Citrus Sinensis ID: 030262

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MLSLLLRTFLLLMLFLASALICTCLSGTVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQRELAAAVKEEEKKKREEAKAAAAARIQAKMEAKKGQGKGKGKGK
cHHHHHHHHHHHHHHccccccccccEEEEEEEEEEccccccccccccccccEEEEcccccccccHHHHHHccccccEEEEEEccccccccccccccccccccEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
cEEEEEccHHEEcccccccccccccEEEEEEEEEEEccccEEEEcHHHcccEEEEcccccccHHHHHHHHccccccEEEEEEcHHHccccccEcccEcccccEEEEEEEEEEccccccccccccHHHHHHHHccccccccccccHcccccHHHHHHHHHHHHHHHHcccccccccccccc
MLSLLLRTFLLLMLFLASALICTClsgtvhyegslaetgevfdtthedntvFSFELGKGSVIRAWDIALRSmkvgevakltckpeyaygsagsppdvppdatLIFEVELVacrprkgsslgsVSEERARLEELKRQRELAAAVKEEEKKKREEAKAAAAARIQAKMEAkkgqgkgkgkgk
MLSLLLRTFLLLMLFLASALICTCLSGTVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVAcrprkgsslgsvseeraRLEELKRQRELAAAVKEEEKKKREEAKAAAAARIQAkmeakkgqgkgkgkgk
mlslllrtflllmlflasalICTCLSGTVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQrelaaavkeeekkkreeakaaaaariqakmeakkgqgkgkgkgk
***LLLRTFLLLMLFLASALICTCLSGTVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGS*********DATLIFEVELVAC********************************************************************
****LLRTFLLLMLFLASALICTCLSGTVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRP******************************EEEKKKREEAKAAAAARIQA****************
MLSLLLRTFLLLMLFLASALICTCLSGTVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQ********************************************
MLSLLLRTFLLLMLFLASALICTCLSGTVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSS*GSVSEERARLEELKRQRELAAAVKEEEKKKREEAKAAAAARIQAKMEA************
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSLLLRTFLLLMLFLASALICTCLSGTVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKMEAKKGQGKGKGKGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
Q9M2S7190 Peptidyl-prolyl cis-trans yes no 0.772 0.731 0.834 3e-56
Q02790 459 Peptidyl-prolyl cis-trans yes no 0.444 0.174 0.654 2e-26
Q9QVC8 458 Peptidyl-prolyl cis-trans yes no 0.444 0.174 0.654 4e-26
P27124 458 Peptidyl-prolyl cis-trans yes no 0.444 0.174 0.641 4e-26
P30416 458 Peptidyl-prolyl cis-trans yes no 0.444 0.174 0.641 9e-26
Q9TRY0 459 Peptidyl-prolyl cis-trans yes no 0.444 0.174 0.641 2e-25
Q13451 457 Peptidyl-prolyl cis-trans no no 0.45 0.177 0.585 9e-24
Q5RF88 457 Peptidyl-prolyl cis-trans no no 0.45 0.177 0.585 1e-23
Q9XSH5 457 Peptidyl-prolyl cis-trans N/A no 0.45 0.177 0.573 4e-23
Q9XSI2 457 Peptidyl-prolyl cis-trans N/A no 0.45 0.177 0.560 7e-23
>sp|Q9M2S7|FK201_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-1 OS=Arabidopsis thaliana GN=FKBP20-1 PE=2 SV=1 Back     alignment and function desciption
 Score =  217 bits (552), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 131/139 (94%)

Query: 29  VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAY 88
           VHYEG LAE  +VFDTT EDN VFSFELG GSVIR+WDIAL++MKVGEVAK+TCKPEYAY
Sbjct: 37  VHYEGILAEDEKVFDTTREDNLVFSFELGTGSVIRSWDIALKTMKVGEVAKITCKPEYAY 96

Query: 89  GSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQRELAAAVKEEEK 148
           G AGSPPD+PPDATLIFEVELVACRPRKG+S+GSVSEERARLE+LK+QRE+AAA KE++K
Sbjct: 97  GRAGSPPDIPPDATLIFEVELVACRPRKGASVGSVSEERARLEDLKKQREIAAAAKEDDK 156

Query: 149 KKREEAKAAAAARIQAKME 167
           KKREEAKAAAAARIQAK++
Sbjct: 157 KKREEAKAAAAARIQAKLD 175
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 Back     alignment and function description
>sp|P27124|FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 Back     alignment and function description
>sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 Back     alignment and function description
>sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens GN=FKBP5 PE=1 SV=2 Back     alignment and function description
>sp|Q5RF88|FKBP5_PONAB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Pongo abelii GN=FKBP5 PE=2 SV=1 Back     alignment and function description
>sp|Q9XSH5|FKBP5_SAIBB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saimiri boliviensis boliviensis GN=FKBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
388515907183 unknown [Medicago truncatula] 0.816 0.803 0.829 5e-61
30172151156 peptidylprolyl cis-trans isomerase [Oryz 0.666 0.769 0.858 1e-57
357131273256 PREDICTED: FK506-binding protein 59-like 0.772 0.542 0.748 2e-57
388518611188 unknown [Medicago truncatula] 0.772 0.739 0.827 7e-57
357492297258 Peptidyl-prolyl cis-trans isomerase FKBP 0.772 0.538 0.827 1e-56
363806914188 uncharacterized protein LOC100815917 [Gl 0.772 0.739 0.856 2e-56
225449458188 PREDICTED: FK506-binding protein 59 isof 0.777 0.744 0.85 9e-56
351721330188 uncharacterized protein LOC100500018 [Gl 0.772 0.739 0.877 1e-55
255581541186 fk506 binding protein, putative [Ricinus 0.777 0.752 0.878 1e-55
115464287186 Os05g0458100 [Oryza sativa Japonica Grou 0.777 0.752 0.857 2e-55
>gi|388515907|gb|AFK46015.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 122/147 (82%), Positives = 143/147 (97%)

Query: 29  VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAY 88
           VHYEG+LA+TGEVFDTTHEDNT+FSFE+GKGSVI+AWDIA+++MKVGE+AK+TCKPEYAY
Sbjct: 37  VHYEGTLADTGEVFDTTHEDNTIFSFEVGKGSVIKAWDIAVKTMKVGEIAKITCKPEYAY 96

Query: 89  GSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQRELAAAVKEEEK 148
           GSAGSPPD+PPD+TL+FEVELVACRPRKGS+ GSVSEERARL+ELK+QRE+AAA KEE+K
Sbjct: 97  GSAGSPPDIPPDSTLVFEVELVACRPRKGSTTGSVSEERARLDELKKQREIAAAAKEEDK 156

Query: 149 KKREEAKAAAAARIQAKMEAKKGQGKG 175
           KKREE KAAAAAR+QAK++AKKG GKG
Sbjct: 157 KKREEQKAAAAARVQAKLDAKKGHGKG 183

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|30172151|emb|CAD89783.1| peptidylprolyl cis-trans isomerase [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|357131273|ref|XP_003567263.1| PREDICTED: FK506-binding protein 59-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|388518611|gb|AFK47367.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357492297|ref|XP_003616437.1| Peptidyl-prolyl cis-trans isomerase FKBP4 [Medicago truncatula] gi|355517772|gb|AES99395.1| Peptidyl-prolyl cis-trans isomerase FKBP4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|363806914|ref|NP_001242048.1| uncharacterized protein LOC100815917 [Glycine max] gi|255640891|gb|ACU20728.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225449458|ref|XP_002283206.1| PREDICTED: FK506-binding protein 59 isoform 1 [Vitis vinifera] gi|359486789|ref|XP_003633475.1| PREDICTED: FK506-binding protein 59 [Vitis vinifera] gi|296086212|emb|CBI31653.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351721330|ref|NP_001235670.1| uncharacterized protein LOC100500018 [Glycine max] gi|255628543|gb|ACU14616.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255581541|ref|XP_002531576.1| fk506 binding protein, putative [Ricinus communis] gi|223528806|gb|EEF30812.1| fk506 binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|115464287|ref|NP_001055743.1| Os05g0458100 [Oryza sativa Japonica Group] gi|52353447|gb|AAU44015.1| putative peptidylprolyl cis-trans isomerase [Oryza sativa Japonica Group] gi|76057837|emb|CAH55766.1| peptidyl prolyl cis-trans isomerase [Oryza sativa Indica Group] gi|113579294|dbj|BAF17657.1| Os05g0458100 [Oryza sativa Japonica Group] gi|215686485|dbj|BAG87746.1| unnamed protein product [Oryza sativa Japonica Group] gi|218196920|gb|EEC79347.1| hypothetical protein OsI_20211 [Oryza sativa Indica Group] gi|222631841|gb|EEE63973.1| hypothetical protein OsJ_18799 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
UNIPROTKB|Q65XG1186 OJ1362_D02.6 "Peptidyl-prolyl 0.6 0.580 0.851 1.4e-48
UNIPROTKB|Q5N9W0185 P0406G08.35 "Peptidyl-prolyl c 0.6 0.583 0.814 8.8e-47
TAIR|locus:2100016190 AT3G55520 "AT3G55520" [Arabido 0.6 0.568 0.842 4.8e-46
ZFIN|ZDB-GENE-030131-514 450 fkbp4 "FK506 binding protein 4 0.444 0.177 0.617 1.5e-24
UNIPROTKB|F1SK86 456 FKBP4 "Uncharacterized protein 0.45 0.177 0.646 2.1e-24
UNIPROTKB|Q02790 459 FKBP4 "Peptidyl-prolyl cis-tra 0.444 0.174 0.654 2.2e-24
UNIPROTKB|F1NIM4 442 FKBP4 "Uncharacterized protein 0.45 0.183 0.634 2.3e-24
UNIPROTKB|P27124 458 FKBP4 "Peptidyl-prolyl cis-tra 0.444 0.174 0.641 2.8e-24
RGD|628729 458 Fkbp4 "FK506 binding protein 4 0.444 0.174 0.654 2.8e-24
UNIPROTKB|E2QWF5 459 FKBP4 "Uncharacterized protein 0.466 0.183 0.635 2.9e-24
UNIPROTKB|Q65XG1 OJ1362_D02.6 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 507 (183.5 bits), Expect = 1.4e-48, P = 1.4e-48
 Identities = 92/108 (85%), Positives = 107/108 (99%)

Query:    29 VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAY 88
             VHYEG+LAE GEVFDTTHEDN++FSFE+G+G+VI+AWDIALR+MKVGEVAK+TCKPEYAY
Sbjct:    37 VHYEGTLAENGEVFDTTHEDNSIFSFEIGQGAVIKAWDIALRTMKVGEVAKITCKPEYAY 96

Query:    89 GSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQ 136
             GSAGSPP++PP+ATLIFEVELVACRPRKGSSLGSVS+E+ARLEELK+Q
Sbjct:    97 GSAGSPPEIPPNATLIFEVELVACRPRKGSSLGSVSDEKARLEELKKQ 144
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=ISS
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS
GO:0005528 "FK506 binding" evidence=ISS
GO:0016020 "membrane" evidence=ISS
GO:0018208 "peptidyl-proline modification" evidence=ISS
UNIPROTKB|Q5N9W0 P0406G08.35 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2100016 AT3G55520 "AT3G55520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-514 fkbp4 "FK506 binding protein 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SK86 FKBP4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q02790 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIM4 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P27124 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
RGD|628729 Fkbp4 "FK506 binding protein 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWF5 FKBP4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2S7FK201_ARATH5, ., 2, ., 1, ., 80.83450.77220.7315yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.691
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
BRADI2G54760.1
annotation not avaliable (240 aa)
(Brachypodium distachyon)
Predicted Functional Partners:
BRADI3G59060.1
annotation not avaliable (228 aa)
  •     0.504

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 3e-33
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 4e-26
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 2e-09
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 2e-09
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 5e-09
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score =  113 bits (285), Expect = 3e-33
 Identities = 45/84 (53%), Positives = 52/84 (61%), Gaps = 2/84 (2%)

Query: 28  TVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYA 87
           TVHY G L E G VFD++ +    F F LG G VI  WD  L  MKVGE  KLT  PE A
Sbjct: 12  TVHYTGKL-EDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGEKRKLTIPPELA 70

Query: 88  YGSAGS-PPDVPPDATLIFEVELV 110
           YG  G     +PP+ATL+FEVEL+
Sbjct: 71  YGEEGLAGGVIPPNATLVFEVELL 94

Length = 94
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.92
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.91
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.9
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.84
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.83
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.83
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.83
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.77
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 99.71
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.67
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 99.62
PRK01490 435 tig trigger factor; Provisional 99.61
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.56
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.55
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.54
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.78
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 97.84
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.33
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.92  E-value=8.6e-25  Score=168.01  Aligned_cols=95  Identities=44%  Similarity=0.789  Sum_probs=89.1

Q ss_pred             Ccceee---EEEEEEEcCCCcEEecccCCCeeEEEEeCCCCchHHHHHHHccCCCCcEEEEEeCCCCCcCCCCCCCCCCC
Q 030262           23 TCLSGT---VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPP   99 (180)
Q Consensus        23 ~~~~Gd---i~y~~~~~~dG~~~dst~~~~~~~~~~lG~~~~i~g~e~~L~gmk~Ge~~~v~vp~~~ayG~~g~~~~Ip~   99 (180)
                      .++.||   +||++.+ .||+.|||||..+.|++|.||.+++|+||+.+|.+||+||++.+.|||+++||+.|.++.||+
T Consensus        84 kak~GD~l~~HY~g~l-eDGt~fdSS~~rg~P~~f~LG~gqVIkG~Dqgl~gMCvGEkRkl~IPp~LgYG~~G~~~~IP~  162 (188)
T KOG0549|consen   84 KAKKGDTLHVHYTGSL-EDGTKFDSSYSRGAPFTFTLGTGQVIKGWDQGLLGMCVGEKRKLIIPPHLGYGERGAPPKIPG  162 (188)
T ss_pred             cccCCCEEEEEEEEEe-cCCCEEeeeccCCCCEEEEeCCCceeccHhHHhhhhCcccceEEecCccccCccCCCCCCCCC
Confidence            456899   9999988 599999999999999999999999999999999999999999999999999999999888999


Q ss_pred             CCcEEEEEEEeeecCCCCC
Q 030262          100 DATLIFEVELVACRPRKGS  118 (180)
Q Consensus       100 ~~~lvf~Vel~~i~~~~~~  118 (180)
                      +++|+|+|+|+++.+.+..
T Consensus       163 ~A~LiFdiELv~i~~~~~~  181 (188)
T KOG0549|consen  163 DAVLIFDIELVKIERGPPE  181 (188)
T ss_pred             CeeEEEEEEEEEeecCCCc
Confidence            9999999999999976543

>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
1q1c_A280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 6e-26
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 7e-26
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 7e-26
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 1e-25
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 2e-24
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 5e-24
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 5e-24
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 7e-24
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 7e-24
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 8e-24
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 1e-23
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 4e-20
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 6e-20
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 7e-19
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 1e-18
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 1e-18
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-18
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 2e-18
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 2e-18
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-18
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 2e-18
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 2e-18
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 4e-18
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 9e-18
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 1e-17
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 2e-17
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 3e-17
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 3e-17
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 4e-17
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-17
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 4e-17
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 5e-17
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 5e-17
2ki3_A126 Structural And Biochemical Characterization Of Fk50 7e-17
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 8e-17
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 9e-17
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 1e-16
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-16
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 1e-15
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 3e-15
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 3e-15
2pbc_A102 Fk506-Binding Protein 2 Length = 102 7e-15
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 5e-14
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 7e-14
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 8e-14
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 2e-12
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 4e-12
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 1e-08
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 1e-07
2f2d_A121 Solution Structure Of The Fk506-Binding Domain Of H 1e-07
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 1e-07
2awg_A118 Structure Of The Ppiase Domain Of The Human Fk506-B 1e-07
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 5e-07
2jwx_A157 Solution Structure Of The N-Terminal Domain Of Huma 9e-07
2d9f_A135 Solution Structure Of Ruh-047, An Fkbp Domain From 1e-06
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 1e-05
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 1e-05
3oe2_A219 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Tran 3e-05
2if4_A 338 Crystal Structure Of A Multi-Domain Immunophilin Fr 9e-05
2f4e_A180 N-Terminal Domain Of Fkbp42 From Arabidopsis Thalia 1e-04
1qz2_A 336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 3e-04
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure 
Iteration: 1

 Score =  113 bits (282), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (77%), Gaps = 1/85 (1%)
Query: 29  VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAY 88
           VHY G L + G  FD++ +    FSF+LGKG VI+AWDIA+ +MKVGEV  +TCKPEYAY
Sbjct: 75  VHYTGWLLD-GTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAY 133
Query: 89  GSAGSPPDVPPDATLIFEVELVACR 113
           GSAGSPP +PP+ATL+FEVEL   +
Sbjct: 134 GSAGSPPKIPPNATLVFEVELFEFK 158
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|2F2D|A Chain A, Solution Structure Of The Fk506-Binding Domain Of Human Fkbp38 Length = 121 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|2AWG|A Chain A, Structure Of The Ppiase Domain Of The Human Fk506-Binding Protein 8 Length = 118 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|2JWX|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Fkbp38 (Fkbp38ntd) Length = 157 Back     alignment and structure
>pdb|2D9F|A Chain A, Solution Structure Of Ruh-047, An Fkbp Domain From Human Cdna Length = 135 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|3OE2|A Chain A, 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Ppiase From Pseudomonas Syringae Pv. Tomato Str. Dc3000 (Pspto Dc3000) Length = 219 Back     alignment and structure
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure
>pdb|2F4E|A Chain A, N-Terminal Domain Of Fkbp42 From Arabidopsis Thaliana Length = 180 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 2e-45
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 3e-42
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 2e-41
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 8e-41
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 2e-40
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 2e-40
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-40
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 5e-40
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 2e-39
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 2e-38
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 3e-38
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 1e-29
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 6e-38
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-37
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-32
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-28
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 2e-36
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 5e-36
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 1e-35
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 4e-35
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 5e-34
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 2e-33
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 6e-30
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 6e-28
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-20
1jvw_A167 Macrophage infectivity potentiator; chagas disease 2e-25
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-23
1fd9_A213 Protein (macrophage infectivity potentiator prote; 2e-23
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 3e-23
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 2e-22
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-18
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 6e-13
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 2e-11
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 2e-11
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 5e-11
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 4e-10
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 1e-09
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 1e-08
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 2e-08
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
 Score =  144 bits (366), Expect = 2e-45
 Identities = 35/89 (39%), Positives = 53/89 (59%)

Query: 28  TVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYA 87
           TVHY G L  TG+VFD++ + N  F F L +G VI+ WDI + SM+  E   +  +  Y 
Sbjct: 41  TVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYG 100

Query: 88  YGSAGSPPDVPPDATLIFEVELVACRPRK 116
           YG  G    +P ++ L+FE+EL++ R  +
Sbjct: 101 YGDEGCGESIPGNSVLLFEIELLSFRELE 129
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.88
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.88
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.88
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.88
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.88
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.87
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.87
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.87
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.87
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.87
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.87
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.86
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.86
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.86
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.84
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.84
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.83
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.83
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.83
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.83
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.83
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.82
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.82
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.77
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.77
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.76
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.76
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.76
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.76
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.74
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.71
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.71
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.71
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.71
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.69
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.67
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.65
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.63
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.62
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.56
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.35
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 99.23
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.0
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=6.3e-23  Score=144.94  Aligned_cols=92  Identities=43%  Similarity=0.774  Sum_probs=85.7

Q ss_pred             Ccceee---EEEEEEEcCCCcEEecccCCCeeEEEEeCCCCchHHHHHHHccCCCCcEEEEEeCCCCCcCCCCCCCCCCC
Q 030262           23 TCLSGT---VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPP   99 (180)
Q Consensus        23 ~~~~Gd---i~y~~~~~~dG~~~dst~~~~~~~~~~lG~~~~i~g~e~~L~gmk~Ge~~~v~vp~~~ayG~~g~~~~Ip~   99 (180)
                      +++.||   +||++++. ||++|++|+..+.|+.|.+|.+.++|||+++|.+|++|++++|.+||+++||..+.++.|||
T Consensus         5 ~~~~gd~V~v~y~~~~~-dG~~~d~s~~~~~p~~f~lG~~~~i~g~~~~l~gm~~Ge~~~v~ip~~~ayG~~~~~~~Ip~   83 (102)
T 2pbc_A            5 KSRKGDVLHMHYTGKLE-DGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPG   83 (102)
T ss_dssp             CCCTTCEEEEEEEEECT-TSCEEEESTTTTCCEEEETTSSSSCHHHHTTSTTCCTTCEEEEEECGGGTTTTTCBTTTBCT
T ss_pred             cCCCCCEEEEEEEEEEC-CCCEEEeCCCCCCCEEEEeCCCCccHHHHHHHhCCCCCCEEEEEECHHHCcCCCCCCCCcCc
Confidence            566788   99999984 99999999876789999999999999999999999999999999999999999998788999


Q ss_pred             CCcEEEEEEEeeecCC
Q 030262          100 DATLIFEVELVACRPR  115 (180)
Q Consensus       100 ~~~lvf~Vel~~i~~~  115 (180)
                      |++++|+|+|++|.++
T Consensus        84 ~~~l~f~v~l~~v~~~   99 (102)
T 2pbc_A           84 GATLVFEVELLKIERR   99 (102)
T ss_dssp             TCCEEEEEEEEEEGGG
T ss_pred             CCeEEEEEEEEEeccc
Confidence            9999999999999864
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 1e-23
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 2e-21
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 4e-21
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 3e-19
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 3e-19
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 4e-19
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 9e-19
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 3e-17
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 6e-17
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-15
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 3e-15
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 1e-14
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 2e-14
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 3e-11
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKB-6, N-terminal domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 87.8 bits (217), Expect = 1e-23
 Identities = 43/83 (51%), Positives = 57/83 (68%), Gaps = 1/83 (1%)

Query: 28  TVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYA 87
            VHY G+L E G  FD++ +    FSF LG+G+VI+ WD+ + +M  GEVA+ T + +Y 
Sbjct: 33  KVHYVGTL-ENGTKFDSSRDRGDQFSFNLGRGNVIKGWDLGVATMTKGEVAEFTIRSDYG 91

Query: 88  YGSAGSPPDVPPDATLIFEVELV 110
           YG AGSPP +P  ATLIFEVEL 
Sbjct: 92  YGDAGSPPKIPGGATLIFEVELF 114
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.89
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.88
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.88
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.88
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.88
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.87
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.86
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.83
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.81
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.78
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.72
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.72
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.62
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.57
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 99.49
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FK-506 binding protein (FKBP12), an immunophilin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.89  E-value=7.1e-24  Score=149.88  Aligned_cols=96  Identities=45%  Similarity=0.775  Sum_probs=87.7

Q ss_pred             hhccccC-cceee---EEEEEEEcCCCcEEecccCCCeeEEEEeCCCCchHHHHHHHccCCCCcEEEEEeCCCCCcCCCC
Q 030262           17 ASALICT-CLSGT---VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAG   92 (180)
Q Consensus        17 ~~~~~~~-~~~Gd---i~y~~~~~~dG~~~dst~~~~~~~~~~lG~~~~i~g~e~~L~gmk~Ge~~~v~vp~~~ayG~~g   92 (180)
                      ..+.+.. +..||   +||++++. ||++|++|+..+.|+.|.+|.+.+++||+++|.+|++|++++|.|||+++||..+
T Consensus         8 ~~G~G~~~p~~gd~V~v~y~g~l~-dG~~~d~s~~~~~p~~~~~g~~~~i~G~~~~l~~M~~Ge~~~~~ip~~laYG~~g   86 (107)
T d2ppna1           8 SPGDGRTFPKRGQTCVVHYTGMLE-DGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATG   86 (107)
T ss_dssp             ECCCSSCCCCTTCEEEEEEEEEET-TSCEEEEHHHHTSCEEEETTSCCSCHHHHHHHTTCCTTCEEEEEECGGGTTTTTC
T ss_pred             ECcCCccCCCCCCEEEEEEEEEec-CCeEEEeeeccceeeeEeeCcchhheeehhhhcCccCCCEEEEEECHHHhCCCCC
Confidence            3455543 67788   99999996 9999999988788999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCcEEEEEEEeeec
Q 030262           93 SPPDVPPDATLIFEVELVACR  113 (180)
Q Consensus        93 ~~~~Ip~~~~lvf~Vel~~i~  113 (180)
                      .++.||||++|+|+|+|++|+
T Consensus        87 ~~~~IPp~s~lif~ieL~~vk  107 (107)
T d2ppna1          87 HPGIIPPHATLVFDVELLKLE  107 (107)
T ss_dssp             BTTTBCTTCCEEEEEEEEEEC
T ss_pred             CCCCCCcCCeEEEEEEEEEEC
Confidence            888899999999999999985
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure