Citrus Sinensis ID: 030235
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 181 | ||||||
| 359488731 | 183 | PREDICTED: uncharacterized protein LOC10 | 0.966 | 0.956 | 0.545 | 5e-40 | |
| 255552698 | 219 | metal ion binding protein, putative [Ric | 0.955 | 0.789 | 0.539 | 7e-38 | |
| 18417512 | 178 | heavy metal transport/detoxification dom | 0.917 | 0.932 | 0.518 | 2e-37 | |
| 224060008 | 184 | predicted protein [Populus trichocarpa] | 0.977 | 0.961 | 0.572 | 3e-37 | |
| 9755658 | 175 | putative protein [Arabidopsis thaliana] | 0.911 | 0.942 | 0.518 | 4e-37 | |
| 449459422 | 181 | PREDICTED: uncharacterized protein LOC10 | 0.972 | 0.972 | 0.494 | 1e-35 | |
| 297807505 | 178 | heavy-metal-associated domain-containing | 0.961 | 0.977 | 0.508 | 8e-35 | |
| 388491950 | 178 | unknown [Lotus japonicus] gi|388504556|g | 0.519 | 0.528 | 0.687 | 5e-31 | |
| 388514407 | 195 | unknown [Medicago truncatula] | 0.524 | 0.487 | 0.659 | 7e-28 | |
| 351726030 | 183 | uncharacterized protein LOC100305469 [Gl | 0.651 | 0.644 | 0.624 | 6e-27 |
| >gi|359488731|ref|XP_002275276.2| PREDICTED: uncharacterized protein LOC100264617 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 169 bits (427), Expect = 5e-40, Method: Compositional matrix adjust.
Identities = 102/187 (54%), Positives = 132/187 (70%), Gaps = 12/187 (6%)
Query: 1 MATVSLSSTLYSTYRTKLHTSKVMPSCS--LTIPIR---TFNFQIKLALKNKKQKWGFNG 55
MAT++ S+L S +T +H S + P+ N +L +KN+ + +G
Sbjct: 1 MATIAAVSSLSSICKTSIHCHGASRHSSSFMKFPVHRNCAANCFGRLTVKNENRS---HG 57
Query: 56 MRVLRSSEEETLITEQETEAVEETVAADEQQPVAVPVSPSDKLTMYFQADGAMNETAIPA 115
R +RS EETL+ E+E E EE + D QPV+VPVSPSD LTM+FQA+G MNETAIP
Sbjct: 58 SRKIRSVAEETLVPEEEGEEGEEGSSVD--QPVSVPVSPSDILTMFFQAEGTMNETAIPT 115
Query: 116 VTQALQGTEGISDLKVQVIEGIATVE--KQTTVQATGVAANLVEIIQGSGFKLQTLNLSF 173
VT+AL+ TEGI+ LKVQV+EGIA+V KQTTVQATGVA++LVE IQGSGFKLQTLNLSF
Sbjct: 116 VTKALEETEGITTLKVQVVEGIASVALTKQTTVQATGVASSLVETIQGSGFKLQTLNLSF 175
Query: 174 DDEEEVL 180
+DEE+++
Sbjct: 176 EDEEDII 182
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255552698|ref|XP_002517392.1| metal ion binding protein, putative [Ricinus communis] gi|223543403|gb|EEF44934.1| metal ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|18417512|ref|NP_568306.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|14517526|gb|AAK62653.1| AT5g14910/F2G14_30 [Arabidopsis thaliana] gi|15810113|gb|AAL06982.1| AT5g14910/F2G14_30 [Arabidopsis thaliana] gi|21554207|gb|AAM63286.1| unknown [Arabidopsis thaliana] gi|332004705|gb|AED92088.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224060008|ref|XP_002300027.1| predicted protein [Populus trichocarpa] gi|222847285|gb|EEE84832.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|9755658|emb|CAC01810.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449459422|ref|XP_004147445.1| PREDICTED: uncharacterized protein LOC101219347 [Cucumis sativus] gi|449517154|ref|XP_004165611.1| PREDICTED: uncharacterized LOC101219347 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297807505|ref|XP_002871636.1| heavy-metal-associated domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317473|gb|EFH47895.1| heavy-metal-associated domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|388491950|gb|AFK34041.1| unknown [Lotus japonicus] gi|388504556|gb|AFK40344.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|388514407|gb|AFK45265.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|351726030|ref|NP_001235833.1| uncharacterized protein LOC100305469 [Glycine max] gi|255625599|gb|ACU13144.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 181 | ||||||
| TAIR|locus:2147795 | 178 | AT5G14910 [Arabidopsis thalian | 0.519 | 0.528 | 0.75 | 2.3e-32 |
| TAIR|locus:2147795 AT5G14910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 354 (129.7 bits), Expect = 2.3e-32, P = 2.3e-32
Identities = 72/96 (75%), Positives = 85/96 (88%)
Query: 88 VAVPVSPSDKLTMYFQADGAMNETAIPAVTQALQGTEGISDLKVQVIEGIATVE--KQTT 145
V+VPVSPSD LTM+FQADG +NE AIP VT+ALQ +G+S+LKVQV EG+A VE KQTT
Sbjct: 83 VSVPVSPSDMLTMFFQADGTLNEAAIPNVTRALQDIDGVSNLKVQVSEGVAVVELLKQTT 142
Query: 146 VQATGVAANLVEIIQGSGFKLQTLNLSFDDEEEVLV 181
VQATGVA+NLVE IQG+GFKLQTLNLSF+D++EVLV
Sbjct: 143 VQATGVASNLVETIQGAGFKLQTLNLSFEDDDEVLV 178
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.316 0.130 0.354 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 181 147 0.00091 103 3 11 22 0.47 31
30 0.50 33
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 567 (60 KB)
Total size of DFA: 114 KB (2075 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 12.45u 0.15s 12.60t Elapsed: 00:00:00
Total cpu time: 12.45u 0.15s 12.60t Elapsed: 00:00:00
Start: Fri May 10 15:21:07 2013 End: Fri May 10 15:21:07 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT5G14910 | heavy-metal-associated domain-containing protein; heavy-metal-associated domain-containing protein; FUNCTIONS IN- metal ion binding; INVOLVED IN- metal ion transport; LOCATED IN- thylakoid, chloroplast thylakoid membrane, chloroplast stroma, chloroplast; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Heavy metal transport/detoxification protein (InterPro-IPR006121); Has 18 Blast hits to 18 proteins in 7 species- Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 18; Viruses - 0; Other Eukaryotes - 0 (source- NCBI BLink). (178 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| EDA3 | • | • | 0.958 | ||||||||
| AT1G71500 | • | • | 0.939 | ||||||||
| AT3G47070 | • | • | 0.937 | ||||||||
| emb1473 | • | 0.925 | |||||||||
| emb2184 | • | 0.923 | |||||||||
| AT4G01310 | • | 0.919 | |||||||||
| AT1G52220 | • | • | 0.919 | ||||||||
| AT4G17560 | • | 0.917 | |||||||||
| RRF | • | • | 0.914 | ||||||||
| AT5G47190 | • | 0.911 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 181 | |||
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.01 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 98.93 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 97.32 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.0 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 96.92 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 96.11 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 95.95 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 95.61 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 93.34 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 92.24 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 88.67 | |
| TIGR00268 | 252 | conserved hypothetical protein TIGR00268. The N-te | 87.83 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 80.77 | |
| PF02120 | 85 | Flg_hook: Flagellar hook-length control protein Fl | 80.23 |
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.01 E-value=9.2e-10 Score=76.99 Aligned_cols=65 Identities=22% Similarity=0.510 Sum_probs=57.5
Q ss_pred EEEEeeccCCCCCchHHHHHHhccCCCceeeEEEEecceEEE---eeeccccccchHHHHHHHHHhCCccceee
Q 030235 99 TMYFQADGAMNETAIPAVTQALQGTEGISDLKVQVIEGIATV---EKQTTVQATGVAANLVEIIQGSGFKLQTL 169 (181)
Q Consensus 99 ~m~f~aegt~~e~cV~sVTkALE~leGVsdVkVsLeeG~AtV---~kqttvqatgvassLvEAIe~aGFevqtl 169 (181)
.+.|+-+|-==++|+.+|+++|+.++||.+|+|+|+.|.+.| ...++. ..|+++|+++||++...
T Consensus 3 ~~~l~v~~MtC~~C~~~V~~al~~v~gv~~v~v~l~~~~~~V~~d~~~~~~------~~i~~ai~~aGy~~~~~ 70 (71)
T COG2608 3 KTTLKVEGMTCGHCVKTVEKALEEVDGVASVDVDLEKGTATVTFDSNKVDI------EAIIEAIEDAGYKVEEI 70 (71)
T ss_pred eEEEEECCcCcHHHHHHHHHHHhcCCCeeEEEEEcccCeEEEEEcCCcCCH------HHHHHHHHHcCCCeeec
Confidence 356888888889999999999999999999999999988887 446784 99999999999998653
|
|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00268 conserved hypothetical protein TIGR00268 | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF02120 Flg_hook: Flagellar hook-length control protein FliK; InterPro: IPR021136 This entry represents the C-terminal domain of the flagellar hook-length control protein FliK | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 181 | |||
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 98.96 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 98.94 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 98.83 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.76 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.76 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.75 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.73 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.72 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.72 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 98.71 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.71 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.7 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.68 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.67 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.66 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.64 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.63 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.62 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.62 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.62 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.62 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.62 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.56 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 98.53 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.52 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.51 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.51 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.5 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.49 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.43 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.39 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.33 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.31 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.22 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.11 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.06 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.03 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 97.87 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 97.72 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 97.66 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 97.3 |
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
Probab=98.96 E-value=8.6e-10 Score=69.87 Aligned_cols=64 Identities=19% Similarity=0.333 Sum_probs=57.0
Q ss_pred EEEeeccCCCCCchHHHHHHhccCCCceeeEEEEecceEEE--eeeccccccchHHHHHHHHHhCCccceee
Q 030235 100 MYFQADGAMNETAIPAVTQALQGTEGISDLKVQVIEGIATV--EKQTTVQATGVAANLVEIIQGSGFKLQTL 169 (181)
Q Consensus 100 m~f~aegt~~e~cV~sVTkALE~leGVsdVkVsLeeG~AtV--~kqttvqatgvassLvEAIe~aGFevqtl 169 (181)
+-|+-+|-.-.+|+.+|+++|+.++||.+++|++..+.++| +..++ .+.|.++|+++||++.-|
T Consensus 4 ~~~~v~gm~C~~C~~~i~~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~------~~~i~~~i~~~Gy~~~~~ 69 (69)
T 4a4j_A 4 INLQLEGMDCTSCASSIERAIAKVPGVQSCQVNFALEQAVVSYHGETT------PQILTDAVERAGYHARVL 69 (69)
T ss_dssp EEEEEESCCSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEECTTCC------HHHHHHHHHHTTCEEEEC
T ss_pred EEEEECCeecHHHHHHHHHHHhcCCCeEEEEEEecCCEEEEEECCCCC------HHHHHHHHHHcCCceEeC
Confidence 46788898899999999999999999999999999999999 35666 489999999999998643
|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 181 | |||
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.08 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.07 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.06 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.03 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.0 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 98.98 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 98.98 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 98.95 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 98.91 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 98.87 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 98.84 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 98.83 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 98.82 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 98.7 |
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Potential copper-translocating P-type ATPase CopA (YvgX) species: Bacillus subtilis [TaxId: 1423]
Probab=99.08 E-value=7.9e-11 Score=78.62 Aligned_cols=65 Identities=18% Similarity=0.339 Sum_probs=59.0
Q ss_pred cceEEEEeeccCCCCCchHHHHHHhccCCCceeeEEEEecceEEE---eeeccccccchHHHHHHHHHhCCccc
Q 030235 96 DKLTMYFQADGAMNETAIPAVTQALQGTEGISDLKVQVIEGIATV---EKQTTVQATGVAANLVEIIQGSGFKL 166 (181)
Q Consensus 96 d~l~m~f~aegt~~e~cV~sVTkALE~leGVsdVkVsLeeG~AtV---~kqttvqatgvassLvEAIe~aGFev 166 (181)
+.-..-|+-+|-.=.+|+.+|+++|..++||.+|+|++..+.++| +..+++ +.|+++|+++||++
T Consensus 4 ~~~~~~l~V~Gm~C~~C~~~Ie~~l~~~~gV~~v~v~~~~~~~~v~~d~~~~~~------~~i~~~i~~~Gy~v 71 (72)
T d1p6ta1 4 EQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGT------AAIQEKIEKLGYHV 71 (72)
T ss_dssp CCEEEEEEEESCCSSHHHHHHHHHHTTSSSEEEEEEEGGGTEEEEEECTTTSCH------HHHHHHHHHHTCEE
T ss_pred CceEEEEEECCeecHHHHHHHHHHHHcCCCcEEEEEEcCCCEEEEEECCCCCCH------HHHHHHHHHhCCcc
Confidence 344667999999999999999999999999999999999999999 566774 99999999999997
|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|