Citrus Sinensis ID: 030411

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MAGIGASCSFLPSRSKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKPG

cccccccccccccccccccccEEcccccccccccHHHHHHHHHHcccccEEcHHHHHHHHHccccEEEEcccHHHHHHccccccccccccccccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccccccccHHcccccccc

ccccccccccccccccccEEEEEEEccccccccccHHHHHHHHHHccccEccHHHHHHHHHccccEEEEcccHHHHHHccccccEEcEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHcccccEEEHcccHHccccc

magigascsflpsrskLRTTWLqfethpgrkvsgksicrrnlkiradvnyvnAEEAKNLIAVERYAVLdvrdnsqynrahikssyhvplfienqdndlgTIIKRTVhnnfsglffglpftkqnpefvqsvksqfspesKLLVVCQEGLRSAAAANKLEEAGFQNIACITsglqtvkpg

magigascsflpsrSKLRTTWlqfethpgrkvsgksicrrnlkiradvnyvnaeeaknliavERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLeeagfqniacitsglqtvkpg

MAGIGASCSFLPSRSKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKPG

***************KLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSV*******SKLLVVCQEGLRSAAAANKLEEAGFQNIACITSG*******

******************************************KIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVK**

MAGIGASCSFLPSRSKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKPG

**************SKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQT****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAGIGASCSFLPSRSKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKPG

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		178	2.2.26 [Sep-21-2011]
O48529		234	Rhodanese-like domain-con	yes	no	1.0	0.760	0.648	3e-61
Q9SR92		214	Rhodanese-like domain-con	no	no	0.803	0.668	0.388	1e-22
Q0WWT7		292	Rhodanese-like domain-con	no	no	0.719	0.438	0.369	1e-16
Q94A65		224	Rhodanese-like domain-con	no	no	0.741	0.589	0.286	2e-08
Q39129		120	Thiosulfate sulfurtransfe	no	no	0.494	0.733	0.283	8e-05
Q8RUD6		169	Rhodanese-like domain-con	no	no	0.584	0.615	0.253	0.0002

>sp\|O48529\|STR9_ARATH Rhodanese-like domain-containing protein 9, chloroplastic OS=Arabidopsis thaliana GN=STR9 PE=2 SV=1	Back alignment and function desciption

 Score =  234 bits (596), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 116/179 (64%), Positives = 146/179 (81%), Gaps = 1/179 (0%)

Query: 1   MAGI-GASCSFLPSRSKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNL 59
           MAGI   S + L   S +    L+  +  G+ VSG  I RR+L+I A++ +VNAEEAK L
Sbjct: 1   MAGIISPSPTALYFTSNVGGRRLKAVSWAGKSVSGNVIRRRSLRIAAELKFVNAEEAKQL 60

Query: 60  IAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPF 119
           IA E Y+V+DVRD +Q+ RAHIKS  H+PLFI N+DND+GTIIKRTVHNNFSGLFFGLPF
Sbjct: 61  IAEEGYSVVDVRDKTQFERAHIKSCSHIPLFIYNEDNDIGTIIKRTVHNNFSGLFFGLPF 120

Query: 120 TKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKPG 178
           TK NPEF++SV+++FS +SKLL+VCQEGLRSAAAA++LEEAG++NIAC+TSGLQ+VKPG
Sbjct: 121 TKVNPEFLKSVRNEFSQDSKLLLVCQEGLRSAAAASRLEEAGYENIACVTSGLQSVKPG 179

Arabidopsis thaliana (taxid: 3702)

>sp\|Q9SR92\|STR10_ARATH Rhodanese-like domain-containing protein 10 OS=Arabidopsis thaliana GN=STR10 PE=2 SV=1	Back alignment and function description

>sp\|Q0WWT7\|STR11_ARATH Rhodanese-like domain-containing protein 11, chloroplastic OS=Arabidopsis thaliana GN=STR11 PE=2 SV=1	Back alignment and function description

>sp\|Q94A65\|STR14_ARATH Rhodanese-like domain-containing protein 14, chloroplastic OS=Arabidopsis thaliana GN=At4g27700 PE=2 SV=1	Back alignment and function description

>sp\|Q39129\|STR16_ARATH Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana GN=STR16 PE=1 SV=2	Back alignment and function description

>sp\|Q8RUD6\|STR19_ARATH Rhodanese-like domain-containing protein 19, mitochondrial OS=Arabidopsis thaliana GN=STR19 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		178
225441393		234	PREDICTED: uncharacterized protein LOC10	0.994	0.756	0.792	3e-76
449453846		246	PREDICTED: rhodanese-like domain-contain	1.0	0.723	0.737	3e-73
255583140		235	conserved hypothetical protein [Ricinus	1.0	0.757	0.724	2e-71
224120418		235	predicted protein [Populus trichocarpa]	1.0	0.757	0.696	1e-67
356572084		246	PREDICTED: uncharacterized protein LOC10	1.0	0.723	0.718	2e-64
255635860		238	unknown [Glycine max]	1.0	0.747	0.718	3e-64
388496664		237	unknown [Lotus japonicus]	0.898	0.675	0.712	2e-63
357509873		234	hypothetical protein MTR_7g092820 [Medic	0.971	0.739	0.631	1e-60
217075670		234	unknown [Medicago truncatula]	0.971	0.739	0.631	2e-60
226500806		239	LOC100280883 [Zea mays] gi\|195609398\|gb\|	0.977	0.728	0.627	3e-60

>gi\|225441393\|ref\|XP_002278312.1\| PREDICTED: uncharacterized protein LOC100241760 [Vitis vinifera] gi\|297739859\|emb\|CBI30041.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 155/178 (87%), Gaps = 1/178 (0%)

Query: 1   MAGIGASCSFLPSRSKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLI 60
           MAG+   C  L SRS  RT+ L  ET  GR + GKS+ RRNL+I+A+VN+VNAEE K LI
Sbjct: 1   MAGL-CCCMPLSSRSNFRTSRLMLETRHGRTMVGKSLGRRNLQIKAEVNFVNAEEGKKLI 59

Query: 61  AVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFT 120
           AVE YA+LDVRD SQY+RAHIKS YHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFT
Sbjct: 60  AVEGYAILDVRDKSQYDRAHIKSCYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFT 119

Query: 121 KQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKPG 178
           K NP+FVQSVKSQFSPESKLL+VCQEGLRSAAAA+KLE+AGF NIACITSGLQTVKPG
Sbjct: 120 KVNPDFVQSVKSQFSPESKLLLVCQEGLRSAAAASKLEQAGFANIACITSGLQTVKPG 177

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449453846\|ref\|XP_004144667.1\| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255583140\|ref\|XP_002532336.1\| conserved hypothetical protein [Ricinus communis] gi\|223527953\|gb\|EEF30038.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|224120418\|ref\|XP_002331043.1\| predicted protein [Populus trichocarpa] gi\|222872973\|gb\|EEF10104.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356572084\|ref\|XP_003554200.1\| PREDICTED: uncharacterized protein LOC100801860 [Glycine max]	Back alignment and taxonomy information

>gi\|255635860\|gb\|ACU18277.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|388496664\|gb\|AFK36398.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|357509873\|ref\|XP_003625225.1\| hypothetical protein MTR_7g092820 [Medicago truncatula] gi\|124360655\|gb\|ABN08644.1\| Rhodanese-like [Medicago truncatula] gi\|355500240\|gb\|AES81443.1\| hypothetical protein MTR_7g092820 [Medicago truncatula] gi\|388512749\|gb\|AFK44436.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|217075670\|gb\|ACJ86195.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|226500806\|ref\|NP_001147275.1\| LOC100280883 [Zea mays] gi\|195609398\|gb\|ACG26529.1\| rhodanese family protein [Zea mays] gi\|238013362\|gb\|ACR37716.1\| unknown [Zea mays] gi\|414884786\|tpg\|DAA60800.1\| TPA: putative Rhodanese family protein [Zea mays]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		178
TAIR\|locus:2059999		234	AT2G42220 "AT2G42220" [Arabido	1.0	0.760	0.648	2.5e-56
TAIR\|locus:2097628		214	AT3G08920 "AT3G08920" [Arabido	0.797	0.663	0.412	2.6e-22
TAIR\|locus:2121994		292	AT4G24750 "AT4G24750" [Arabido	0.719	0.438	0.369	3.2e-17
TAIR\|locus:2137792		224	AT4G27700 "AT4G27700" [Arabido	0.741	0.589	0.286	1.4e-09
UNIPROTKB\|Q81UT0		110	BAS0741 "Rhodanese-like domain	0.247	0.4	0.340	5.7e-09
TIGR_CMR\|BA_0779		110	BA_0779 "rhodanese-like domain	0.247	0.4	0.340	5.7e-09
TAIR\|locus:2156937		120	STR16 "AT5G66040" [Arabidopsis	0.280	0.416	0.38	3.3e-08
TIGR_CMR\|CBU_0587		107	CBU_0587 "glpE protein, putati	0.280	0.467	0.3	7.6e-05
UNIPROTKB\|Q604K3		145	MCA2536 "Rhodanese domain prot	0.191	0.234	0.382	0.00035
UNIPROTKB\|Q3AEL0		126	CHY_0566 "Rhodanese-like domai	0.202	0.285	0.361	0.00059

TAIR\|locus:2059999 AT2G42220 "AT2G42220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 580 (209.2 bits), Expect = 2.5e-56, P = 2.5e-56
 Identities = 116/179 (64%), Positives = 146/179 (81%)

Query:     1 MAGI-GASCSFLPSRSKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNL 59
             MAGI   S + L   S +    L+  +  G+ VSG  I RR+L+I A++ +VNAEEAK L
Sbjct:     1 MAGIISPSPTALYFTSNVGGRRLKAVSWAGKSVSGNVIRRRSLRIAAELKFVNAEEAKQL 60

Query:    60 IAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPF 119
             IA E Y+V+DVRD +Q+ RAHIKS  H+PLFI N+DND+GTIIKRTVHNNFSGLFFGLPF
Sbjct:    61 IAEEGYSVVDVRDKTQFERAHIKSCSHIPLFIYNEDNDIGTIIKRTVHNNFSGLFFGLPF 120

Query:   120 TKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKPG 178
             TK NPEF++SV+++FS +SKLL+VCQEGLRSAAAA++LEEAG++NIAC+TSGLQ+VKPG
Sbjct:   121 TKVNPEFLKSVRNEFSQDSKLLLVCQEGLRSAAAASRLEEAGYENIACVTSGLQSVKPG 179

GO:0003674 "molecular_function" evidence=ND

GO:0008150 "biological_process" evidence=ND

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0009535 "chloroplast thylakoid membrane" evidence=IDA

GO:0009534 "chloroplast thylakoid" evidence=IDA

GO:0010103 "stomatal complex morphogenesis" evidence=RCA

GO:0019344 "cysteine biosynthetic process" evidence=RCA

GO:0019684 "photosynthesis, light reaction" evidence=RCA

TAIR\|locus:2097628 AT3G08920 "AT3G08920" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2121994 AT4G24750 "AT4G24750" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2137792 AT4G27700 "AT4G27700" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q81UT0 BAS0741 "Rhodanese-like domain protein" [Bacillus anthracis (taxid:1392)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_0779 BA_0779 "rhodanese-like domain protein" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

TAIR\|locus:2156937 STR16 "AT5G66040" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_0587 CBU_0587 "glpE protein, putative" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

UNIPROTKB\|Q604K3 MCA2536 "Rhodanese domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3AEL0 CHY_0566 "Rhodanese-like domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O48529	STR9_ARATH	No assigned EC number	0.6480	1.0	0.7606	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.8.1.1	LOW CONFIDENCE prediction!
3rd Layer	2.8.1	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00025354001	SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (213 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00024835001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (329 aa)	•	•	0.493
	GSVIVG00024719001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (396 aa)	•	•	0.485
	GSVIVG00037015001	SubName- Full=Chromosome chr1 scaffold_84, whole genome shotgun sequence; (198 aa)	•	•	0.452
	GSVIVG00027006001	SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (440 aa)	•	•	0.439
	GSVIVG00034383001	SubName- Full=Putative uncharacterized protein (Chromosome chr9 scaffold_7, whole genome shotgu [...] (144 aa)	•		0.430
	GSVIVG00014438001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (180 aa)	•	•	0.420

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		178
cd00158		89	cd00158, RHOD, Rhodanese Homology Domain (RHOD); a	2e-14
smart00450		100	smart00450, RHOD, Rhodanese Homology Domain	1e-11
pfam00581		106	pfam00581, Rhodanese, Rhodanese-like domain	6e-10
cd01522		117	cd01522, RHOD_1, Member of the Rhodanese Homology	2e-07
COG0607		110	COG0607, PspE, Rhodanese-related sulfurtransferase	4e-06
cd01531		113	cd01531, Acr2p, Eukaryotic arsenate resistance pro	8e-05
cd01520		128	cd01520, RHOD_YbbB, Member of the Rhodanese Homolo	3e-04
TIGR03167		311	TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine s	6e-04
cd01528		101	cd01528, RHOD_2, Member of the Rhodanese Homology	6e-04
cd01523		100	cd01523, RHOD_Lact_B, Member of the Rhodanese Homo	7e-04
cd01519		106	cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom	8e-04
cd01526		122	cd01526, RHOD_ThiF, Member of the Rhodanese Homolo	0.001
PLN02160		136	PLN02160, PLN02160, thiosulfate sulfurtransferase	0.001
cd01447		103	cd01447, Polysulfide_ST, Polysulfide-sulfurtransfe	0.001
PRK08762		376	PRK08762, PRK08762, molybdopterin biosynthesis pro	0.001
PRK00162		108	PRK00162, glpE, thiosulfate sulfurtransferase; Val	0.003
PRK05597		355	PRK05597, PRK05597, molybdopterin biosynthesis pro	0.004

>gnl\|CDD\|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein	Back alignment and domain information

 Score = 65.0 bits (159), Expect = 2e-14
 Identities = 28/122 (22%), Positives = 47/122 (38%), Gaps = 33/122 (27%)

Query: 55  EAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLF 114
           E K L+  E   +LDVR+  +Y   HI  + ++P         L  + +R          
Sbjct: 1   ELKELLDDEDAVLLDVREPEEYAAGHIPGAINIP---------LSELEER---------- 41

Query: 115 FGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQT 174
                         +   +   +  ++V C+ G RSA AA  L +AG  N+  +  G+  
Sbjct: 42  --------------AALLELDKDKPIVVYCRSGNRSARAAKLLRKAGGTNVYNLEGGMLA 87

Query: 175 VK 176
            K
Sbjct: 88  WK 89

The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins. Length = 89

>gnl\|CDD\|197731 smart00450, RHOD, Rhodanese Homology Domain	Back alignment and domain information

>gnl\|CDD\|216005 pfam00581, Rhodanese, Rhodanese-like domain	Back alignment and domain information

>gnl\|CDD\|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1	Back alignment and domain information

>gnl\|CDD\|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238789 cd01531, Acr2p, Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>gnl\|CDD\|238778 cd01520, RHOD_YbbB, Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>gnl\|CDD\|234132 TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine synthase	Back alignment and domain information

>gnl\|CDD\|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2	Back alignment and domain information

>gnl\|CDD\|238781 cd01523, RHOD_Lact_B, Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>gnl\|CDD\|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>gnl\|CDD\|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>gnl\|CDD\|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase	Back alignment and domain information

>gnl\|CDD\|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain	Back alignment and domain information

>gnl\|CDD\|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>gnl\|CDD\|178908 PRK00162, glpE, thiosulfate sulfurtransferase; Validated	Back alignment and domain information

>gnl\|CDD\|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		178
cd01518		101	RHOD_YceA Member of the Rhodanese Homology Domain	99.92
cd01533		109	4RHOD_Repeat_2 Member of the Rhodanese Homology Do	99.91
cd01523		100	RHOD_Lact_B Member of the Rhodanese Homology Domai	99.9
cd01522		117	RHOD_1 Member of the Rhodanese Homology Domain sup	99.89
cd01519		106	RHOD_HSP67B2 Member of the Rhodanese Homology Doma	99.89
KOG1530		136	consensus Rhodanese-related sulfurtransferase [Ino	99.89
PRK00162		108	glpE thiosulfate sulfurtransferase; Validated	99.89
cd01534		95	4RHOD_Repeat_3 Member of the Rhodanese Homology Do	99.89
cd01520		128	RHOD_YbbB Member of the Rhodanese Homology Domain	99.89
cd01444		96	GlpE_ST GlpE sulfurtransferase (ST) and homologs a	99.89
cd01527		99	RHOD_YgaP Member of the Rhodanese Homology Domain	99.89
cd01526		122	RHOD_ThiF Member of the Rhodanese Homology Domain	99.88
cd01525		105	RHOD_Kc Member of the Rhodanese Homology Domain su	99.88
cd01528		101	RHOD_2 Member of the Rhodanese Homology Domain sup	99.88
cd01530		121	Cdc25 Cdc25 phosphatases are members of the Rhodan	99.88
PF00581		113	Rhodanese: Rhodanese-like domain This Prosite entr	99.88
cd01524		90	RHOD_Pyr_redox Member of the Rhodanese Homology Do	99.88
PLN02160		136	thiosulfate sulfurtransferase	99.88
cd01449		118	TST_Repeat_2 Thiosulfate sulfurtransferase (TST),	99.88
PRK01415		247	hypothetical protein; Validated	99.87
cd01447		103	Polysulfide_ST Polysulfide-sulfurtransferase - Rho	99.87
cd01529		96	4RHOD_Repeats Member of the Rhodanese Homology Dom	99.87
cd01448		122	TST_Repeat_1 Thiosulfate sulfurtransferase (TST),	99.86
PRK05320		257	rhodanese superfamily protein; Provisional	99.85
cd01521		110	RHOD_PspE2 Member of the Rhodanese Homology Domain	99.85
cd01445		138	TST_Repeats Thiosulfate sulfurtransferases (TST) c	99.85
cd01532		92	4RHOD_Repeat_1 Member of the Rhodanese Homology Do	99.85
TIGR03865		162	PQQ_CXXCW PQQ-dependent catabolism-associated CXXC	99.84
cd01531		113	Acr2p Eukaryotic arsenate resistance proteins are	99.84
cd00158		89	RHOD Rhodanese Homology Domain (RHOD); an alpha be	99.83
smart00450		100	RHOD Rhodanese Homology Domain. An alpha beta fold	99.83
PRK00142		314	putative rhodanese-related sulfurtransferase; Prov	99.82
cd01443		113	Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda	99.82
TIGR03167		311	tRNA_sel_U_synt tRNA 2-selenouridine synthase. The	99.81
PRK11784		345	tRNA 2-selenouridine synthase; Provisional	99.81
cd01535		145	4RHOD_Repeat_4 Member of the Rhodanese Homology Do	99.8
PRK11493		281	sseA 3-mercaptopyruvate sulfurtransferase; Provisi	99.79
PRK08762		376	molybdopterin biosynthesis protein MoeB; Validated	99.79
TIGR02981		101	phageshock_pspE phage shock operon rhodanese PspE.	99.79
PRK10287		104	thiosulfate:cyanide sulfurtransferase; Provisional	99.78
PRK07878		392	molybdopterin biosynthesis-like protein MoeZ; Vali	99.78
PRK09629		610	bifunctional thiosulfate sulfurtransferase/phospha	99.78
COG0607		110	PspE Rhodanese-related sulfurtransferase [Inorgani	99.77
PLN02723		320	3-mercaptopyruvate sulfurtransferase	99.77
PLN02723		320	3-mercaptopyruvate sulfurtransferase	99.77
PRK07411		390	hypothetical protein; Validated	99.74
PRK11493		281	sseA 3-mercaptopyruvate sulfurtransferase; Provisi	99.73
PRK05597		355	molybdopterin biosynthesis protein MoeB; Validated	99.73
COG2897		285	SseA Rhodanese-related sulfurtransferase [Inorgani	99.73
cd01446		132	DSP_MapKP N-terminal regulatory rhodanese domain o	99.73
PRK09629		610	bifunctional thiosulfate sulfurtransferase/phospha	99.72
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	99.69
COG2897		285	SseA Rhodanese-related sulfurtransferase [Inorgani	99.66
COG1054		308	Predicted sulfurtransferase [General function pred	99.66
PRK01269		482	tRNA s(4)U8 sulfurtransferase; Provisional	99.48
KOG3772		325	consensus M-phase inducer phosphatase [Cell cycle	99.43
KOG1529		286	consensus Mercaptopyruvate sulfurtransferase/thios	99.23
KOG2017		427	consensus Molybdopterin synthase sulfurylase [Coen	99.21
COG5105		427	MIH1 Mitotic inducer, protein phosphatase [Cell di	98.98
KOG1529		286	consensus Mercaptopyruvate sulfurtransferase/thios	98.91
COG2603		334	Predicted ATPase [General function prediction only	98.35
PF04273		110	DUF442: Putative phosphatase (DUF442); InterPro: I	97.24
TIGR01244		135	conserved hypothetical protein TIGR01244. No membe	97.04
KOG1717		343	consensus Dual specificity phosphatase [Defense me	96.85
PF13350		164	Y_phosphatase3: Tyrosine phosphatase family; PDB:	96.11
KOG1093		725	consensus Predicted protein kinase (contains TBC a	95.12
PRK00142		314	putative rhodanese-related sulfurtransferase; Prov	94.48
smart00195		138	DSPc Dual specificity phosphatase, catalytic domai	92.1
PLN02727		986	NAD kinase	91.95
cd00127		139	DSPc Dual specificity phosphatases (DSP); Ser/Thr	91.74
KOG3636		669	consensus Uncharacterized conserved protein, conta	91.23
COG3453		130	Uncharacterized protein conserved in bacteria [Fun	90.26
TIGR03167		311	tRNA_sel_U_synt tRNA 2-selenouridine synthase. The	87.93
PF00782		133	DSPc: Dual specificity phosphatase, catalytic doma	85.65
PF09992		170	DUF2233: Predicted periplasmic protein (DUF2233);	84.37
COG4822		265	CbiK Cobalamin biosynthesis protein CbiK, Co2+ che	81.52

>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

Probab=99.92  E-value=2.7e-25  Score=153.64  Aligned_cols=100  Identities=23%  Similarity=0.401  Sum_probs=83.1

Q ss_pred             eeeCHHHHHHHhhcCCeEEEeeCChhhhhhccCCCeEEecccccccCCcchhhhhhcccccccccccCCCCCCCChHHHH
Q 030411           49 NYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQ  128 (178)
Q Consensus        49 ~~Is~~e~~~~l~~~~~~lIDvR~~~e~~~ghIpgAvnip~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  128 (178)
                      +.|+++++.+++++++.+|||||++.||..+|||||+|+|+..+...                            .+.+.
T Consensus         2 ~~is~~~l~~~~~~~~~~iiDvR~~~e~~~ghi~gA~~ip~~~~~~~----------------------------~~~~~   53 (101)
T cd01518           2 TYLSPAEWNELLEDPEVVLLDVRNDYEYDIGHFKGAVNPDVDTFREF----------------------------PFWLD   53 (101)
T ss_pred             CcCCHHHHHHHHcCCCEEEEEcCChhhhhcCEeccccCCCcccHhHh----------------------------HHHHH
Confidence            46899999999987789999999999999999999999998754210                            01111


Q ss_pred             HHHhcCCCCCeEEEEcCCChhHHHHHHHHHHcCCceEEEeccccccccC
Q 030411          129 SVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKP  177 (178)
Q Consensus       129 ~~~~~~~~~~~iviyC~~g~rs~~aa~~L~~~G~~~v~~l~GG~~~w~~  177 (178)
                      .. ..++++++||+||++|.||..++..|...||+||++|+||+.+|.+
T Consensus        54 ~~-~~~~~~~~ivvyC~~G~rs~~a~~~L~~~G~~~v~~l~GG~~~W~~  101 (101)
T cd01518          54 EN-LDLLKGKKVLMYCTGGIRCEKASAYLKERGFKNVYQLKGGILKYLE  101 (101)
T ss_pred             hh-hhhcCCCEEEEECCCchhHHHHHHHHHHhCCcceeeechhHHHHhC
Confidence            11 1236889999999999999999999999999999999999999975

This CD includes Escherichia coli YceA, Bacillus subtilis YbfQ, and similar uncharacterized proteins.

>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2	Back alignment and domain information

>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1	Back alignment and domain information

>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK00162 glpE thiosulfate sulfurtransferase; Validated	Back alignment and domain information

>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3	Back alignment and domain information

>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2	Back alignment and domain information

>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family	Back alignment and domain information

>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>PLN02160 thiosulfate sulfurtransferase	Back alignment and domain information

>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain	Back alignment and domain information

>PRK01415 hypothetical protein; Validated	Back alignment and domain information

>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain	Back alignment and domain information

>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain	Back alignment and domain information

>PRK05320 rhodanese superfamily protein; Provisional	Back alignment and domain information

>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain	Back alignment and domain information

>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1	Back alignment and domain information

>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein	Back alignment and domain information

>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein	Back alignment and domain information

>smart00450 RHOD Rhodanese Homology Domain	Back alignment and domain information

>PRK00142 putative rhodanese-related sulfurtransferase; Provisional	Back alignment and domain information

>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily	Back alignment and domain information

>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase	Back alignment and domain information

>PRK11784 tRNA 2-selenouridine synthase; Provisional	Back alignment and domain information

>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4	Back alignment and domain information

>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional	Back alignment and domain information

>PRK08762 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE	Back alignment and domain information

>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional	Back alignment and domain information

>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated	Back alignment and domain information

>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional	Back alignment and domain information

>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN02723 3-mercaptopyruvate sulfurtransferase	Back alignment and domain information

>PLN02723 3-mercaptopyruvate sulfurtransferase	Back alignment and domain information

>PRK07411 hypothetical protein; Validated	Back alignment and domain information

>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional	Back alignment and domain information

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase	Back alignment and domain information

>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1054 Predicted sulfurtransferase [General function prediction only]	Back alignment and domain information

>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional	Back alignment and domain information

>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms]	Back alignment and domain information

>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism]	Back alignment and domain information

>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms]	Back alignment and domain information

>COG2603 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function	Back alignment and domain information

>TIGR01244 conserved hypothetical protein TIGR01244	Back alignment and domain information

>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms]	Back alignment and domain information

>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B	Back alignment and domain information

>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only]	Back alignment and domain information

>PRK00142 putative rhodanese-related sulfurtransferase; Provisional	Back alignment and domain information

>smart00195 DSPc Dual specificity phosphatase, catalytic domain	Back alignment and domain information

>PLN02727 NAD kinase	Back alignment and domain information

>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases	Back alignment and domain information

>KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only]	Back alignment and domain information

>COG3453 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase	Back alignment and domain information

>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity	Back alignment and domain information

>PF09992 DUF2233: Predicted periplasmic protein (DUF2233); InterPro: IPR018711 This entry contains proteins that catalyze the second step in the formation of the mannose 6-phosphate targeting signal on lysosomal enzyme oligosaccharides, this is achieved by removing GlcNAc residues from GlcNAc-alpha-P-mannose moieties, which are formed in the first step	Back alignment and domain information

>COG4822 CbiK Cobalamin biosynthesis protein CbiK, Co2+ chelatase [Coenzyme metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		178
1tq1_A		129	Solution Structure Of At5g66040, A Putative Protein		7e-05
3r2u_A		466	2.1 Angstrom Resolution Crystal Structure Of Metall		8e-05

>pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129

Back alignment and structure

Iteration: 1

Score = 43.5 bits (101), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 25/113 (22%) Query: 59 LIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLP 118 L+A RY LDVR ++++ H + +VP ++ SG+ Sbjct: 29 LLAGHRY--LDVRTPEEFSQGHACGAINVPY----------------MNRGASGM----- 65 Query: 119 FTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSG 171 +N +F++ V S F ++V CQ G RS A L AGF + I G Sbjct: 66 --SKNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGG 116

PyMOL of 1tq1

>pdb|3R2U|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp. Aureus Col Length = 466

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		178
1tq1_A		129	AT5G66040, senescence-associated family protein; C	4e-16
1gmx_A		108	GLPE protein; transferase, rhodanese, sulfurtransf	2e-14
3ilm_A		141	ALR3790 protein; rhodanese-like, NSR437H, NESG, st	3e-13
1wv9_A		94	Rhodanese homolog TT1651; CDC25, phosphatase, sulf	1e-12
3d1p_A		139	Putative thiosulfate sulfurtransferase YOR285W; at	1e-12
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	1e-12
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	3e-11
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	3e-08
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	4e-07
3i2v_A		127	Adenylyltransferase and sulfurtransferase MOCS3; r	2e-12
1qxn_A		137	SUD, sulfide dehydrogenase; polysulfide-sulfur tra	3e-12
3hix_A		106	ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q	5e-12
3tp9_A		474	Beta-lactamase and rhodanese domain protein; struc	6e-12
1vee_A		134	Proline-rich protein family; hypothetical protein,	7e-12
3eme_A		103	Rhodanese-like domain protein; alpha-beta-alpha sa	1e-11
2hhg_A		139	Hypothetical protein RPA3614; MCSG, structural gen	2e-11
2fsx_A		148	RV0390, COG0607: rhodanese-related sulfurtransfera	3e-11
3foj_A		100	Uncharacterized protein; protein SSP1007, structur	4e-11
3gk5_A		108	Uncharacterized rhodanese-related protein TVG08686	2e-10
2k0z_A		110	Uncharacterized protein HP1203; A/B domain, struct	4e-10
3g5j_A		134	Putative ATP/GTP binding protein; N-terminal domai	1e-09
3r2u_A		466	Metallo-beta-lactamase family protein; structural	1e-09
1t3k_A		152	Arath CDC25, dual-specificity tyrosine phosphatase	2e-09
2jtq_A		85	Phage shock protein E; solution structure rhodanes	2e-08
3nhv_A		144	BH2092 protein; alpha-beta protein, structural gen	6e-08
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	6e-07
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	1e-06
3flh_A		124	Uncharacterized protein LP_1913; alpha-beta protei	2e-05
1c25_A		161	CDC25A; hydrolase, cell cycle phosphatase,dual spe	8e-05
3op3_A		216	M-phase inducer phosphatase 3; structural genomics	2e-04
1qb0_A		211	Protein (M-phase inducer phosphatase 2 (CDC25B));	2e-04
2j6p_A		152	SB(V)-AS(V) reductase; arsenate reductase, antimon	2e-04
2a2k_A		175	M-phase inducer phosphatase 2; dual specificity, s	2e-04
3f4a_A		169	Uncharacterized protein YGR203W; protein phosphata	5e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-04

>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129	Back alignment and structure

 Score = 69.8 bits (171), Expect = 4e-16
 Identities = 29/129 (22%), Positives = 47/129 (36%), Gaps = 24/129 (18%)

Query: 45  RADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKR 104
               + V+   A +L+    +  LDVR   ++++ H   + +VP                
Sbjct: 14  SRVPSSVSVTVAHDLLL-AGHRYLDVRTPEEFSQGHACGAINVPYM-------------- 58

Query: 105 TVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQN 164
                      G     +N +F++ V S F     ++V CQ G RS  A   L  AGF  
Sbjct: 59  ---------NRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTG 109

Query: 165 IACITSGLQ 173
           +  I  G  
Sbjct: 110 VKDIVGGYS 118

PyMOL of 1tq1

>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108	Back alignment and structure

>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141	Back alignment and structure

>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94	Back alignment and structure

>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539	Back alignment and structure

>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127	Back alignment and structure

>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137	Back alignment and structure

>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106	Back alignment and structure

>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474	Back alignment and structure

>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134	Back alignment and structure

>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139	Back alignment and structure

>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148	Back alignment and structure

>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100	Back alignment and structure

>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108	Back alignment and structure

>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110	Back alignment and structure

>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134	Back alignment and structure

>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466	Back alignment and structure

>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152	Back alignment and structure

>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85	Back alignment and structure

>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588	Back alignment and structure

>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124	Back alignment and structure

>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161	Back alignment and structure

>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216	Back alignment and structure

>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211	Back alignment and structure

>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152	Back alignment and structure

>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175	Back alignment and structure

>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		178
3foj_A		100	Uncharacterized protein; protein SSP1007, structur	99.94
3iwh_A		103	Rhodanese-like domain protein; alpha-beta-alpha sa	99.94
3eme_A		103	Rhodanese-like domain protein; alpha-beta-alpha sa	99.94
1gmx_A		108	GLPE protein; transferase, rhodanese, sulfurtransf	99.93
1tq1_A		129	AT5G66040, senescence-associated family protein; C	99.93
3gk5_A		108	Uncharacterized rhodanese-related protein TVG08686	99.93
1wv9_A		94	Rhodanese homolog TT1651; CDC25, phosphatase, sulf	99.92
3d1p_A		139	Putative thiosulfate sulfurtransferase YOR285W; at	99.92
1qxn_A		137	SUD, sulfide dehydrogenase; polysulfide-sulfur tra	99.92
3hix_A		106	ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q	99.91
2hhg_A		139	Hypothetical protein RPA3614; MCSG, structural gen	99.91
3g5j_A		134	Putative ATP/GTP binding protein; N-terminal domai	99.91
3ilm_A		141	ALR3790 protein; rhodanese-like, NSR437H, NESG, st	99.91
1t3k_A		152	Arath CDC25, dual-specificity tyrosine phosphatase	99.9
3flh_A		124	Uncharacterized protein LP_1913; alpha-beta protei	99.9
3nhv_A		144	BH2092 protein; alpha-beta protein, structural gen	99.89
3i2v_A		127	Adenylyltransferase and sulfurtransferase MOCS3; r	99.89
2fsx_A		148	RV0390, COG0607: rhodanese-related sulfurtransfera	99.89
2k0z_A		110	Uncharacterized protein HP1203; A/B domain, struct	99.89
4f67_A		265	UPF0176 protein LPG2838; structural genomics, PSI-	99.89
2jtq_A		85	Phage shock protein E; solution structure rhodanes	99.88
1vee_A		134	Proline-rich protein family; hypothetical protein,	99.88
1e0c_A		271	Rhodanese, sulfurtransferase; sulfur metabolism, t	99.87
1urh_A		280	3-mercaptopyruvate sulfurtransferase; rhodanese; 2	99.86
3op3_A		216	M-phase inducer phosphatase 3; structural genomics	99.85
2vsw_A		153	Dual specificity protein phosphatase 16; hydrolase	99.85
1e0c_A		271	Rhodanese, sulfurtransferase; sulfur metabolism, t	99.85
1c25_A		161	CDC25A; hydrolase, cell cycle phosphatase,dual spe	99.85
1urh_A		280	3-mercaptopyruvate sulfurtransferase; rhodanese; 2	99.85
3hzu_A		318	Thiosulfate sulfurtransferase SSEA; niaid, ssgcid,	99.85
1qb0_A		211	Protein (M-phase inducer phosphatase 2 (CDC25B));	99.85
2a2k_A		175	M-phase inducer phosphatase 2; dual specificity, s	99.85
2j6p_A		152	SB(V)-AS(V) reductase; arsenate reductase, antimon	99.84
3aay_A		277	Putative thiosulfate sulfurtransferase; sulfurtran	99.84
1rhs_A		296	Sulfur-substituted rhodanese; transferase, sulfurt	99.84
2ouc_A		142	Dual specificity protein phosphatase 10; rhodanese	99.84
3olh_A		302	MST, 3-mercaptopyruvate sulfurtransferase; structu	99.84
1uar_A		285	Rhodanese; sulfurtransferase, riken structural gen	99.83
1rhs_A		296	Sulfur-substituted rhodanese; transferase, sulfurt	99.83
3olh_A		302	MST, 3-mercaptopyruvate sulfurtransferase; structu	99.83
1uar_A		285	Rhodanese; sulfurtransferase, riken structural gen	99.83
3hzu_A		318	Thiosulfate sulfurtransferase SSEA; niaid, ssgcid,	99.82
3f4a_A		169	Uncharacterized protein YGR203W; protein phosphata	99.82
3tg1_B		158	Dual specificity protein phosphatase 10; kinase/rh	99.82
3aay_A		277	Putative thiosulfate sulfurtransferase; sulfurtran	99.82
3tp9_A		474	Beta-lactamase and rhodanese domain protein; struc	99.81
1hzm_A		154	Dual specificity protein phosphatase 6; hydrolase;	99.8
2gwf_A		157	Ubiquitin carboxyl-terminal hydrolase 8; protein-p	99.8
1whb_A		157	KIAA0055; deubiqutinating enzyme, UBPY, structural	99.8
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	99.79
1okg_A		373	Possible 3-mercaptopyruvate sulfurtransferase; rho	99.79
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	99.79
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	99.79
2wlr_A		423	Putative thiosulfate sulfurtransferase YNJE; rhoda	99.78
2eg4_A		230	Probable thiosulfate sulfurtransferase; structural	99.78
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	99.78
2wlr_A		423	Putative thiosulfate sulfurtransferase YNJE; rhoda	99.76
2eg4_A		230	Probable thiosulfate sulfurtransferase; structural	99.75
3r2u_A		466	Metallo-beta-lactamase family protein; structural	99.73
1okg_A		373	Possible 3-mercaptopyruvate sulfurtransferase; rho	99.72
3utn_X		327	Thiosulfate sulfurtransferase TUM1; rhodanese-like	99.7
3utn_X		327	Thiosulfate sulfurtransferase TUM1; rhodanese-like	99.69
3tp9_A		474	Beta-lactamase and rhodanese domain protein; struc	99.68
3r2u_A		466	Metallo-beta-lactamase family protein; structural	99.4
2f46_A		156	Hypothetical protein; structural genomics, joint c	98.15
4erc_A		150	Dual specificity protein phosphatase 23; alpha bet	95.28
1v8c_A		168	MOAD related protein; riken structural genomics/pr	94.44
3rgo_A		157	Protein-tyrosine phosphatase mitochondrial 1; phos	94.19
2img_A		151	Dual specificity protein phosphatase 23; DUSP23, V	93.24
1xri_A		151	AT1G05000; structural genomics, protein structure	92.61
2nt2_A		145	Protein phosphatase slingshot homolog 2; alpha/bet	92.43
2hcm_A		164	Dual specificity protein phosphatase; structural g	91.99
2r0b_A		154	Serine/threonine/tyrosine-interacting protein; str	91.35
1yz4_A		160	DUSP15, dual specificity phosphatase-like 15 isofo	91.09
1ywf_A		296	Phosphotyrosine protein phosphatase PTPB; four str	90.98
1wrm_A		165	Dual specificity phosphatase 22; DSP, JNK, hydrola	90.44
2e0t_A		151	Dual specificity phosphatase 26; conserved hypothe	90.08
3ezz_A		144	Dual specificity protein phosphatase 4; alpha/beta	89.48
1fpz_A		212	Cyclin-dependent kinase inhibitor 3; alpha-beta sa	89.25
2esb_A		188	Dual specificity protein phosphatase 18; alpha/bet	89.13
1zzw_A		149	Dual specificity protein phosphatase 10; MKP, PTP,	89.01
3f81_A		183	Dual specificity protein phosphatase 3; hydrolase,	88.26
2wgp_A		190	Dual specificity protein phosphatase 14; MKP6, DUS	88.2
3s4e_A		144	Dual specificity protein phosphatase 19; PTP, prot	87.99
2pq5_A		205	Dual specificity protein phosphatase 13; hydrolase	87.13
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	86.76
3rz2_A		189	Protein tyrosine phosphatase type IVA 1; tyrosine	86.19
2g6z_A		211	Dual specificity protein phosphatase 5; alpha/beta	85.5
3s4o_A		167	Protein tyrosine phosphatase-like protein; structu	85.13
2q05_A		195	Late protein H1, dual specificity protein phosphat	84.88
3cm3_A		176	Late protein H1, dual specificity protein phosphat	83.7
2y96_A		219	Dual specificity phosphatase DUPD1; hydrolase; 2.3	83.62
2rb4_A		175	ATP-dependent RNA helicase DDX25; rossmann fold, s	80.66

>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp}	Back alignment and structure

Probab=99.94  E-value=6.6e-27  Score=160.50  Aligned_cols=94  Identities=20%  Similarity=0.356  Sum_probs=83.6

Q ss_pred             ceeeCHHHHHHHhh-cCCeEEEeeCChhhhhhccCCCeEEecccccccCCcchhhhhhcccccccccccCCCCCCCChHH
Q 030411           48 VNYVNAEEAKNLIA-VERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEF  126 (178)
Q Consensus        48 ~~~Is~~e~~~~l~-~~~~~lIDvR~~~e~~~ghIpgAvnip~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  126 (178)
                      ++.|+++++.++++ +++++|||||+++||..||||||+|+|+..+.+.                               
T Consensus         1 ~~~is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpgA~~ip~~~l~~~-------------------------------   49 (100)
T 3foj_A            1 MESITVTELKEKILDANPVNIVDVRTDQETAMGIIPGAETIPMNSIPDN-------------------------------   49 (100)
T ss_dssp             CCEECHHHHHHGGGSSSCCEEEECSCHHHHTTCBCTTCEECCGGGGGGC-------------------------------
T ss_pred             CCccCHHHHHHHHhcCCCcEEEECCCHHHHhcCcCCCCEECCHHHHHHH-------------------------------
Confidence            35799999999984 5689999999999999999999999999865321                               


Q ss_pred             HHHHHhcCCCCCeEEEEcCCChhHHHHHHHHHHcCCceEEEeccccccccC
Q 030411          127 VQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKP  177 (178)
Q Consensus       127 ~~~~~~~~~~~~~iviyC~~g~rs~~aa~~L~~~G~~~v~~l~GG~~~w~~  177 (178)
                          ...++++++||+||.+|.||..+++.|+..|| +|++|+||+.+|++
T Consensus        50 ----~~~l~~~~~ivvyC~~g~rs~~a~~~L~~~G~-~v~~l~GG~~~W~~   95 (100)
T 3foj_A           50 ----LNYFNDNETYYIICKAGGRSAQVVQYLEQNGV-NAVNVEGGMDEFGD   95 (100)
T ss_dssp             ----GGGSCTTSEEEEECSSSHHHHHHHHHHHTTTC-EEEEETTHHHHHCS
T ss_pred             ----HHhCCCCCcEEEEcCCCchHHHHHHHHHHCCC-CEEEecccHHHHHH
Confidence                34467899999999999999999999999999 89999999999976

PyMOL of 3foj

>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A	Back alignment and structure

>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A	Back alignment and structure

>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3	Back alignment and structure

>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1}	Back alignment and structure

>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus}	Back alignment and structure

>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae}	Back alignment and structure

>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3	Back alignment and structure

>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A	Back alignment and structure

>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris}	Back alignment and structure

>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile}	Back alignment and structure

>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A	Back alignment and structure

>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1	Back alignment and structure

>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A	Back alignment and structure

>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A	Back alignment and structure

>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens}	Back alignment and structure

>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis}	Back alignment and structure

>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori}	Back alignment and structure

>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp}	Back alignment and structure

>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A	Back alignment and structure

>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A	Back alignment and structure

>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X	Back alignment and structure

>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2	Back alignment and structure

>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens}	Back alignment and structure

>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A	Back alignment and structure

>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X	Back alignment and structure

>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1	Back alignment and structure

>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2	Back alignment and structure

>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A	Back alignment and structure

>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A	Back alignment and structure

>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A	Back alignment and structure

>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major}	Back alignment and structure

>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A	Back alignment and structure

>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A	Back alignment and structure

>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens}	Back alignment and structure

>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens}	Back alignment and structure

>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2	Back alignment and structure

>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A	Back alignment and structure

>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens}	Back alignment and structure

>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2	Back alignment and structure

>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A	Back alignment and structure

>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A*	Back alignment and structure

>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens}	Back alignment and structure

>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A	Back alignment and structure

>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1	Back alignment and structure

>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4	Back alignment and structure

>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2	Back alignment and structure

>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A	Back alignment and structure

>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2	Back alignment and structure

>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A	Back alignment and structure

>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A	Back alignment and structure

>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus}	Back alignment and structure

>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3	Back alignment and structure

>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae}	Back alignment and structure

>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae}	Back alignment and structure

>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus}	Back alignment and structure

>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491}	Back alignment and structure

>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A	Back alignment and structure

>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1	Back alignment and structure

>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A*	Back alignment and structure

>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens}	Back alignment and structure

>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A	Back alignment and structure

>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens}	Back alignment and structure

>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus}	Back alignment and structure

>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens}	Back alignment and structure

>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens}	Back alignment and structure

>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A*	Back alignment and structure

>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens}	Back alignment and structure

>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens}	Back alignment and structure

>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A	Back alignment and structure

>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A*	Back alignment and structure

>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens}	Back alignment and structure

>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens}	Back alignment and structure

>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A*	Back alignment and structure

>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens}	Back alignment and structure

>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens}	Back alignment and structure

>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens}	Back alignment and structure

>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A	Back alignment and structure

>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens}	Back alignment and structure

>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major}	Back alignment and structure

>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR}	Back alignment and structure

>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A	Back alignment and structure

>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens}	Back alignment and structure

>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		178
d1tq1a_		119	c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc	2e-08
d1gmxa_		108	c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia	3e-08
d1e0ca2		136	c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte	6e-05
d1yt8a4		130	c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase	6e-05
d1ymka1		174	c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens)	6e-05
d1c25a_		161	c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId:	8e-05
d1hzma_		154	c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat	0.001
d2gwfa1		135	c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h	0.002
d1yt8a1		136	c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase	0.002
d1e0ca1		135	c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter	0.002

>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 47.9 bits (113), Expect = 2e-08
 Identities = 29/123 (23%), Positives = 46/123 (37%), Gaps = 24/123 (19%)

Query: 51  VNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNF 110
           V+   A +L+    +  LDVR   ++++ H   + +VP                      
Sbjct: 10  VSVTVAHDLLL-AGHRYLDVRTPEEFSQGHACGAINVPYM-------------------- 48

Query: 111 SGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITS 170
                G     +N +F++ V S F     ++V CQ G RS  A   L  AGF  +  I  
Sbjct: 49  ---NRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVG 105

Query: 171 GLQ 173
           G  
Sbjct: 106 GYS 108

PyMOL of d1tq1a_

>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108	Back information, alignment and structure

>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136	Back information, alignment and structure

>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130	Back information, alignment and structure

>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174	Back information, alignment and structure

>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161	Back information, alignment and structure

>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154	Back information, alignment and structure

>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135	Back information, alignment and structure

>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136	Back information, alignment and structure

>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		178
d1gmxa_		108	Sulfurtransferase GlpE {Escherichia coli [TaxId: 5	99.94
d1tq1a_		119	Thiosulfate sulfurtransferase/Senescence-associate	99.92
d1e0ca2		136	Sulfurtransferase {Azotobacter vinelandii [TaxId:	99.91
d1yt8a2		101	Thiosulfate sulfurtransferase PA2603 {Pseudomonas	99.91
d1yt8a4		130	Thiosulfate sulfurtransferase PA2603 {Pseudomonas	99.91
d1yt8a3		157	Thiosulfate sulfurtransferase PA2603 {Pseudomonas	99.9
d1yt8a1		136	Thiosulfate sulfurtransferase PA2603 {Pseudomonas	99.9
d1qxna_		137	Polysulfide-sulfur transferase (sulfide dehydrogen	99.89
d1urha1		147	3-mercaptopyruvate sulfurtransferase {Escherichia	99.89
d1t3ka_		132	Dual specificity phosphatase Cdc25 {Thale cress (A	99.89
d1rhsa2		144	Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	99.88
d1e0ca1		135	Sulfurtransferase {Azotobacter vinelandii [TaxId:	99.88
d1urha2		120	3-mercaptopyruvate sulfurtransferase {Escherichia	99.88
d1uara1		143	Sulfurtransferase {Thermus thermophilus [TaxId: 27	99.88
d1rhsa1		149	Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	99.87
d1uara2		141	Sulfurtransferase {Thermus thermophilus [TaxId: 27	99.86
d1c25a_		161	CDC25a {Human (Homo sapiens) [TaxId: 9606]}	99.82
d1okga1		156	3-mercaptopyruvate sulfurtransferase {Leishmania m	99.81
d2gwfa1		135	Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum	99.8
d1okga2		139	3-mercaptopyruvate sulfurtransferase {Leishmania m	99.8
d1ymka1		174	CDC25b {Human (Homo sapiens) [TaxId: 9606]}	99.79
d1hzma_		154	Erk2 binding domain of Mapk phosphatase mkp-3 {Hum	99.67
d1ywfa1		272	Phosphotyrosine protein phosphatase PtpB {Mycobact	94.59
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	93.36
d1xria_		151	Putative phosphatase At1g05000 {Thale cress (Arabi	92.48
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	89.73
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	88.43
d1ohea2		182	Proline directed phosphatase CDC14b2 {Human (Homo	84.02
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	82.96
d1m3ga_		145	Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax	81.41
d1fpza_		176	Kinase associated phosphatase (kap) {Human (Homo s	81.36
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	80.86
d1u9ya2		129	Phosphoribosylpyrophosphate synthetase {Methanocal	80.58
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	80.17

>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Sulfurtransferase GlpE
species: Escherichia coli [TaxId: 562]

Probab=99.94  E-value=2.3e-27  Score=163.63  Aligned_cols=96  Identities=18%  Similarity=0.337  Sum_probs=87.3

Q ss_pred             CceeeCHHHHHHHhhcCCeEEEeeCChhhhhhccCCCeEEecccccccCCcchhhhhhcccccccccccCCCCCCCChHH
Q 030411           47 DVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEF  126 (178)
Q Consensus        47 ~~~~Is~~e~~~~l~~~~~~lIDvR~~~e~~~ghIpgAvnip~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  126 (178)
                      .++.||++|+.+++++++++|||||++.||..||||||+|+|...+                                  
T Consensus         3 ~~~~Is~~e~~~~l~~~~~~liDvR~~~e~~~ghI~gA~~ip~~~l----------------------------------   48 (108)
T d1gmxa_           3 QFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTL----------------------------------   48 (108)
T ss_dssp             SCEEECHHHHHHHHHTTCCEEEECSCHHHHHHCEETTCEECCHHHH----------------------------------
T ss_pred             CCCEeCHHHHHHHHHCCCeEEEECCCHHHHHhcCCCCcccccchhH----------------------------------
Confidence            4688999999999998899999999999999999999999998743                                  


Q ss_pred             HHHHHhcCCCCCeEEEEcCCChhHHHHHHHHHHcCCceEEEeccccccccC
Q 030411          127 VQSVKSQFSPESKLLVVCQEGLRSAAAANKLEEAGFQNIACITSGLQTVKP  177 (178)
Q Consensus       127 ~~~~~~~~~~~~~iviyC~~g~rs~~aa~~L~~~G~~~v~~l~GG~~~w~~  177 (178)
                       ......++++++||+||.+|.+|..++..|.+.||+||++|+||+.+|++
T Consensus        49 -~~~~~~~~~~~~ivv~c~~g~rs~~~a~~L~~~G~~~v~~l~GG~~~W~~   98 (108)
T d1gmxa_          49 -GAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEAWQR   98 (108)
T ss_dssp             -HHHHHHSCTTSCEEEECSSSSHHHHHHHHHHHHTCSSEEEETTHHHHHHH
T ss_pred             -HHHhhhccccCcccccCCCChHHHHHHHHHHHcCCCCEEEEcChHHHHHH
Confidence             33355678999999999999999999999999999999999999999964

PyMOL of d1gmxa_

>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]}	Back information, alignment and structure

>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure