Citrus Sinensis ID: 030404


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MAQKTEKEETEFKVPETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTGGGGGGGSGVAIIKFSSEKSLRSRPIIRSGSSDAAGTTGQNQELTDRREKEANVEKRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccEEEEccccccccccccccccccccHHHHHHHHHHHHcccccccccccc
cccccccccccccccccccEEcccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHEcccccEEEccccEEEccEcccccccccccHHHHHHHHHHHHccEEEccHcccc
maqktekeetefkvpetltlcvnncgftgnpatnnmcqkcfnatatttasavagsstgggggggSGVAIIKFSsekslrsrpiirsgssdaagttgqnqeltDRREKEANVEKRVVNrcsgcrrkvgltgfrcrcgelfcgehrysdrhdcsydyksagrdaiarenpVIKAAKIVRV
maqktekeetefkvpetLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGsstggggggGSGVAIIKFSsekslrsrpiirsgssdaagttgqnqeltdrrekeanvekrvvnrcsgcrrkvgltgfrcRCGElfcgehrysdrhDCSYDYKSAgrdaiarenpvikaakivrv
MAQKTEKEETEFKVPETLTLCVNNCGFTGNPATNNMCQKCFNatatttasavagsstgggggggsgvaIIKFSSEKSLRSRPIIRSGSSDAAGTTGQNQELTDRREKEANVEKRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV
*************VPETLTLCVNNCGFTGNPATNNMCQKCFNATAT*******************************************************************RVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIA**************
********************CVNNCGFTGNPATNNMCQKCF******************************FSSEKSLRSRPIIR****************************RVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV
*************VPETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTGGGGGGGSGVAIIKFSSEKSLRSRPIIRSG*************************KRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV
****************TLTLCVNNCGFTGNPATNNMCQKCFNATATTT*******************************************************************VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKI*R*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQKTEKEETEFKVPETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTGGGGGGGSGVAIIKFSSEKSLRSRPIIRSGSSDAAGTTGQNQELTDRREKEANVEKRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
Q9LHJ8160 Zinc finger A20 and AN1 d yes no 0.848 0.943 0.556 3e-45
Q84PD8170 Zinc finger A20 and AN1 d yes no 0.898 0.941 0.494 2e-38
A3C039164 Zinc finger A20 and AN1 d no no 0.904 0.981 0.497 6e-38
A2Z2J6164 Zinc finger A20 and AN1 d N/A no 0.904 0.981 0.497 6e-38
Q852K5160 Zinc finger A20 and AN1 d no no 0.882 0.981 0.403 5e-32
A3BDI8171 Zinc finger A20 and AN1 d no no 0.893 0.929 0.403 2e-31
A2YEZ6171 Zinc finger A20 and AN1 d N/A no 0.893 0.929 0.403 2e-31
Q7Y1W9161 Zinc finger A20 and AN1 d no no 0.882 0.975 0.406 9e-31
Q6H7P8173 Zinc finger A20 and AN1 d no no 0.887 0.913 0.390 2e-30
Q94B40170 Zinc finger A20 and AN1 d no no 0.943 0.988 0.374 2e-26
>sp|Q9LHJ8|SAP5_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 5 OS=Arabidopsis thaliana GN=SAP5 PE=2 SV=1 Back     alignment and function desciption
 Score =  181 bits (458), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/187 (55%), Positives = 121/187 (64%), Gaps = 36/187 (19%)

Query: 1   MAQKTEKEETEFKVPETLTLCVNNC-----GFTGNPATNNMCQKCFNATATTTASAVAGS 55
           MAQ+TEKEETEFKV ETLT           G T NPATNNMCQKCFNA+  + A+ V  S
Sbjct: 1   MAQRTEKEETEFKVLETLTTTTTTLCTNNCGVTANPATNNMCQKCFNASLVSAAAGVVES 60

Query: 56  STGGGGGGGSGVAIIKFSSEK-SLRSRP---IIRSGSSDAAGTTGQNQELTDRREKEANV 111
            +           I+K S+   +LRS P   +IR    DA     Q              
Sbjct: 61  GS-----------ILKRSARSVNLRSSPAKVVIRPREIDAVKKRDQ-------------- 95

Query: 112 EKRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIK 171
             ++VNRCSGCR+KVGLTGFRCRCGELFC EHRYSDRHDCSYDYK+AGR+AIARENPV+K
Sbjct: 96  --QIVNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENPVVK 153

Query: 172 AAKIVRV 178
           AAK+V+V
Sbjct: 154 AAKMVKV 160




May be involved in environmental stress response.
Arabidopsis thaliana (taxid: 3702)
>sp|Q84PD8|SAP11_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 11 OS=Oryza sativa subsp. japonica GN=SAP11 PE=2 SV=1 Back     alignment and function description
>sp|A3C039|SAP1_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Oryza sativa subsp. japonica GN=SAP1 PE=2 SV=2 Back     alignment and function description
>sp|A2Z2J6|SAP1_ORYSI Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Oryza sativa subsp. indica GN=SAP1 PE=2 SV=1 Back     alignment and function description
>sp|Q852K5|SAP6_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Oryza sativa subsp. japonica GN=SAP6 PE=2 SV=1 Back     alignment and function description
>sp|A3BDI8|SAP8_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. japonica GN=SAP8 PE=2 SV=1 Back     alignment and function description
>sp|A2YEZ6|SAP8_ORYSI Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. indica GN=SAP8 PE=2 SV=2 Back     alignment and function description
>sp|Q7Y1W9|SAP9_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Oryza sativa subsp. japonica GN=SAP9 PE=2 SV=1 Back     alignment and function description
>sp|Q6H7P8|SAP4_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Oryza sativa subsp. japonica GN=SAP4 PE=2 SV=1 Back     alignment and function description
>sp|Q94B40|SAP6_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Arabidopsis thaliana GN=SAP6 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
356557142161 PREDICTED: zinc finger A20 and AN1 domai 0.904 1.0 0.623 4e-55
224055247181 predicted protein [Populus trichocarpa] 0.971 0.955 0.634 5e-55
449436277159 PREDICTED: zinc finger A20 and AN1 domai 0.882 0.987 0.622 1e-53
224106053179 predicted protein [Populus trichocarpa] 0.971 0.966 0.630 9e-53
359487271172 PREDICTED: zinc finger A20 and AN1 domai 0.966 1.0 0.634 8e-51
88866527188 stress-associated protein 1 [Solanum lyc 1.0 0.946 0.601 1e-50
358249158164 zinc finger A20 and AN1 domain-containin 0.921 1.0 0.606 2e-49
449463761169 PREDICTED: zinc finger A20 and AN1 domai 0.932 0.982 0.629 2e-49
18399690160 zinc finger A20 and AN1 domain-containin 0.848 0.943 0.556 1e-43
297829802160 hypothetical protein ARALYDRAFT_478622 [ 0.842 0.937 0.547 5e-43
>gi|356557142|ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] Back     alignment and taxonomy information
 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 130/178 (73%), Gaps = 17/178 (9%)

Query: 1   MAQKTEKEETEFKVPETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTGGG 60
           MAQKTEKEET+FKVPET+TLCVNNCG TGNPATNNMCQKCF A+  TT+           
Sbjct: 1   MAQKTEKEETDFKVPETITLCVNNCGVTGNPATNNMCQKCFTASTATTS----------- 49

Query: 61  GGGGSGVAIIKFSSEKSLRSRPIIRSGSSDAAGTTGQNQELTDRREKEANVEKRVVNRCS 120
           G GG+G+A    ++   + +RP  RS   + +       +     +   +  KRVVNRCS
Sbjct: 50  GAGGAGIA--SPATRSGVSARPQKRSFPEEPSPVA----DPPSSDQTTPSEAKRVVNRCS 103

Query: 121 GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV 178
           GCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYK+AGR+AIARENPVI+AAKIV+V
Sbjct: 104 GCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENPVIRAAKIVKV 161




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224055247|ref|XP_002298442.1| predicted protein [Populus trichocarpa] gi|118486081|gb|ABK94884.1| unknown [Populus trichocarpa] gi|222845700|gb|EEE83247.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449436277|ref|XP_004135919.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucumis sativus] gi|449489065|ref|XP_004158204.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224106053|ref|XP_002314027.1| predicted protein [Populus trichocarpa] gi|222850435|gb|EEE87982.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359487271|ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|88866527|gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|358249158|ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] gi|300510880|gb|ADK25058.1| AN1-like transcription factor [Glycine max] Back     alignment and taxonomy information
>gi|449463761|ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucumis sativus] gi|449532105|ref|XP_004173024.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18399690|ref|NP_566429.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Arabidopsis thaliana] gi|75335009|sp|Q9LHJ8.1|SAP5_ARATH RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated protein 5; Short=AtSAP5 gi|12321951|gb|AAG51008.1|AC069474_7 unknown protein; 15087-14605 [Arabidopsis thaliana] gi|9294357|dbj|BAB02254.1| unnamed protein product [Arabidopsis thaliana] gi|21536983|gb|AAM61324.1| unknown [Arabidopsis thaliana] gi|32815927|gb|AAP88348.1| At3g12630 [Arabidopsis thaliana] gi|110736612|dbj|BAF00270.1| hypothetical protein [Arabidopsis thaliana] gi|332641705|gb|AEE75226.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297829802|ref|XP_002882783.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. lyrata] gi|297328623|gb|EFH59042.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
TAIR|locus:2101217160 SAP5 "stress associated protei 0.410 0.456 0.805 2.3e-48
TAIR|locus:2083208170 AT3G52800 [Arabidopsis thalian 0.943 0.988 0.374 5.6e-29
RGD|1310776213 Zfand5 "zinc finger, AN1-type 0.578 0.483 0.462 7.6e-29
MGI|MGI:1278334213 Zfand5 "zinc finger, AN1-type 0.578 0.483 0.453 1.6e-28
UNIPROTKB|E2RMV3213 ZFAND5 "Uncharacterized protei 0.573 0.478 0.467 2e-28
UNIPROTKB|O76080213 ZFAND5 "AN1-type zinc finger p 0.573 0.478 0.467 2e-28
UNIPROTKB|A4U9C9213 LOC100737314 "Zinc finger prot 0.573 0.478 0.467 2e-28
UNIPROTKB|I3LS37206 ZFAND5 "Uncharacterized protei 0.573 0.495 0.467 2e-28
UNIPROTKB|A7MBA8213 ZFAND5 "ZFAND5 protein" [Bos t 0.573 0.478 0.467 2.5e-28
TAIR|locus:2049505161 AT2G36320 [Arabidopsis thalian 0.348 0.385 0.580 3.2e-28
TAIR|locus:2101217 SAP5 "stress associated protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 334 (122.6 bits), Expect = 2.3e-48, Sum P(2) = 2.3e-48
 Identities = 62/77 (80%), Positives = 71/77 (92%)

Query:   105 REKEANVEKR---VVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRD 161
             RE +A V+KR   +VNRCSGCR+KVGLTGFRCRCGELFC EHRYSDRHDCSYDYK+AGR+
Sbjct:    85 REIDA-VKKRDQQIVNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGRE 143

Query:   162 AIARENPVIKAAKIVRV 178
             AIARENPV+KAAK+V+V
Sbjct:   144 AIARENPVVKAAKMVKV 160


GO:0003677 "DNA binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0009414 "response to water deprivation" evidence=IMP
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0051865 "protein autoubiquitination" evidence=IDA
GO:0006007 "glucose catabolic process" evidence=RCA
TAIR|locus:2083208 AT3G52800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1310776 Zfand5 "zinc finger, AN1-type domain 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1278334 Zfand5 "zinc finger, AN1-type domain 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMV3 ZFAND5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O76080 ZFAND5 "AN1-type zinc finger protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A4U9C9 LOC100737314 "Zinc finger protein 216" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LS37 ZFAND5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBA8 ZFAND5 "ZFAND5 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2049505 AT2G36320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LHJ8SAP5_ARATHNo assigned EC number0.55610.84830.9437yesno
Q84PD8SAP11_ORYSJNo assigned EC number0.49460.89880.9411yesno
Q5R7S6ZFAN6_PONABNo assigned EC number0.32090.96060.8221yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
smart0015439 smart00154, ZnF_AN1, AN1-like Zinc finger 4e-13
pfam0142843 pfam01428, zf-AN1, AN1-like Zinc finger 5e-10
pfam0175425 pfam01754, zf-A20, A20-like zinc finger 1e-06
smart0025926 smart00259, ZnF_A20, A20-like zinc fingers 0.001
>gnl|CDD|197545 smart00154, ZnF_AN1, AN1-like Zinc finger Back     alignment and domain information
 Score = 60.1 bits (146), Expect = 4e-13
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 1/39 (2%)

Query: 119 CSGCRRKVGLTGFRCR-CGELFCGEHRYSDRHDCSYDYK 156
           C  CR+KVGLTGF+CR CG LFCGEHR  + HDC  DYK
Sbjct: 1   CHFCRKKVGLTGFKCRHCGNLFCGEHRLPEDHDCPGDYK 39


Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis. Length = 39

>gnl|CDD|201791 pfam01428, zf-AN1, AN1-like Zinc finger Back     alignment and domain information
>gnl|CDD|201955 pfam01754, zf-A20, A20-like zinc finger Back     alignment and domain information
>gnl|CDD|128555 smart00259, ZnF_A20, A20-like zinc fingers Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
KOG3173167 consensus Predicted Zn-finger protein [General fun 100.0
smart0015439 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C 99.54
PF0175425 zf-A20: A20-like zinc finger; InterPro: IPR002653 99.49
smart0025926 ZnF_A20 A20-like zinc fingers. A20- (an inhibitor 99.43
PF0142843 zf-AN1: AN1-like Zinc finger; InterPro: IPR000058 99.08
COG3582162 Predicted nucleic acid binding protein containing 96.82
KOG3183 250 consensus Predicted Zn-finger protein [General fun 96.47
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 94.66
KOG3183250 consensus Predicted Zn-finger protein [General fun 93.39
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 92.65
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 91.99
KOG1818 634 consensus Membrane trafficking and cell signaling 89.75
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 85.71
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 83.94
>KOG3173 consensus Predicted Zn-finger protein [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=1.2e-45  Score=300.68  Aligned_cols=164  Identities=39%  Similarity=0.757  Sum_probs=107.6

Q ss_pred             CCccccccccccCCCcccccccccCCCcCCccCCCchhhhhhhhhhhhccc-ccCC-CCCCCCCCCCCcccccccccccc
Q 030404            1 MAQKTEKEETEFKVPETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASA-VAGS-STGGGGGGGSGVAIIKFSSEKSL   78 (178)
Q Consensus         1 Ma~~~~~~~pe~~~p~~~~lC~ngCGFfGs~at~n~CSkCyr~~~~~~~~~-~~~~-~~~~~~~~~~~~~~~~~~~~~~~   78 (178)
                      |+++.....+.   ++.+.||.|||||||+|+|+||||+||++++.++++. ...+ .+...+. ++   ...+..+...
T Consensus         1 M~~e~~~~~~~---~~~~~lc~~gCGf~G~p~~~n~CSkC~~e~~~~~~~~~~~~~~~~~~~~~-~~---~s~~~~~~~~   73 (167)
T KOG3173|consen    1 MASETNGSQTP---PSQDLLCVNGCGFYGSPATENLCSKCYRDHLLRQQQKQARASPPVESSLS-SP---RSVPSRDPPA   73 (167)
T ss_pred             CcccccCCCCC---CccccccccCccccCChhhccHHHHHHHHHHHHhhhccccccCccccccc-Cc---cccCcccccc
Confidence            77765553322   2245899999999999999999999999999877665 2211 1111100 00   0001000000


Q ss_pred             ccccccccCCCC-CCCCCCcccchhhhhhhhhhhccccCCccccccccccccceeeecCccccccCCCCCCCCCCccchH
Q 030404           79 RSRPIIRSGSSD-AAGTTGQNQELTDRREKEANVEKRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKS  157 (178)
Q Consensus        79 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~rC~~C~kkvgl~gf~CrCg~~FC~~HRy~e~H~C~fDyk~  157 (178)
                        .........+ ......   +..  ...........++||+.|+|||||+||.||||++||+.|||||.|+|+||||.
T Consensus        74 --~~~~~~~~~~~~~~~~~---~s~--~~~~~~~~~~~~~rC~~C~kk~gltgf~CrCG~~fC~~HRy~e~H~C~fDyK~  146 (167)
T KOG3173|consen   74 --VSLESTTESELKLVSDT---PST--EEEDEESKPKKKKRCFKCRKKVGLTGFKCRCGNTFCGTHRYPEQHDCSFDYKQ  146 (167)
T ss_pred             --ccccccccccccccccC---Ccc--cccccccccccchhhhhhhhhhcccccccccCCcccccccCCccccccccHHH
Confidence              0000000000 000000   000  01112233456789999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHhCCcccccccccC
Q 030404          158 AGRDAIARENPVIKAAKIVRV  178 (178)
Q Consensus       158 ~~r~~l~k~NP~v~~~Kl~ki  178 (178)
                      +||+.|+++||+|+++||.||
T Consensus       147 ~gr~~i~k~nP~v~a~k~~ki  167 (167)
T KOG3173|consen  147 AGREKIAKANPVVKADKLQKI  167 (167)
T ss_pred             HHHHHHHHhCCeeeccccccC
Confidence            999999999999999999998



>smart00154 ZnF_AN1 AN1-like Zinc finger Back     alignment and domain information
>PF01754 zf-A20: A20-like zinc finger; InterPro: IPR002653 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00259 ZnF_A20 A20-like zinc fingers Back     alignment and domain information
>PF01428 zf-AN1: AN1-like Zinc finger; InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3183 consensus Predicted Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3183 consensus Predicted Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>KOG1818 consensus Membrane trafficking and cell signaling protein HRS, contains VHS and FYVE domains [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
1wfl_A74 Solution Structure Of The Zf-An1 Domain From Mouse 5e-15
1wfh_A64 Solution Structrue Of The Zf-An1 Domain From Arabid 3e-12
1wff_A85 Solution Structure Of The Zf-An1 Domain From Mouse 5e-12
1wg2_A64 Solution Structure Of Zf-An1 Domain From Arabidopsi 3e-11
1wfp_A74 Solution Structure Of The Zf-an1 Domain From Arabio 4e-11
>pdb|1WFL|A Chain A, Solution Structure Of The Zf-An1 Domain From Mouse Zinc Finger Protein 216 Length = 74 Back     alignment and structure

Iteration: 1

Score = 77.0 bits (188), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 34/52 (65%), Positives = 39/52 (75%) Query: 106 EKEANVEKRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKS 157 EK + K NRC CR+KVGLTGF CRCG LFCG HRYSD+H+C YDYK+ Sbjct: 15 EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKA 66
>pdb|1WFH|A Chain A, Solution Structrue Of The Zf-An1 Domain From Arabidopsis Thaliana At2g36320 Protein Length = 64 Back     alignment and structure
>pdb|1WFF|A Chain A, Solution Structure Of The Zf-An1 Domain From Mouse Riken Cdna 2810002d23 Protein Length = 85 Back     alignment and structure
>pdb|1WG2|A Chain A, Solution Structure Of Zf-An1 Domain From Arabidopsis Thaliana Length = 64 Back     alignment and structure
>pdb|1WFP|A Chain A, Solution Structure Of The Zf-an1 Domain From Arabiopsis Thaliana F5o11.17 Protein Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 2e-29
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 1e-26
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 8e-26
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 2e-25
1wfl_A74 Zinc finger protein 216; ZF-AN1 domain, zinc bindi 2e-23
1x4w_A67 Hypothetical protein FLJ13222; ZF-AN1 domain, zinc 2e-21
2kzy_A62 ZNF216-A20, zfand5 protein (zinc finger protein 21 5e-08
2c7n_A74 Rabex-5, GEF 1, RAB guanine nucleotide exchange fa 5e-08
1x4v_A63 Hypothetical protein LOC130617; ZF-AN1 domain, zin 3e-04
1wfe_A86 Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc 4e-04
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Length = 85 Back     alignment and structure
 Score =  103 bits (257), Expect = 2e-29
 Identities = 30/64 (46%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 111 VEKRVVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPV 169
            +K+++  C  C +K GL T F CRCG  FC  HRY++ H C+YDYKSAGR  +   NPV
Sbjct: 20  TKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEANPV 79

Query: 170 IKAA 173
              +
Sbjct: 80  SGPS 83


>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Length = 74 Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Length = 64 Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Length = 64 Back     alignment and structure
>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Length = 74 Back     alignment and structure
>1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2kzy_A ZNF216-A20, zfand5 protein (zinc finger protein 216 (predicte isoform CRA_A); A20 domain, atrogene, metal binding Pro; NMR {Rattus norvegicus} PDB: 2l00_A Length = 62 Back     alignment and structure
>2c7n_A Rabex-5, GEF 1, RAB guanine nucleotide exchange factor 1; protein-binding, ubiquitin binding domain, endocytosis, NUCL protein, polyprotein; 2.1A {Homo sapiens} SCOP: g.39.1.15 PDB: 2c7m_A 2fif_B 2fid_B Length = 74 Back     alignment and structure
>1x4v_A Hypothetical protein LOC130617; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1wfe_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Length = 86 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 99.95
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 99.92
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 99.91
1wfl_A74 Zinc finger protein 216; ZF-AN1 domain, zinc bindi 99.9
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 99.9
1x4w_A67 Hypothetical protein FLJ13222; ZF-AN1 domain, zinc 99.9
2kzy_A62 ZNF216-A20, zfand5 protein (zinc finger protein 21 99.72
2c7n_A74 Rabex-5, GEF 1, RAB guanine nucleotide exchange fa 99.64
3oj3_I49 Tumor necrosis factor alpha-induced protein 3; ubi 99.53
1wfe_A86 Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc 99.32
1x4v_A63 Hypothetical protein LOC130617; ZF-AN1 domain, zin 99.28
1wys_A75 Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc 99.23
2eqe_A48 Tumor necrosis factor, alpha-induced protein 3; ZF 97.68
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 94.4
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 93.81
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 93.45
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 93.45
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 93.4
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 93.2
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 92.48
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 91.98
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 91.31
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 90.72
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 83.95
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 82.07
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 81.19
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
Probab=99.95  E-value=2e-30  Score=190.39  Aligned_cols=61  Identities=48%  Similarity=1.074  Sum_probs=58.4

Q ss_pred             cccCCcccccccccccc-ceeeecCccccccCCCCCCCCCCccchHhhHHHHHHhCCccccc
Q 030404          113 KRVVNRCSGCRRKVGLT-GFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAA  173 (178)
Q Consensus       113 ~~~~~rC~~C~kkvgl~-gf~CrCg~~FC~~HRy~e~H~C~fDyk~~~r~~l~k~NP~v~~~  173 (178)
                      +..++||+.|+|||||+ +|+||||++||+.|||||+|+|+||||++||++|+|+||+|+++
T Consensus        22 k~~~~rC~~C~kkvgl~~~f~CrCg~~FC~~HRy~e~H~C~fDyK~~gr~~iak~NPvV~a~   83 (85)
T 1wff_A           22 KKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEANPVSGPS   83 (85)
T ss_dssp             CCCCCBCSSSCCBCSSSSCEECTTCCEECTTTCSTGGGTCCSCCSSSCCCCCCCCCCCCCTT
T ss_pred             cccCccchhhCCeecccCCeEcCCCCEecccCCCccCCCCcchhhHHHHHHHHHHCCeecCC
Confidence            55689999999999995 99999999999999999999999999999999999999999986



>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kzy_A ZNF216-A20, zfand5 protein (zinc finger protein 216 (predicte isoform CRA_A); A20 domain, atrogene, metal binding Pro; NMR {Rattus norvegicus} PDB: 2l00_A Back     alignment and structure
>2c7n_A Rabex-5, GEF 1, RAB guanine nucleotide exchange factor 1; protein-binding, ubiquitin binding domain, endocytosis, NUCL protein, polyprotein; 2.1A {Homo sapiens} SCOP: g.39.1.15 PDB: 2c7m_A 2fif_B 2fid_B Back     alignment and structure
>3oj3_I Tumor necrosis factor alpha-induced protein 3; ubiquitin, zinc finger, zinc ION, protein binding-hydrolase; 2.50A {Homo sapiens} PDB: 3oj4_C Back     alignment and structure
>1wfe_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1x4v_A Hypothetical protein LOC130617; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wys_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2eqe_A Tumor necrosis factor, alpha-induced protein 3; ZF-A20 domain, putative DNA-binding protein A20, zinc finger protein A20, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1wffa_85 g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog 2e-29
d1wfha_64 g.80.1.1 (A:) Zinc finger A20 and AN1 domains cont 5e-23
d1wfla_74 g.80.1.1 (A:) Zinc finger A20 domain containing pr 2e-22
d1wfpa_74 g.80.1.1 (A:) Zinc finger A20 and AN1 domains cont 1e-21
d2c7na156 g.39.1.15 (A:18-73) RabGEF1 (Rabex-5), ubiquitin-b 3e-07
d1wfea_86 g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mous 6e-04
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure

class: Small proteins
fold: AN1-like Zinc finger
superfamily: AN1-like Zinc finger
family: AN1-like Zinc finger
domain: ANUBL1 (AN1, ubiquitin-like, homolog)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  101 bits (254), Expect = 2e-29
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 106 EKEANVEKRVVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIA 164
           +     +K+++  C  C +K GL T F CRCG  FC  HRY++ H C+YDYKSAGR  + 
Sbjct: 15  KAPLQTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLE 74

Query: 165 RENPVIKAA 173
             NPV   +
Sbjct: 75  EANPVSGPS 83


>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 74 Back     information, alignment and structure
>d2c7na1 g.39.1.15 (A:18-73) RabGEF1 (Rabex-5), ubiquitin-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1wfea_ g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 99.93
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 99.91
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 99.89
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 99.88
d2c7na156 RabGEF1 (Rabex-5), ubiquitin-binding domain {Human 99.63
d1wfea_86 AN1-type zinc finger protein 1 {Mouse (Mus musculu 98.13
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 95.23
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 94.13
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 93.69
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 93.44
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 91.56
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 90.87
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 82.03
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: AN1-like Zinc finger
superfamily: AN1-like Zinc finger
family: AN1-like Zinc finger
domain: ANUBL1 (AN1, ubiquitin-like, homolog)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93  E-value=1.1e-28  Score=179.43  Aligned_cols=61  Identities=49%  Similarity=1.084  Sum_probs=57.4

Q ss_pred             cccCCccccccccccc-cceeeecCccccccCCCCCCCCCCccchHhhHHHHHHhCCccccc
Q 030404          113 KRVVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAA  173 (178)
Q Consensus       113 ~~~~~rC~~C~kkvgl-~gf~CrCg~~FC~~HRy~e~H~C~fDyk~~~r~~l~k~NP~v~~~  173 (178)
                      +..++||+.|+|||+| ++|+||||++||+.|||||.|+|+||||+.||++|+++||+|.+.
T Consensus        22 k~~~~RC~~C~KKl~l~~~~~CrCg~~FC~~HR~pe~H~CtfDyK~~~k~~L~k~NP~i~p~   83 (85)
T d1wffa_          22 KKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEANPVSGPS   83 (85)
T ss_dssp             CCCCCBCSSSCCBCSSSSCEECTTCCEECTTTCSTGGGTCCSCCSSSCCCCCCCCCCCCCTT
T ss_pred             cccCCcChhcCCeecCCcCeecCCCCEehhhcCCCcCcCCCcchHHHHHHHHHHHCCccCCC
Confidence            4567899999999999 589999999999999999999999999999999999999999874



>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c7na1 g.39.1.15 (A:18-73) RabGEF1 (Rabex-5), ubiquitin-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfea_ g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure