNSKHAFDWALIHLCRLAD 70
           Y+WREV LP+L P    EPELERET ERRRGRDILIAVDHGPNSKHAFDWALIH CRLAD
Sbjct: 10  YNWREVRLPSLIPVVP-EPELERETAERRRGRDILIAVDHGPNSKHAFDWALIHFCRLAD 68

Query: 71  TIHLVHAVSSVQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLK 130
           TIHLVHAVS+V+N++VY+ SQGLMEKLA+EA +VAMVRT ARIV+GDA KVICKEAE+LK
Sbjct: 69  TIHLVHAVSNVKNELVYEFSQGLMEKLAVEAFEVAMVRTVARIVQGDAGKVICKEAEKLK 128

Query: 131 PAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGK 171
           PAAVV+G+RGR LIQSVLQGSV E+  H+CK+AP+++VPGK
Sbjct: 129 PAAVVMGTRGRSLIQSVLQGSVSEHVFHNCKSAPVVIVPGK 169

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255543701|ref|XP_002512913.1| conserved hypothetical protein [Ricinus communis] gi|223547924|gb|EEF49416.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|45720184|emb|CAG14983.1| putative universal stress protein [Cicer arietinum] Back     alignment and taxonomy information
>gi|351725895|ref|NP_001237876.1| uncharacterized protein LOC100306377 [Glycine max] gi|255628351|gb|ACU14520.1| unknown [Glycine max] gi|255647216|gb|ACU24076.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388522921|gb|AFK49522.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357467311|ref|XP_003603940.1| Universal stress protein A-like protein [Medicago truncatula] gi|217075524|gb|ACJ86122.1| unknown [Medicago truncatula] gi|355492988|gb|AES74191.1| Universal stress protein A-like protein [Medicago truncatula] gi|388519485|gb|AFK47804.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224080359|ref|XP_002306112.1| predicted protein [Populus trichocarpa] gi|222849076|gb|EEE86623.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|195626300|gb|ACG34980.1| pathogen induced protein 2-4 [Zea mays] Back     alignment and taxonomy information
>gi|325975910|gb|ADZ48040.1| universal stress protein [Salvia miltiorrhiza] Back     alignment and taxonomy information
>gi|284433778|gb|ADB85095.1| response to dessication RD2 [Jatropha curcas] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
TAIR|locus:2049334193 RD2 "AT2G21620" [Arabidopsis t 0.933 0.875 0.615 2.1e-54
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.591 0.524 0.324 3.2e-16
TAIR|locus:2199282160 AT1G68300 "AT1G68300" [Arabido 0.342 0.387 0.375 1.4e-12
TAIR|locus:2222687175 AT5G14680 "AT5G14680" [Arabido 0.408 0.422 0.368 1.5e-11
TAIR|locus:2084153175 AT3G01520 "AT3G01520" [Arabido 0.337 0.348 0.387 4.2e-10
TAIR|locus:2043273162 AT2G47710 "AT2G47710" [Arabido 0.303 0.339 0.345 4.9e-10
TAIR|locus:2096089162 AT3G62550 "AT3G62550" [Arabido 0.447 0.5 0.289 8.3e-10
TAIR|locus:2131719260 PHOS34 "AT4G27320" [Arabidopsi 0.320 0.223 0.428 1.6e-08
TAIR|locus:2081531226 AT3G11930 "AT3G11930" [Arabido 0.386 0.309 0.297 3.4e-08
TAIR|locus:2147319242 PHOS32 "AT5G54430" [Arabidopsi 0.320 0.239 0.421 8.1e-08
TAIR|locus:2049334 RD2 "AT2G21620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 562 (202.9 bits), Expect = 2.1e-54, P = 2.1e-54
 Identities = 109/177 (61%), Positives = 136/177 (76%)

Query:     1 MEPVKEEEEVYSWREVNLPALSPTAAAXXXXXXXXXXXXXXXDILIAVDHGPNSKHAFDW 60
             ME + E+EE YS+REV LP+L P                   D+++AVDHGPNSKHAFDW
Sbjct:     1 MEALPEDEE-YSFREVVLPSLIPVVPEPELERESGERRRGR-DVIVAVDHGPNSKHAFDW 58

Query:    61 ALIHLCRLADTIHLVHAVSS------VQNQIVYDMSQGLMEKLAIEAMDVAMVRTKARIV 114
             AL+H CRLADT+HLVHAVSS      V+N +VY+ SQ LMEKLA+EA  VAMV++ AR+V
Sbjct:    59 ALVHFCRLADTLHLVHAVSSSFSLQCVKNDVVYETSQALMEKLAVEAYQVAMVKSVARVV 118

Query:   115 EGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGK 171
             EGDA KVICKEAE++KPAAV++G+RGR L++SVLQGSV EYC H+CK+AP+I+VPGK
Sbjct:   119 EGDAGKVICKEAEKVKPAAVIVGTRGRSLVRSVLQGSVSEYCFHNCKSAPVIIVPGK 175
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0009269 "response to desiccation" evidence=IEP
GO:0002238 "response to molecule of fungal origin" evidence=RCA
GO:0016036 "cellular response to phosphate starvation" evidence=RCA
GO:0019375 "galactolipid biosynthetic process" evidence=RCA
GO:0042631 "cellular response to water deprivation" evidence=RCA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2222687 AT5G14680 "AT5G14680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084153 AT3G01520 "AT3G01520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043273 AT2G47710 "AT2G47710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_IV0562
hypothetical protein (178 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 2e-24
pfam00582139 pfam00582, Usp, Universal stress protein family 2e-18
COG0589154 COG0589, UspA, Universal stress protein UspA and r 1e-11
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score = 92.0 bits (229), Expect = 2e-24
 Identities = 44/130 (33%), Positives = 64/130 (49%), Gaps = 6/130 (4%)

Query: 44  ILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAI---- 99
           IL+AVD    S+ A  WA     RL   + L+H V    +           E  A+    
Sbjct: 2   ILVAVDGSEESERALRWAARLARRLGAELVLLHVVDPPPSSAAELAELLEEEARALLEAL 61

Query: 100 -EAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLH 158
            EA+  A V+ +  ++EGD A+ I + AE L    +V+GSRGR  ++ +L GSV E  L 
Sbjct: 62  REALAEAGVKVETVVLEGDPAEAILEAAEELGADLIVMGSRGRSGLRRLLLGSVAERVLR 121

Query: 159 HCKTAPIIVV 168
           H    P++VV
Sbjct: 122 HAPC-PVLVV 130

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
PRK15005144 universal stress protein F; Provisional 99.93
PRK15456142 universal stress protein UspG; Provisional 99.93
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.92
PRK09982142 universal stress protein UspD; Provisional 99.92
PRK15118144 universal stress global response regulator UspA; P 99.91
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.9
PRK10116142 universal stress protein UspC; Provisional 99.9
PRK11175305 universal stress protein UspE; Provisional 99.9
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.89
cd01987124 USP_OKCHK USP domain is located between the N-term 99.88
PRK11175 305 universal stress protein UspE; Provisional 99.86
cd00293130 USP_Like Usp: Universal stress protein family. The 99.83
COG0589154 UspA Universal stress protein UspA and related nuc 99.77
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.61
PRK10490 895 sensor protein KdpD; Provisional 99.51
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.41
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.69
PLN03159832 cation/H(+) antiporter 15; Provisional 97.68
PLN03159 832 cation/H(+) antiporter 15; Provisional 97.49
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 96.87
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 96.75
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 96.4
PRK12342254 hypothetical protein; Provisional 95.74
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 95.3
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 94.94
PRK03359256 putative electron transfer flavoprotein FixA; Revi 94.47
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 94.21
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 93.98
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 93.5
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 92.97
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 92.64
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 92.16
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 91.87
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 91.1
cd01995169 ExsB ExsB is a transcription regulator related pro 91.08
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 90.45
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 90.18
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 89.67
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 89.32
TIGR02852187 spore_dpaB dipicolinic acid synthetase, B subunit. 89.25
PRK13820 394 argininosuccinate synthase; Provisional 89.24
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 89.08
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 88.11
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 87.61
cd01713173 PAPS_reductase This domain is found in phosphoaden 87.59
PRK08305196 spoVFB dipicolinate synthase subunit B; Reviewed 86.59
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 85.81
PRK00919 307 GMP synthase subunit B; Validated 84.71
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 84.25
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 84.23
PRK06029185 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Prov 83.48
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 82.77
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 82.42
PRK08091228 ribulose-phosphate 3-epimerase; Validated 82.36
TIGR02699174 archaeo_AfpA archaeoflavoprotein AfpA. The prototy 82.12
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 82.06
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 81.38
cd00408 281 DHDPS-like Dihydrodipicolinate synthase family. A 80.44
TIGR00290223 MJ0570_dom MJ0570-related uncharacterized domain. 80.35
>PRK15005 universal stress protein F; Provisional Back     alignment and domain information 
Probab=99.93  E-value=1e-24  Score=154.45  Aligned_cols=127  Identities=17%  Similarity=0.276  Sum_probs=100.5

Q ss_pred             CCCeEEEEEcCChh--hHHHHHHHHHHhccCCCEEEEEEEecCCchh---------------hHHHHHHHHHHHHHHHHh
Q 030208           40 RGRDILIAVDHGPN--SKHAFDWALIHLCRLADTIHLVHAVSSVQNQ---------------IVYDMSQGLMEKLAIEAM  102 (181)
Q Consensus        40 ~~~~Ilv~vd~s~~--s~~a~~~a~~la~~~~a~l~llhV~~~~~~~---------------~~~~~~~~~l~~~~~~~~  102 (181)
                      |+++||+|+|+|+.  +..++++|.++|+..+++++++||++.....               ...+..++.++++.+. .
T Consensus         1 m~~~ILv~~D~s~~~~~~~a~~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~-~   79 (144)
T PRK15005          1 MNRTILVPIDISDSELTQRVISHVEAEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPAMDDLKAEAKSQLEEIIKK-F   79 (144)
T ss_pred             CCccEEEecCCCchhHHHHHHHHHHHHHhccCCeEEEEEEEccCcccccccccccccchHHHHHHHHHHHHHHHHHHH-h
Confidence            57999999999987  5799999999999999999999998743210               0011222333332222 2


Q ss_pred             hhcCceEEEEEecCChHHHHHHHHHHhCCCEEEEeccCCCcccccccCchhhHHHhcCCCccEEEEc
Q 030208          103 DVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVP  169 (181)
Q Consensus       103 ~~~~i~~~~~~~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~gs~~~~ll~~~~~~pVlvv~  169 (181)
                      ...+..++..+..|++.+.|++++++.++||||||++ ++++.+.++||++++|+++++ ||||+||
T Consensus        80 ~~~~~~~~~~v~~G~p~~~I~~~a~~~~~DLIV~Gs~-~~~~~~~llGS~a~~vl~~a~-cpVlvVr  144 (144)
T PRK15005         80 KLPTDRVHVHVEEGSPKDRILELAKKIPADMIIIASH-RPDITTYLLGSNAAAVVRHAE-CSVLVVR  144 (144)
T ss_pred             CCCCCceEEEEeCCCHHHHHHHHHHHcCCCEEEEeCC-CCCchheeecchHHHHHHhCC-CCEEEeC
Confidence            2334567788889999999999999999999999998 467888899999999999999 9999996

>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK08305 spoVFB dipicolinate synthase subunit B; Reviewed Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06029 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR02699 archaeo_AfpA archaeoflavoprotein AfpA Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>TIGR00290 MJ0570_dom MJ0570-related uncharacterized domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
2gm3_A175 Crystal Structure Of An Universal Stress Protein Fa 3e-07
>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%)
Query: 110 KARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVP 169
           +A I  GD   VIC+E +R++P  +V+GSRG G  Q V  G+V  +C+ H +     +  
Sbjct: 104 EAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVXTIKR 163
Query: 170 GKGTSPS 176
               +PS
Sbjct: 164 NADETPS 170

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 9e-26
2z08_A137 Universal stress protein family; uncharacterized c 9e-20
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 3e-19
3loq_A294 Universal stress protein; structural genomics, PSI 6e-19
3loq_A 294 Universal stress protein; structural genomics, PSI 2e-13
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 2e-17
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 2e-16
3s3t_A146 Nucleotide-binding protein, universal stress PROT 2e-16
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 3e-16
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 9e-16
3fdx_A143 Putative filament protein / universal stress PROT; 1e-15
3tnj_A150 Universal stress protein (USP); structural genomic 2e-15
3dlo_A155 Universal stress protein; unknown function, struct 3e-15
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 6e-15
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 1e-14
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 2e-12
3fg9_A156 Protein of universal stress protein USPA family; A 4e-14
3olq_A319 Universal stress protein E; structural genomics, P 2e-12
3olq_A 319 Universal stress protein E; structural genomics, P 1e-10
3mt0_A290 Uncharacterized protein PA1789; structural genomic 1e-11
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 6e-10
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 3e-11
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 6e-09
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score = 96.4 bits (240), Expect = 9e-26
 Identities = 36/168 (21%), Positives = 68/168 (40%), Gaps = 31/168 (18%)

Query: 42  RDILIAVD---------HGPNSKHAFDWALIHLCRLADT---IHLVHAVSSVQNQI---- 85
             +++AV+            + K AF+W L  + R   +   I L+H     ++      
Sbjct: 6   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDGFDDVD 65

Query: 86  -------VYDMSQGLMEKLAIEAMDVAM-------VRTKARIVEGDAAKVICKEAERLKP 131
                   +   +   +   +  ++  +       V  +A I  GD   VIC+E +R++P
Sbjct: 66  SIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRP 125

Query: 132 AAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGKGTSPSCIP 179
             +V+GSRG G  Q V  G+V  +C+ H +  P++ +          P
Sbjct: 126 DFLVVGSRGLGRFQKVFVGTVSAFCVKHAEC-PVMTIKRNADETPSDP 172
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
3tnj_A150 Universal stress protein (USP); structural genomic 99.95
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.94
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.94
2z08_A137 Universal stress protein family; uncharacterized c 99.94
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.94
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.94
3dlo_A155 Universal stress protein; unknown function, struct 99.94
3fg9_A156 Protein of universal stress protein USPA family; A 99.93
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.93
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.93
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.92
3fdx_A143 Putative filament protein / universal stress PROT; 99.92
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.92
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.91
3olq_A319 Universal stress protein E; structural genomics, P 99.9
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.9
3loq_A294 Universal stress protein; structural genomics, PSI 99.9
3olq_A 319 Universal stress protein E; structural genomics, P 99.89
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.88
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.88
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.87
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.87
3loq_A 294 Universal stress protein; structural genomics, PSI 99.87
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.85
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 96.08
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 94.41
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 94.25
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 93.25
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 92.77
1o97_C 264 Electron transferring flavoprotein beta-subunit; F 91.24
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 89.62
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 89.41
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 87.88
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 86.78
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 85.02
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 84.48
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 84.45
1g63_A181 Epidermin modifying enzyme EPID; alpha, beta prote 83.53
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 83.14
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 82.82
3zqu_A209 Probable aromatic acid decarboxylase; lyase; HET: 82.44
1efv_B255 Electron transfer flavoprotein; electron transport 81.92
2hma_A 376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 81.82
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 81.66
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 81.46
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 80.88
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 80.33
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 80.26
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
Probab=99.95  E-value=1.1e-26  Score=164.03  Aligned_cols=134  Identities=19%  Similarity=0.273  Sum_probs=98.2

Q ss_pred             CCCCCCeEEEEEcCChhhHHHHHHHHHHhccCCCEEEEEEEecCCch-------------hhHHHHHHHHHHHHHHHHhh
Q 030208           37 ERRRGRDILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQN-------------QIVYDMSQGLMEKLAIEAMD  103 (181)
Q Consensus        37 ~~~~~~~Ilv~vd~s~~s~~a~~~a~~la~~~~a~l~llhV~~~~~~-------------~~~~~~~~~~l~~~~~~~~~  103 (181)
                      .|+++++||||+|+++.+..++++|..+|+..+++|+++||.+....             ....+...+..++.+++..+
T Consensus         2 ~m~~~~~ILv~vD~s~~s~~al~~a~~la~~~~a~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~   81 (150)
T 3tnj_A            2 HMSVYHHILLAVDFSSEDSQVVQKVRNLASQIGARLSLIHVLDNIPMPDTPYGTAIPLDTETTYDAMLDVEKQKLSQIGN   81 (150)
T ss_dssp             --CCCSEEEEECCCSTTHHHHHHHHHHHHHHHTCEEEEEEEEC--------CTTCCCSSSCCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCccceEEEEeCCCHHHHHHHHHHHHHHhhcCCEEEEEEEEcCccccccccccccCcCHHHHHHHHHHHHHHHHHHHHH
Confidence            46779999999999999999999999999999999999999875321             00112222233333333333


Q ss_pred             hcCce-EEEEEecCChHHHHHHHHHHhCCCEEEEeccCCCcccccccCchhhHHHhcCCCccEEEEcCCC
Q 030208          104 VAMVR-TKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGKG  172 (181)
Q Consensus       104 ~~~i~-~~~~~~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~gs~~~~ll~~~~~~pVlvv~~~~  172 (181)
                      ..++. +++.+..|++.+.|++++++.++||||||+++++.+. +++||++++++++++ |||++||+.+
T Consensus        82 ~~~~~~~~~~~~~g~~~~~I~~~a~~~~~dliV~G~~~~~~~~-~~~Gs~~~~vl~~~~-~pVlvv~~~~  149 (150)
T 3tnj_A           82 TLGIDPAHRWLVWGEPREEIIRIAEQENVDLIVVGSHGRHGLA-LLLGSTANSVLHYAK-CDVLAVRLRD  149 (150)
T ss_dssp             HHTCCGGGEEEEESCHHHHHHHHHHHTTCSEEEEEEC---------CCCHHHHHHHHCS-SEEEEEECCC
T ss_pred             HcCCCcceEEEecCCHHHHHHHHHHHcCCCEEEEecCCCCCcC-eEecchHHHHHHhCC-CCEEEEeCCC
Confidence            33555 4667788999999999999999999999999999999 999999999999999 9999999864
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0 Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 5e-15
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 1e-13
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 8e-13
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 2e-12
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 6e-11
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 7e-07
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Hypothetical protein TTHA0895
species: Thermus thermophilus [TaxId: 274]

 Score = 66.4 bits (161), Expect = 5e-15
 Identities = 29/135 (21%), Positives = 58/135 (42%), Gaps = 9/135 (6%)

Query: 42  RDILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQIVYDMSQGLMEKLAIEA 101
           + IL+A D   +++ A + A          + +VHA   V + +     +  + +    A
Sbjct: 2   KTILLAYDGSEHARRAAEVAKAEAEAHGARLIVVHAYEPVPDYLGEPFFEEALRRRLERA 61

Query: 102 MDVA--------MVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVG 153
             V         + +  A ++EG  A+ I + A   K   +V+G+RG G + S+  GS  
Sbjct: 62  EGVLEEARALTGVPKEDALLLEGVPAEAILQAARAEKADLIVMGTRGLGALGSLFLGSQS 121

Query: 154 EYCLHHCKTAPIIVV 168
           +  +      P+++V
Sbjct: 122 QRVVAEAPC-PVLLV 135
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.96
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.94
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.92
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.91
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.91
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.87
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 96.07
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 94.96
d1efpb_246 Small, beta subunit of electron transfer flavoprot 94.75
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 91.51
d1efvb_252 Small, beta subunit of electron transfer flavoprot 91.14
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 90.64
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 89.35
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 89.18
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 88.64
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 87.37
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 86.16
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 85.81
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 84.9
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 84.12
d2d13a1226 Hypothetical protein PH1257 {Archaeon Pyrococcus h 82.47
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.96  E-value=7e-28  Score=170.71  Aligned_cols=132  Identities=22%  Similarity=0.302  Sum_probs=109.9

Q ss_pred             CCCCeEEEEEcCChhhHHHHHHHHHHhccCCCEEEEEEEecCCchhh-------------------H--------HHHHH
Q 030208           39 RRGRDILIAVDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNQI-------------------V--------YDMSQ   91 (181)
Q Consensus        39 ~~~~~Ilv~vd~s~~s~~a~~~a~~la~~~~a~l~llhV~~~~~~~~-------------------~--------~~~~~   91 (181)
                      .|+|+||||+|+|+.+.+++++|..+|+..+++|+++||.+......                   .        .+..+
T Consensus         1 ~m~~~ILvavD~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (160)
T d1mjha_           1 VMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEAK   80 (160)
T ss_dssp             CCCCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHHH
T ss_pred             CCcCeEEEEECCCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHHHHH
Confidence            37899999999999999999999999999999999999976431100                   0        11222


Q ss_pred             HHHHHHHHHHhhhcCceEEEEEecCChHHHHHHHHHHhCCCEEEEeccCCCcccccccCchhhHHHhcCCCccEEEEcCC
Q 030208           92 GLMEKLAIEAMDVAMVRTKARIVEGDAAKVICKEAERLKPAAVVIGSRGRGLIQSVLQGSVGEYCLHHCKTAPIIVVPGK  171 (181)
Q Consensus        92 ~~l~~~~~~~~~~~~i~~~~~~~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~gs~~~~ll~~~~~~pVlvv~~~  171 (181)
                      +.++++. ..+...++.+++.+..|++.+.|+++|++.++||||||+++++++.++++||++++|+++++ |||+|||++
T Consensus        81 ~~l~~~~-~~~~~~gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~-~pVlvV~~~  158 (160)
T d1mjha_          81 NKMENIK-KELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSN-KPVLVVKRK  158 (160)
T ss_dssp             HHHHHHH-HHHHHTTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCC-SCEEEECCC
T ss_pred             HHHHHHH-HHHHhcCCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCC-CCEEEEcCC
Confidence            3333322 33445678899999999999999999999999999999999999999999999999999999 999999986


Q ss_pred             C
Q 030208          172 G  172 (181)
Q Consensus       172 ~  172 (181)
                      .
T Consensus       159 ~  159 (160)
T d1mjha_         159 N  159 (160)
T ss_dssp             C
T ss_pred             C
Confidence            5
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure