Citrus Sinensis ID: 030435

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVIEK
ccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccccHHHHHHcHHcccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccEEEEccccccccccccccEEEEccccccHHccccccccc
ccHHHHHHHccccEccEccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcEcccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEEEccccHEcccccEEEEEEEccccHHHcccEEEEEEEccHHHcHHHHHHccc
mskdtlefhwgkHHRAYVDNLNkqivgtelgdgkslEDVVIASynkgdllpafNNAAQAWnhdffwesmkpggggkpsgelLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANnradvanavnplpsekdksllvvktpnavnplvwdysplltidVWEVNIYHCVLVIEK
mskdtlefhwgKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNplpsekdksllvVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVIEK
MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWesmkpggggkpsgellgLIERDFGSfekfleefkaaaaTQFGSGWAWLVYKannradvanavnPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVIEK
*****LEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM*********GELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVN********SLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVI**
MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKP******SGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVIE*
MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVIEK
MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVI**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVIEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
Q9LU64305 Superoxide dismutase [Fe] yes no 0.943 0.547 0.763 5e-74
P22302202 Superoxide dismutase [Fe] N/A no 0.858 0.752 0.686 9e-61
P28759248 Superoxide dismutase [Fe] no no 0.943 0.673 0.735 4e-60
P21276212 Superoxide dismutase [Fe] no no 0.847 0.707 0.686 3e-53
Q9FMX0263 Superoxide dismutase [Fe] no no 0.864 0.581 0.532 6e-47
Q5VRL3391 Superoxide dismutase [Fe] yes no 0.943 0.427 0.497 2e-43
Q8YSZ1200 Superoxide dismutase [Fe] yes no 0.847 0.75 0.520 1e-41
P77968199 Superoxide dismutase [Fe] N/A no 0.847 0.753 0.514 3e-40
P50061199 Superoxide dismutase [Fe] N/A no 0.847 0.753 0.508 3e-39
Q5VSB7255 Superoxide dismutase [Fe] no no 0.858 0.596 0.467 5e-38
>sp|Q9LU64|SODF2_ARATH Superoxide dismutase [Fe] 2, chloroplastic OS=Arabidopsis thaliana GN=FSD2 PE=1 SV=1 Back     alignment and function desciption
 Score =  276 bits (706), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 151/169 (89%), Gaps = 2/169 (1%)

Query: 1   MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAW 60
           MS++TL++HWGKHH+ YV+NLNKQI+GT+L D  SLE+VV+ SYNKG++LPAFNNAAQAW
Sbjct: 69  MSRETLDYHWGKHHKTYVENLNKQILGTDL-DALSLEEVVLLSYNKGNMLPAFNNAAQAW 127

Query: 61  NHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANN 120
           NH+FFWES++PGGGGKP+GELL LIERDFGSFE+FLE FK+AAA+ FGSGW WL YKA N
Sbjct: 128 NHEFFWESIQPGGGGKPTGELLRLIERDFGSFEEFLERFKSAAASNFGSGWTWLAYKA-N 186

Query: 121 RADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIY 169
           R DVANAVNPLP E+DK L++VKTPNAVNPLVWDYSPLLTID WE   Y
Sbjct: 187 RLDVANAVNPLPKEEDKKLVIVKTPNAVNPLVWDYSPLLTIDTWEHAYY 235
Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems (By similarity). Plays important role in chloroplast development, particularly in the maintenance of thylakoids membranes. Seems to act as a heterodimer with FSD3.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|P22302|SODF_NICPL Superoxide dismutase [Fe], chloroplastic (Fragment) OS=Nicotiana plumbaginifolia GN=SODB PE=2 SV=1 Back     alignment and function description
>sp|P28759|SODF_SOYBN Superoxide dismutase [Fe], chloroplastic OS=Glycine max GN=SODB PE=2 SV=1 Back     alignment and function description
>sp|P21276|SODF1_ARATH Superoxide dismutase [Fe] 1, chloroplastic OS=Arabidopsis thaliana GN=FSD1 PE=1 SV=4 Back     alignment and function description
>sp|Q9FMX0|SODF3_ARATH Superoxide dismutase [Fe] 3, chloroplastic OS=Arabidopsis thaliana GN=FSD3 PE=1 SV=1 Back     alignment and function description
>sp|Q5VRL3|SODF1_ORYSJ Superoxide dismutase [Fe] 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0115400 PE=2 SV=1 Back     alignment and function description
>sp|Q8YSZ1|SODF_NOSS1 Superoxide dismutase [Fe] OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=sodB PE=3 SV=3 Back     alignment and function description
>sp|P77968|SODF_SYNY3 Superoxide dismutase [Fe] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sodB PE=1 SV=3 Back     alignment and function description
>sp|P50061|SODF_PLEBO Superoxide dismutase [Fe] OS=Plectonema boryanum GN=sodB PE=2 SV=1 Back     alignment and function description
>sp|Q5VSB7|SODF2_ORYSJ Superoxide dismutase [Fe] 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0143000 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
195548074163 iron superoxide dismutase [Citrus maxima 0.920 1.0 0.969 2e-78
380085077 305 Fe superoxide dismutase [Jatropha curcas 0.943 0.547 0.816 1e-74
312837926 278 Fe superoxide dismutase 2 [Brassica rapa 0.943 0.600 0.763 2e-72
15241373 305 Fe superoxide dismutase 2 [Arabidopsis t 0.943 0.547 0.763 2e-72
225454956 306 PREDICTED: superoxide dismutase [Fe], ch 0.943 0.545 0.763 6e-72
297795915 305 hypothetical protein ARALYDRAFT_918143 [ 0.943 0.547 0.757 2e-71
356499596 313 PREDICTED: superoxide dismutase [Fe], ch 0.920 0.520 0.783 2e-71
255539971 305 superoxide dismutase [fe], putative [Ric 0.943 0.547 0.834 8e-70
391358662236 iron superoxide dismutase Fe-SOD6, parti 0.943 0.707 0.810 4e-69
347597326 282 Fe-superoxide dismutase [Phytolacca acin 0.943 0.592 0.763 7e-69
>gi|195548074|gb|ACG49262.1| iron superoxide dismutase [Citrus maxima] Back     alignment and taxonomy information
 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 158/163 (96%), Positives = 158/163 (96%)

Query: 7   EFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFW 66
           EFHWGK HRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFW
Sbjct: 1   EFHWGKQHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFW 60

Query: 67  ESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVAN 126
           ESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVAN
Sbjct: 61  ESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVAN 120

Query: 127 AVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIY 169
           AVNPLPSEKDKSLLVVKTPNAVNPLVWDYS LLTIDVWE   Y
Sbjct: 121 AVNPLPSEKDKSLLVVKTPNAVNPLVWDYSSLLTIDVWEHAYY 163

Source: Citrus maxima

Species: Citrus maxima

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|380085077|gb|AFD34189.1| Fe superoxide dismutase [Jatropha curcas] Back     alignment and taxonomy information
>gi|312837926|gb|ADR01110.1| Fe superoxide dismutase 2 [Brassica rapa] Back     alignment and taxonomy information
>gi|15241373|ref|NP_199923.1| Fe superoxide dismutase 2 [Arabidopsis thaliana] gi|8843846|dbj|BAA97372.1| unnamed protein product [Arabidopsis thaliana] gi|21537292|gb|AAM61633.1| Fe-superoxide dismutase precursor [Arabidopsis thaliana] gi|28393352|gb|AAO42100.1| putative iron superoxide dismutase [Arabidopsis thaliana] gi|28827610|gb|AAO50649.1| putative iron superoxide dismutase [Arabidopsis thaliana] gi|110737010|dbj|BAF00460.1| hypothetical protein [Arabidopsis thaliana] gi|332008651|gb|AED96034.1| Fe superoxide dismutase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225454956|ref|XP_002280522.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Vitis vinifera] gi|297744964|emb|CBI38556.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297795915|ref|XP_002865842.1| hypothetical protein ARALYDRAFT_918143 [Arabidopsis lyrata subsp. lyrata] gi|297311677|gb|EFH42101.1| hypothetical protein ARALYDRAFT_918143 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356499596|ref|XP_003518624.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255539971|ref|XP_002511050.1| superoxide dismutase [fe], putative [Ricinus communis] gi|223550165|gb|EEF51652.1| superoxide dismutase [fe], putative [Ricinus communis] Back     alignment and taxonomy information
>gi|391358662|gb|AFM43802.1| iron superoxide dismutase Fe-SOD6, partial [Litchi chinensis] Back     alignment and taxonomy information
>gi|347597326|gb|AEP14527.1| Fe-superoxide dismutase [Phytolacca acinosa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
TAIR|locus:2176167305 FSD2 "AT5G51100" [Arabidopsis 0.943 0.547 0.568 9.5e-50
TAIR|locus:2117273212 FSD1 "Fe superoxide dismutase 0.649 0.542 0.577 2.5e-43
TAIR|locus:2166953263 FSD3 "Fe superoxide dismutase 0.864 0.581 0.443 7.4e-34
UNIPROTKB|Q0C4B8220 sodB "Superoxide dismutase" [H 0.655 0.527 0.444 1.1e-29
UNIPROTKB|P0AGD3193 sodB [Escherichia coli K-12 (t 0.615 0.564 0.4 1.2e-26
UNIPROTKB|Q5VSB7255 LOC_Os06g05110 "Superoxide dis 0.858 0.596 0.378 4e-26
TIGR_CMR|SPO_2340199 SPO_2340 "superoxide dismutase 0.638 0.567 0.401 1e-25
TIGR_CMR|CBU_1708193 CBU_1708 "superoxide dismutase 0.615 0.564 0.408 3e-24
TIGR_CMR|APH_0371206 APH_0371 "Fe superoxide dismut 0.909 0.781 0.392 1.1e-23
TIGR_CMR|NSE_0843205 NSE_0843 "superoxide dismutase 0.864 0.746 0.374 2.1e-22
TAIR|locus:2176167 FSD2 "AT5G51100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 518 (187.4 bits), Expect = 9.5e-50, P = 9.5e-50
 Identities = 96/169 (56%), Positives = 113/169 (66%)

Query:     1 MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAW 60
             MS++TL++HWGKHH+ YV+NLNKQI+GT+L D  SLE+VV+ SYNKG++LPAFNNAAQAW
Sbjct:    69 MSRETLDYHWGKHHKTYVENLNKQILGTDL-DALSLEEVVLLSYNKGNMLPAFNNAAQAW 127

Query:    61 NHDFFWXXXXXXXXXXXXXXXXXLIERDFGSXXXXXXXXXXXXXTQFGSGWAWLVYKXXX 120
             NH+FFW                 LIERDFGS             + FGSGW WL YK   
Sbjct:   128 NHEFFWESIQPGGGGKPTGELLRLIERDFGSFEEFLERFKSAAASNFGSGWTWLAYKANR 187

Query:   121 XXXXXXXXXPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIY 169
                      PLP E+DK L++VKTPNAVNPLVWDYSPLLTID WE   Y
Sbjct:   188 LDVANAVN-PLPKEEDKKLVIVKTPNAVNPLVWDYSPLLTIDTWEHAYY 235
GO:0004784 "superoxide dismutase activity" evidence=ISS;IDA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009295 "nucleoid" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009579 "thylakoid" evidence=IDA
GO:0042644 "chloroplast nucleoid" evidence=IDA
GO:0055114 "oxidation-reduction process" evidence=IDA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006399 "tRNA metabolic process" evidence=RCA
GO:0009658 "chloroplast organization" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0009411 "response to UV" evidence=IEP
TAIR|locus:2117273 FSD1 "Fe superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166953 FSD3 "Fe superoxide dismutase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C4B8 sodB "Superoxide dismutase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|P0AGD3 sodB [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VSB7 LOC_Os06g05110 "Superoxide dismutase [Fe] 2, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2340 SPO_2340 "superoxide dismutase, Fe" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1708 CBU_1708 "superoxide dismutase (fe)" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0371 APH_0371 "Fe superoxide dismutase" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0843 NSE_0843 "superoxide dismutase, Fe" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LU64SODF2_ARATH1, ., 1, 5, ., 1, ., 10.76330.94350.5475yesno
Q8YSZ1SODF_NOSS11, ., 1, 5, ., 1, ., 10.52070.84740.75yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.10.946
3rd Layer1.15.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
FSD2
FSD2 (FE SUPEROXIDE DISMUTASE 2); superoxide dismutase; Fe superoxide dismutase whose mRNA levels are increased in response to exposure to UV-B. ; Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity) (305 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
CAT1
CAT1 (CATALASE 1); catalase; Catalyzes the reduction of hydrogen peroxide using heme group as c [...] (492 aa)
     •• 0.994
AT4G35090
CAT2 (CATALASE 2); catalase; Encodes a peroxisomal catalase, highly expressed in bolts and leav [...] (492 aa)
     •• 0.990
APX1
APX1 (ascorbate peroxidase 1); L-ascorbate peroxidase; Encodes a cytosolic ascorbate peroxidase [...] (250 aa)
      • 0.968
GR
GR (GLUTATHIONE REDUCTASE); ATP binding / glutathione-disulfide reductase; Encodes glutathione [...] (565 aa)
      • 0.937
MDHAR
MDHAR (MONODEHYDROASCORBATE REDUCTASE); monodehydroascorbate reductase (NADH); Encodes a member [...] (441 aa)
      • 0.867
ATGPX2
ATGPX2 (GLUTATHIONE PEROXIDASE 2); glutathione peroxidase; glutathione peroxidase GPx ; May con [...] (169 aa)
      • 0.825
AT1G63460
glutathione peroxidase, putative; glutathione peroxidase, putative; FUNCTIONS IN- glutathione p [...] (167 aa)
      • 0.821
DHAR2
DHAR2 (DEHYDROASCORBATE REDUCTASE 2); glutathione binding / glutathione dehydrogenase (ascorbat [...] (213 aa)
      • 0.821
DHAR3
DHAR3 (dehydroascorbate reductase 1); glutathione dehydrogenase (ascorbate); The protein underg [...] (258 aa)
      • 0.788
AT1G31540
disease resistance protein (TIR-NBS-LRR class), putative; disease resistance protein (TIR-NBS-L [...] (1161 aa)
      • 0.788

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
PLN02685299 PLN02685, PLN02685, iron superoxide dismutase 1e-110
PLN02184212 PLN02184, PLN02184, superoxide dismutase [Fe] 8e-75
COG0605204 COG0605, SodA, Superoxide dismutase [Inorganic ion 9e-63
PLN02622261 PLN02622, PLN02622, iron superoxide dismutase 1e-62
PRK10543193 PRK10543, PRK10543, superoxide dismutase; Provisio 1e-45
PTZ00078193 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Pro 2e-43
pfam02777106 pfam02777, Sod_Fe_C, Iron/manganese superoxide dis 1e-30
PRK10925206 PRK10925, PRK10925, superoxide dismutase; Provisio 2e-27
pfam0008182 pfam00081, Sod_Fe_N, Iron/manganese superoxide dis 1e-23
PLN02471231 PLN02471, PLN02471, superoxide dismutase [Mn] 6e-19
>gnl|CDD|215369 PLN02685, PLN02685, iron superoxide dismutase Back     alignment and domain information 
 Score =  316 bits (811), Expect = e-110
 Identities = 143/169 (84%), Positives = 156/169 (92%), Gaps = 2/169 (1%)

Query: 1   MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAW 60
           MS++TLE+HWGKHHRAYVDNLNKQIVGTEL DG SLEDVV+ +YNKGD+LPAFNNAAQAW
Sbjct: 63  MSRETLEYHWGKHHRAYVDNLNKQIVGTEL-DGMSLEDVVLITYNKGDMLPAFNNAAQAW 121

Query: 61  NHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANN 120
           NH+FFWESMKPGGGGKPSGELL LIERDFGSFE+F+EEFK+AAATQFGSGWAWL YKA N
Sbjct: 122 NHEFFWESMKPGGGGKPSGELLQLIERDFGSFERFVEEFKSAAATQFGSGWAWLAYKA-N 180

Query: 121 RADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIY 169
           R DV NAVNP PSE+DK L+VVK+PNAVNPLVWDYSPLLTIDVWE   Y
Sbjct: 181 RLDVGNAVNPCPSEEDKKLVVVKSPNAVNPLVWDYSPLLTIDVWEHAYY 229

Length = 299
>gnl|CDD|177838 PLN02184, PLN02184, superoxide dismutase [Fe] Back     alignment and domain information
>gnl|CDD|223678 COG0605, SodA, Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|166263 PLN02622, PLN02622, iron superoxide dismutase Back     alignment and domain information
>gnl|CDD|182534 PRK10543, PRK10543, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|185432 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Provisional Back     alignment and domain information
>gnl|CDD|202388 pfam02777, Sod_Fe_C, Iron/manganese superoxide dismutases, C-terminal domain Back     alignment and domain information
>gnl|CDD|182843 PRK10925, PRK10925, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|200985 pfam00081, Sod_Fe_N, Iron/manganese superoxide dismutases, alpha-hairpin domain Back     alignment and domain information
>gnl|CDD|215262 PLN02471, PLN02471, superoxide dismutase [Mn] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
COG0605204 SodA Superoxide dismutase [Inorganic ion transport 100.0
PLN02685299 iron superoxide dismutase 100.0
PLN02184212 superoxide dismutase [Fe] 100.0
PRK10543193 superoxide dismutase; Provisional 100.0
PLN02622261 iron superoxide dismutase 100.0
PRK10925206 superoxide dismutase; Provisional 100.0
PTZ00078193 Superoxide dismutase [Fe]; Provisional 100.0
PLN02471231 superoxide dismutase [Mn] 100.0
KOG0876234 consensus Manganese superoxide dismutase [Inorgani 100.0
PF02777106 Sod_Fe_C: Iron/manganese superoxide dismutases, C- 100.0
PF0008182 Sod_Fe_N: Iron/manganese superoxide dismutases, al 99.88
>COG0605 SodA Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.5e-62  Score=391.86  Aligned_cols=154  Identities=51%  Similarity=0.916  Sum_probs=142.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHhcCCc--cCCCCChHHHHHHhhcCCCchhhhccchHhHhhHHHhhcccCC-CCCCC
Q 030435            1 MSKDTLEFHWGKHHRAYVDNLNKQIVGTE--LGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPG-GGGKP   77 (177)
Q Consensus         1 iS~~~~~~H~~khh~~yV~~LN~~~~~~~--~~~~~~~~~li~~~~~~~~~~~~fn~ag~~~NH~~fw~~L~p~-~~~~p   77 (177)
                      ||++||++||+||||+||++||+++++.+  + +.++++++++.....+.  .++|++||++||+|||++|+|. +++.|
T Consensus        20 is~et~~~Hh~kHH~~YV~~lN~~~~~~~~~~-~~~~~e~~~~~~~~~~~--~~~nn~~gh~NH~~fw~~l~p~~gg~~p   96 (204)
T COG0605          20 ISAETMELHHDKHHQTYVNNLNAALEGLTEEL-EDLSLEEIIKKLAGLPA--ALFNNAGGHWNHSLFWENLSPGGGGGKP   96 (204)
T ss_pred             cCHHHHHHHHHHHHHHHHHHHHHHHhhhhhhc-ccCCHHHHHHHHhcccH--HHHhcchhhhhHHHHHhhcCCCCCCCCC
Confidence            79999999999999999999999999843  5 88899988876644332  5899999999999999999995 78899


Q ss_pred             cHHHHHHHHhhcCCHHHHHHHHHHHHhcCCCccEEEEEEecCccccccccCCCCCCCCCCceeEEeecCCCCCCCCCCee
Q 030435           78 SGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSP  157 (177)
Q Consensus        78 ~~~L~~~I~~~FGS~e~fk~~f~~~a~~~~GsGW~WLv~~~~~~l~~~~~~~~~~~~~~~~L~i~~t~n~~~p~~~~~~P  157 (177)
                      +|+|+++|+++|||+|+||++|.++|.++|||||+|||+|+                 .++|.|++|+||++|++.+.+|
T Consensus        97 ~g~L~~aI~~~FGS~d~fk~~f~~aa~~~fGsGWawLv~~~-----------------~~kL~i~~t~n~~~p~~~~~~P  159 (204)
T COG0605          97 TGELAAAINKDFGSFDKFKEEFTAAAASVFGSGWAWLVYDP-----------------DGKLEIVSTYNQDTPLMWGSVP  159 (204)
T ss_pred             CHHHHHHHHHHhcCHHHHHHHHHHHHhhCCCCceEEEEECC-----------------CCcEEEEeccCCCCcccCCCCc
Confidence            99999999999999999999999999999999999999994                 4699999999999999999999


Q ss_pred             eEEeccchhhhhhhhcc
Q 030435          158 LLTIDVWEVNIYHCVLV  174 (177)
Q Consensus       158 lL~iDvWEHAYyld~~~  174 (177)
                      ||||||||||||+||+.
T Consensus       160 iL~lDvWEHAYYldY~N  176 (204)
T COG0605         160 LLGLDVWEHAYYLDYGN  176 (204)
T ss_pred             eEEecchHHHHHHHhcc
Confidence            99999999999999986

>PLN02685 iron superoxide dismutase Back     alignment and domain information
>PLN02184 superoxide dismutase [Fe] Back     alignment and domain information
>PRK10543 superoxide dismutase; Provisional Back     alignment and domain information
>PLN02622 iron superoxide dismutase Back     alignment and domain information
>PRK10925 superoxide dismutase; Provisional Back     alignment and domain information
>PTZ00078 Superoxide dismutase [Fe]; Provisional Back     alignment and domain information
>PLN02471 superoxide dismutase [Mn] Back     alignment and domain information
>KOG0876 consensus Manganese superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02777 Sod_Fe_C: Iron/manganese superoxide dismutases, C-terminal domain Note: SCOP classifies the two domains separately Back     alignment and domain information
>PF00081 Sod_Fe_N: Iron/manganese superoxide dismutases, alpha-hairpin domain Note: SCOP classifies the two domains separately Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
1unf_X238 The Crystal Structure Of The Eukaryotic Fesod From 3e-48
1my6_A199 The 1.6 A Structure Of Fe-superoxide Dismutase From 2e-29
1isa_A192 Structure-Function In E. Coli Iron Superoxide Dismu 1e-23
2nyb_A192 Crystal Structure Of E.Coli Iron Superoxide Dismuta 3e-23
3js4_A227 Crystal Structure Of Iron Superoxide Dismutase From 3e-23
1za5_A192 Q69h-Fesod Length = 192 4e-23
3h1s_A195 Crystal Structure Of Superoxide Dismutase From Fran 2e-22
3tqj_A210 Structure Of The Superoxide Dismutase (Fe) (Sodb) F 3e-21
1dt0_A197 Cloning, Sequence, And Crystallographic Structure O 1e-20
3sdp_A195 The 2.1 Angstroms Resolution Structure Of Iron Supe 2e-20
1ues_A191 Crystal Structure Of Porphyromonas Gingivalis Sod L 4e-19
1qnn_A191 Cambialistic Superoxide Dismutase From Porphyromona 2e-18
3lio_A192 X-Ray Structure Of The Iron Superoxide Dismutase Fr 2e-18
2w7w_A194 The Crystal Structure Of Iron Superoxide Dismutase 2e-18
4f2n_A230 Crystal Structure Of Iron Superoxide Dismutase From 2e-17
2cw2_A226 Crystal Structure Of Superoxide Dismutase From P. M 4e-17
2a03_A206 Superoxide Dismutase Protein From Plasmodium Berghe 5e-17
4h3e_A241 Crystal Structure Of A Putative Iron Superoxide Dis 1e-16
3cei_A213 Crystal Structure Of Superoxide Dismutase From Heli 2e-16
2bpi_A206 Stucture Of Iron Dependent Superoxide Dismutase Fro 8e-16
2goj_A197 The Crystal Structure Of The Enzyme Fe-Superoxide D 1e-15
2awp_A198 Crystal Structure Of Plasmodium Knowlesi Structure 3e-15
3esf_A197 Crystal Structure Of The Enzyme Fe-Superoxide Dismu 1e-14
1xuq_A212 Crystal Structure Of Soda-1 (Ba4499) From Bacillus 8e-14
1y67_A229 Crystal Structure Of Manganese Superoxide Dismutase 5e-13
3kky_A211 Structure Of Manganese Superoxide Dismutase From De 5e-13
2cdy_A231 Manganese Superoxide Dismutase (Mn-Sod) From Deinoc 6e-13
3tjt_A208 Crystal Structure Analysis Of The Superoxide Dismut 8e-13
2rcv_A202 Crystal Structure Of The Bacillus Subtilis Superoxi 2e-12
2gpc_A194 The Crystal Structure Of The Enzyme Fe-Superoxide D 2e-12
3mds_A203 Maganese Superoxide Dismutase From Thermus Thermoph 9e-12
1vew_A205 Manganese Superoxide Dismutase From Escherichia Col 3e-11
1en6_A205 Crystal Structure Analysis Of The E. Coli Manganese 4e-11
1i0h_A205 Crystal Structure Of The E. Coli Manganese Superoxi 4e-11
1en4_A205 Crystal Structure Analysis Of The E. Coli Manganese 4e-11
1en5_A205 Crystal Structure Analysis Of The E. Coli Manganese 7e-11
1jr9_A202 Crystal Structure Of Manganese Superoxide Dismutase 2e-10
1xre_A217 Crystal Structure Of Soda-2 (Ba5696) From Bacillus 2e-10
1i08_A205 Crystal Structure Analysis Of The H30a Mutant Of Ma 3e-10
1gv3_A248 The 2.0 Angstrom Resolution Structure Of The Cataly 1e-09
2cw3_A280 X-Ray Structure Of Pmsod2, Superoxide Dismutase Fro 7e-08
1em1_A198 X-Ray Crystal Structure For Human Manganese Superox 5e-07
1var_A198 Mitochondrial Manganese Superoxide Dismutase Varian 8e-07
3dc5_A195 Crystal Structure Of A Manganese Superoxide Dismuta 1e-06
2qkc_A196 Structural And Kinetic Study Of The Differences Bet 2e-06
2qka_A196 Structural And Kinetic Study Of The Differences Bet 2e-06
1n0j_A199 The Structure Of Human Mitochondrial Mn3+ Superoxid 2e-06
1msd_A198 Comparison Of The Crystal Structures Of Genetically 2e-06
1pl4_A198 Crystal Structure Of Human Mnsod Y166f Mutant Lengt 2e-06
1qnm_A198 Human Manganese Superoxide Dismutase Mutant Q143n L 2e-06
1xil_A198 Hydrogen Bonding In Human Manganese Superoxide Dism 3e-06
1ap5_A198 Tyr34->phe Mutant Of Human Mitochondrial Manganese 4e-06
3c3t_A198 Role Of A Glutamate Bridge Spanning The Dimeric Int 5e-06
1zte_A198 Contribution To Structure And Catalysis Of Tyrosine 5e-06
1xdc_A198 Hydrogen Bonding In Human Manganese Superoxide Dism 7e-06
3c3s_A198 Role Of A Glutamate Bridge Spanning The Dimeric Int 8e-06
1luw_A198 Catalytic And Structural Effects Of Amino-Acid Subs 1e-05
2adp_A198 Nitrated Human Manganese Superoxide Dismutase Lengt 1e-05
2gds_A198 Interrupting The Hydrogen Bonding Network At The Ac 1e-05
1zuq_A198 Contribution To Structure And Catalysis Of Tyrosine 1e-05
1zsp_A198 Contribution To Structure And Catalysis Of Tyrosine 1e-05
1pm9_A198 Crystal Structure Of Human Mnsod H30n, Y166f Mutant 1e-05
2p4k_A198 Contribution To Structure And Catalysis Of Tyrosine 1e-05
1ja8_A198 Kinetic Analysis Of Product Inhibition In Human Man 2e-05
1szx_A198 Role Of Hydrogen Bonding In The Active Site Of Huma 3e-05
1n0n_A199 Catalytic And Structural Effects Of Amino-Acid Subs 3e-05
3dc6_A198 Crystal Structure Of A Manganese Superoxide Dismuta 3e-05
1ar4_A201 X-Ray Structure Analysis Of The Cambialistic Supero 9e-04
>pdb|1UNF|X Chain X, The Crystal Structure Of The Eukaryotic Fesod From Vigna Unguiculata Suggests A New Enzymatic Mechanism Length = 238 Back     alignment and structure 
Iteration: 1

 Score =  187 bits (474), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 111/170 (65%), Gaps = 3/170 (1%)
Query: 1   MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAW 60
           MS+ TLEFHWGKHHR YV+NL KQ+VGTEL DGKSLE++++ +YNKGD+LPAFNNAAQ W
Sbjct: 35  MSQQTLEFHWGKHHRTYVENLKKQVVGTEL-DGKSLEEIIVTAYNKGDILPAFNNAAQVW 93
Query: 61  NHDFFWXXXXXXXXXXXXXXXXXLIERDFGSXXXXXXXXXXXXXTQFGSGWAWLVYKXXX 120
           NHDFFW                 LIERDFGS             TQFGSGWAWL YK   
Sbjct: 94  NHDFFWECMKPGGGGKPSGELLELIERDFGSFEKFLDEFKAAAATQFGSGWAWLAYKASK 153
Query: 121 XXXXXXXXXPLPSEKDKSLLVVKTPNAVNPLVW-DYSPLLTIDVWEVNIY 169
                    P  +++D  L+V+K+PNAVNPLVW  Y PLLTIDVWE   Y
Sbjct: 154 LDGENAANPP-SADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVWEHAYY 202
>pdb|1MY6|A Chain A, The 1.6 A Structure Of Fe-superoxide Dismutase From The Thermophilic Cyanobacterium Thermosynechococcus Elongatus : Correlation Of Epr And Structural Characteristics Length = 199 Back     alignment and structure
>pdb|1ISA|A Chain A, Structure-Function In E. Coli Iron Superoxide Dismutase: Comparisons With The Manganese Enzyme From T. Thermophilus Length = 192 Back     alignment and structure
>pdb|2NYB|A Chain A, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e At 1.1 Angstrom Resolution Length = 192 Back     alignment and structure
>pdb|3JS4|A Chain A, Crystal Structure Of Iron Superoxide Dismutase From Anaplasma Phagocytophilum Length = 227 Back     alignment and structure
>pdb|1ZA5|A Chain A, Q69h-Fesod Length = 192 Back     alignment and structure
>pdb|3H1S|A Chain A, Crystal Structure Of Superoxide Dismutase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 195 Back     alignment and structure
>pdb|3TQJ|A Chain A, Structure Of The Superoxide Dismutase (Fe) (Sodb) From Coxiella Burnetii Length = 210 Back     alignment and structure
>pdb|1DT0|A Chain A, Cloning, Sequence, And Crystallographic Structure Of Recombinant Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 197 Back     alignment and structure
>pdb|3SDP|A Chain A, The 2.1 Angstroms Resolution Structure Of Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 195 Back     alignment and structure
>pdb|1UES|A Chain A, Crystal Structure Of Porphyromonas Gingivalis Sod Length = 191 Back     alignment and structure
>pdb|1QNN|A Chain A, Cambialistic Superoxide Dismutase From Porphyromonas Gingivalis Length = 191 Back     alignment and structure
>pdb|3LIO|A Chain A, X-Ray Structure Of The Iron Superoxide Dismutase From Pseudoalteromonas Haloplanktis (Crystal Form I) Length = 192 Back     alignment and structure
>pdb|2W7W|A Chain A, The Crystal Structure Of Iron Superoxide Dismutase From Aliivibrio Salmonicida. Length = 194 Back     alignment and structure
>pdb|4F2N|A Chain A, Crystal Structure Of Iron Superoxide Dismutase From Leishmania Major Length = 230 Back     alignment and structure
>pdb|2CW2|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Marinus Length = 226 Back     alignment and structure
>pdb|2A03|A Chain A, Superoxide Dismutase Protein From Plasmodium Berghei Length = 206 Back     alignment and structure
>pdb|4H3E|A Chain A, Crystal Structure Of A Putative Iron Superoxide Dismutase From Trypanosoma Cruzi Bound To Iron Length = 241 Back     alignment and structure
>pdb|3CEI|A Chain A, Crystal Structure Of Superoxide Dismutase From Helicobacter Pylori Length = 213 Back     alignment and structure
>pdb|2BPI|A Chain A, Stucture Of Iron Dependent Superoxide Dismutase From P. Falciparum. Length = 206 Back     alignment and structure
>pdb|2GOJ|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Plasmodium Falciparum Length = 197 Back     alignment and structure
>pdb|2AWP|A Chain A, Crystal Structure Of Plasmodium Knowlesi Structure Of Iron Super-Oxide Dismutase Length = 198 Back     alignment and structure
>pdb|3ESF|A Chain A, Crystal Structure Of The Enzyme Fe-Superoxide Dismutase Tbsodb2 From Trypanosoma Brucei Length = 197 Back     alignment and structure
>pdb|1XUQ|A Chain A, Crystal Structure Of Soda-1 (Ba4499) From Bacillus Anthracis At 1.8a Resolution. Length = 212 Back     alignment and structure
>pdb|1Y67|A Chain A, Crystal Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans Length = 229 Back     alignment and structure
>pdb|3KKY|A Chain A, Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans In The Orthorhombic Space Group P212121: A Case Study Of Mistaken Identity Length = 211 Back     alignment and structure
>pdb|2CDY|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus Radiodurans Length = 231 Back     alignment and structure
>pdb|3TJT|A Chain A, Crystal Structure Analysis Of The Superoxide Dismutase From Clostridium Difficile Length = 208 Back     alignment and structure
>pdb|2RCV|A Chain A, Crystal Structure Of The Bacillus Subtilis Superoxide Dismutase Length = 202 Back     alignment and structure
>pdb|2GPC|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Trypanosoma Cruzi Length = 194 Back     alignment and structure
>pdb|3MDS|A Chain A, Maganese Superoxide Dismutase From Thermus Thermophilus Length = 203 Back     alignment and structure
>pdb|1VEW|A Chain A, Manganese Superoxide Dismutase From Escherichia Coli Length = 205 Back     alignment and structure
>pdb|1EN6|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146l Mutant Length = 205 Back     alignment and structure
>pdb|1I0H|A Chain A, Crystal Structure Of The E. Coli Manganese Superoxide Dismutase Mutant Y174f At 1.35 Angstroms Resolution. Length = 205 Back     alignment and structure
>pdb|1EN4|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146h Mutant Length = 205 Back     alignment and structure
>pdb|1EN5|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Y34f Mutant Length = 205 Back     alignment and structure
>pdb|1JR9|A Chain A, Crystal Structure Of Manganese Superoxide Dismutases From Bacillus Halodenitrificans Length = 202 Back     alignment and structure
>pdb|1XRE|A Chain A, Crystal Structure Of Soda-2 (Ba5696) From Bacillus Anthracis At 1.8a Resolution. Length = 217 Back     alignment and structure
>pdb|1I08|A Chain A, Crystal Structure Analysis Of The H30a Mutant Of Manganese Superoxide Dismutase From E. Coli Length = 205 Back     alignment and structure
>pdb|1GV3|A Chain A, The 2.0 Angstrom Resolution Structure Of The Catalytic Portion Of A Cyanobacterial Membrane-Bound Manganese Superoxide Dismutase Length = 248 Back     alignment and structure
>pdb|2CW3|A Chain A, X-Ray Structure Of Pmsod2, Superoxide Dismutase From Perkinsus Marinus Length = 280 Back     alignment and structure
>pdb|1EM1|A Chain A, X-Ray Crystal Structure For Human Manganese Superoxide Dismutase, Q143a Length = 198 Back     alignment and structure
>pdb|1VAR|A Chain A, Mitochondrial Manganese Superoxide Dismutase Variant With Ile 58 Replaced By Thr Length = 198 Back     alignment and structure
>pdb|3DC5|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 195 Back     alignment and structure
>pdb|2QKC|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>pdb|2QKA|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>pdb|1N0J|A Chain A, The Structure Of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals A Novel Tetrameric Interface Of Two 4-Helix Bundles Length = 199 Back     alignment and structure
>pdb|1MSD|A Chain A, Comparison Of The Crystal Structures Of Genetically Engineered Human Manganese Superoxide Dismutase And Manganese Superoxide Dismutase From Thermus Thermophilus. Differences In Dimer-Dimer Interactions. Length = 198 Back     alignment and structure
>pdb|1PL4|A Chain A, Crystal Structure Of Human Mnsod Y166f Mutant Length = 198 Back     alignment and structure
>pdb|1QNM|A Chain A, Human Manganese Superoxide Dismutase Mutant Q143n Length = 198 Back     alignment and structure
>pdb|1XIL|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3- Fluorotyrosine Length = 198 Back     alignment and structure
>pdb|1AP5|A Chain A, Tyr34->phe Mutant Of Human Mitochondrial Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|3C3T|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1ZTE|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Suerpoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1XDC|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3- Fluorotyrosine Length = 198 Back     alignment and structure
>pdb|3C3S|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1LUW|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His 30 In Human Manganese Superoxide Dismutase: Insertion Of Val Cgamma Into The Substrate Access Channel Length = 198 Back     alignment and structure
>pdb|2ADP|A Chain A, Nitrated Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|2GDS|A Chain A, Interrupting The Hydrogen Bonding Network At The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1ZUQ|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1ZSP|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1PM9|A Chain A, Crystal Structure Of Human Mnsod H30n, Y166f Mutant Length = 198 Back     alignment and structure
>pdb|2P4K|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1JA8|A Chain A, Kinetic Analysis Of Product Inhibition In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1SZX|A Chain A, Role Of Hydrogen Bonding In The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1N0N|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His30 In Human Manganese Superoxide Dismutase Length = 199 Back     alignment and structure
>pdb|3DC6|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 198 Back     alignment and structure
>pdb|1AR4|A Chain A, X-Ray Structure Analysis Of The Cambialistic Superoxide Dismutase From Propionibacterium Shermanii Active With Fe Or Mn Length = 201 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
1unf_X238 Iron superoxide dismutase; oxidoreductase, eukaryo 9e-93
1my6_A199 Iron (III) superoxide dismutase; iron speroxide di 7e-85
3js4_A227 Superoxide dismutase; niaid, ssgcid, seattle struc 2e-82
2nyb_A192 Superoxide dismutase [FE]; iron superoxide dismuta 1e-80
1uer_A191 SOD, superoxide dismutase; metal-specific, cambial 3e-80
3tqj_A210 Superoxide dismutase [FE]; oxidoreductase; 2.00A { 5e-80
1dt0_A197 Superoxide dismutase; pseudomonas ovalis, oxidored 6e-80
3lio_A192 Iron superoxide dismutase; cold adaptation, flexib 4e-79
2awp_A198 Iron super-oxide dismutase; structural genomics, s 5e-79
4f2n_A230 Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em 3e-78
3h1s_A195 Superoxide dismutase; SOBD, csgid, oxidoreductase, 1e-77
2cw2_A226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A 3e-77
3cei_A213 Superoxide dismutase; oxidoreductase; 2.40A {Helic 4e-77
2gpc_A194 Iron superoxide dismutase; alpha+beta structure, o 4e-76
2rcv_A202 Superoxide dismutase [MN]; bacillus subtilis,super 1e-72
2cw3_A280 Pmsod2, iron superoxide dismutase; oxidoreductase; 1e-72
1gv3_A248 Manganese superoxide dismutase; anabaena PCC 7120, 2e-71
3kky_A211 Mnsod, superoxide dismutase [MN]; manganese, ME bi 1e-69
1xre_A217 SODA-2, superoxide dismutase; spine, oxidoreductas 4e-69
1mng_A203 Manganese superoxide dismutase; oxidoreductase(sup 7e-67
1ix9_A205 Mnsod, superoxide dismutase; manganese superoxide 3e-63
1coj_A212 Protein (superoxide dismutase); oxidoreductase; 1. 3e-61
4ffk_A223 Superoxide dismutase; oxidoreductase, superoxide a 1e-60
1ma1_A205 Superoxide dismutase; metal specificity, azide inh 3e-60
1b06_A210 Protein (superoxide dismutase); oxidoreductase; 2. 4e-60
1ids_A207 Iron superoxide dismutase; 2.00A {Mycobacterium tu 3e-59
3ak2_A214 Superoxide dismutase [MN/FE]; cambialistic, oxidor 6e-57
3rn4_A215 Superoxide dismutase [MN], mitochondrial; mitochon 7e-57
1bsm_A201 Superoxide dismutase; oxidoreductase; 1.35A {Propi 8e-57
1pl4_A198 Superoxide dismutase [MN], mitochondrial; oxidored 4e-56
3dc5_A195 Superoxide dismutase [MN] 2; alpha hairpin N domai 3e-53
3qvn_A206 Manganese-containing superoxide dismutase; Mn supe 1e-52
1kkc_A221 Mnsod, manganese superoxide dismutase; homotetrame 3e-51
>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Length = 238 Back     alignment and structure
 Score =  268 bits (688), Expect = 9e-93
 Identities = 127/166 (76%), Positives = 145/166 (87%), Gaps = 3/166 (1%)

Query: 1   MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAW 60
           MS+ TLEFHWGKHHR YV+NL KQ+VGTEL DGKSLE++++ +YNKGD+LPAFNNAAQ W
Sbjct: 35  MSQQTLEFHWGKHHRTYVENLKKQVVGTEL-DGKSLEEIIVTAYNKGDILPAFNNAAQVW 93

Query: 61  NHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANN 120
           NHDFFWE MKPGGGGKPSGELL LIERDFGSFEKFL+EFKAAAATQFGSGWAWL YKA +
Sbjct: 94  NHDFFWECMKPGGGGKPSGELLELIERDFGSFEKFLDEFKAAAATQFGSGWAWLAYKA-S 152

Query: 121 RADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWD-YSPLLTIDVWE 165
           + D  NA NP  +++D  L+V+K+PNAVNPLVW  Y PLLTIDVWE
Sbjct: 153 KLDGENAANPPSADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVWE 198
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Length = 199 Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} Length = 227 Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Length = 192 Back     alignment and structure
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Length = 191 Back     alignment and structure
>3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} Length = 210 Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 Length = 197 Back     alignment and structure
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Length = 192 Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Length = 198 Back     alignment and structure
>4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} Length = 230 Back     alignment and structure
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} Length = 195 Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Length = 226 Back     alignment and structure
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Length = 213 Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Length = 194 Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Length = 202 Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Length = 280 Back     alignment and structure
>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Length = 248 Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Length = 211 Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Length = 217 Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Length = 203 Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A Length = 205 Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Length = 212 Back     alignment and structure
>4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} Length = 223 Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Length = 205 Back     alignment and structure
>1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Length = 210 Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Length = 207 Back     alignment and structure
>3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A Length = 214 Back     alignment and structure
>3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* Length = 215 Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Length = 201 Back     alignment and structure
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Length = 198 Back     alignment and structure
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Length = 195 Back     alignment and structure
>3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} Length = 206 Back     alignment and structure
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Length = 221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
1my6_A199 Iron (III) superoxide dismutase; iron speroxide di 100.0
3lio_A192 Iron superoxide dismutase; cold adaptation, flexib 100.0
3js4_A227 Superoxide dismutase; niaid, ssgcid, seattle struc 100.0
1dt0_A197 Superoxide dismutase; pseudomonas ovalis, oxidored 100.0
1uer_A191 SOD, superoxide dismutase; metal-specific, cambial 100.0
1mng_A203 Manganese superoxide dismutase; oxidoreductase(sup 100.0
2nyb_A192 Superoxide dismutase [FE]; iron superoxide dismuta 100.0
3h1s_A195 Superoxide dismutase; SOBD, csgid, oxidoreductase, 100.0
3tqj_A210 Superoxide dismutase [FE]; oxidoreductase; 2.00A { 100.0
2gpc_A194 Iron superoxide dismutase; alpha+beta structure, o 100.0
1unf_X238 Iron superoxide dismutase; oxidoreductase, eukaryo 100.0
2awp_A198 Iron super-oxide dismutase; structural genomics, s 100.0
2rcv_A202 Superoxide dismutase [MN]; bacillus subtilis,super 100.0
3kky_A211 Mnsod, superoxide dismutase [MN]; manganese, ME bi 100.0
1xre_A217 SODA-2, superoxide dismutase; spine, oxidoreductas 100.0
3cei_A213 Superoxide dismutase; oxidoreductase; 2.40A {Helic 100.0
1gv3_A248 Manganese superoxide dismutase; anabaena PCC 7120, 100.0
4f2n_A230 Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em 100.0
1ix9_A205 Mnsod, superoxide dismutase; manganese superoxide 100.0
4h3e_A241 Fesod, superoxide dismutase; structural genomics, 100.0
2cw2_A226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A 100.0
3tjt_A208 Superoxide dismutase; metal ION binding, rossmann 100.0
1ids_A207 Iron superoxide dismutase; 2.00A {Mycobacterium tu 100.0
4ffk_A223 Superoxide dismutase; oxidoreductase, superoxide a 100.0
1bsm_A201 Superoxide dismutase; oxidoreductase; 1.35A {Propi 100.0
3dc5_A195 Superoxide dismutase [MN] 2; alpha hairpin N domai 100.0
1b06_A210 Protein (superoxide dismutase); oxidoreductase; 2. 100.0
1pl4_A198 Superoxide dismutase [MN], mitochondrial; oxidored 100.0
1ma1_A205 Superoxide dismutase; metal specificity, azide inh 100.0
3ak2_A214 Superoxide dismutase [MN/FE]; cambialistic, oxidor 100.0
3rn4_A215 Superoxide dismutase [MN], mitochondrial; mitochon 100.0
2cw3_A280 Pmsod2, iron superoxide dismutase; oxidoreductase; 100.0
3qvn_A206 Manganese-containing superoxide dismutase; Mn supe 100.0
1kkc_A221 Mnsod, manganese superoxide dismutase; homotetrame 100.0
1coj_A212 Protein (superoxide dismutase); oxidoreductase; 1. 100.0
2jb0_B131 Colicin E7; hydrolase/inhibitor, hydrolase/inhibit 81.77
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
Probab=100.00  E-value=1.2e-64  Score=406.01  Aligned_cols=155  Identities=58%  Similarity=0.973  Sum_probs=145.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHhcCCccCCCCChHHHHHHhhcCCCchhhhccchHhHhhHHHhhcccCCCCCCCcHH
Q 030435            1 MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGE   80 (177)
Q Consensus         1 iS~~~~~~H~~khh~~yV~~LN~~~~~~~~~~~~~~~~li~~~~~~~~~~~~fn~ag~~~NH~~fw~~L~p~~~~~p~~~   80 (177)
                      ||++||++||+||||+||+|||++++++++ +++++++++......+..+.+||+|||++||+|||+||+|+++++|+++
T Consensus        19 is~~tm~~Hh~kHh~~YV~~LN~~~~~~~~-~~~~~~~ii~~~~~~~~~~~i~nn~gg~~NH~~fw~~L~P~gg~~P~g~   97 (199)
T 1my6_A           19 MSAKTLEFHYGKHHKGYVDNLNKLTQDTEL-ADKSLEDVIRTTYGDAAKVGIFNNAAQVWNHTFFWNSLKPGGGGVPTGD   97 (199)
T ss_dssp             CCHHHHHHHHHTHHHHHHHHHHHHHTTSGG-GGSCHHHHHHHHTTCTTCHHHHHHHHHHHHHHHHHHTBCTTCCSCCCHH
T ss_pred             cCHHHHHHHHHHHHHHHHHHHHHHHcchhh-hcCCHHHHHHHhcccchhhhhhhHHHHHHHHHHHHHHhccCCCCCCCHH
Confidence            799999999999999999999999999888 8899999987765545556899999999999999999999877789999


Q ss_pred             HHHHHHhhcCCHHHHHHHHHHHHhcCCCccEEEEEEecCccccccccCCCCCCCCCCceeEEeecCCCCCCCCCCeeeEE
Q 030435           81 LLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLT  160 (177)
Q Consensus        81 L~~~I~~~FGS~e~fk~~f~~~a~~~~GsGW~WLv~~~~~~l~~~~~~~~~~~~~~~~L~i~~t~n~~~p~~~~~~PlL~  160 (177)
                      |+++|+++|||||+||++|+++|.++|||||+|||+|                  +++|.|++|+||++|++.|.+||||
T Consensus        98 L~~aI~~~FGS~d~fk~~f~~aa~~~fGSGW~WLv~~------------------~g~L~I~~t~n~~~p~~~g~~PlL~  159 (199)
T 1my6_A           98 VAARINSAFGSYDEFKAQFKNAAATQFGSGWAWLVLE------------------AGTLKVTKTANAENPLVHGQVPLLT  159 (199)
T ss_dssp             HHHHHHHHHSSHHHHHHHHHHHHHHCCSSEEEEEEEE------------------TTEEEEEEEETTCCGGGGTCEEEEE
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHhhCCCCeEEEEEEE------------------CCEEEEEeccCCCCCcccCCEeEEE
Confidence            9999999999999999999999999999999999998                  3689999999999999999999999


Q ss_pred             eccchhhhhhhhcc
Q 030435          161 IDVWEVNIYHCVLV  174 (177)
Q Consensus       161 iDvWEHAYyld~~~  174 (177)
                      ||||||||||||+-
T Consensus       160 iDvWEHAYyldY~n  173 (199)
T 1my6_A          160 IDVWEHAYYLDYQN  173 (199)
T ss_dssp             EECSGGGTHHHHTT
T ss_pred             EecchhhhHHHHCc
Confidence            99999999999974
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Back     alignment and structure
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} Back     alignment and structure
>3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Back     alignment and structure
>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Back     alignment and structure
>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A Back     alignment and structure
>4h3e_A Fesod, superoxide dismutase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Trypanosoma cruzi} Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Back     alignment and structure
>3tjt_A Superoxide dismutase; metal ION binding, rossmann fold, oxidoreductase; 1.80A {Clostridium difficile} Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Back     alignment and structure
>4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Back     alignment and structure
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Back     alignment and structure
>1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Back     alignment and structure
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A Back     alignment and structure
>3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* 4e4e_A* Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Back     alignment and structure
>3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} Back     alignment and structure
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>2jb0_B Colicin E7; hydrolase/inhibitor, hydrolase/inhibitor complex, zinc, toxin, plasmid, nuclease, hydrolase, antibiotic, H-N-H motif, bacteriocin; 1.91A {Escherichia coli} SCOP: d.4.1.1 PDB: 3fbd_A 2jaz_B 2jbg_B 3gkl_A 3gjn_B 1pt3_A 2ivh_A 1ujz_B 2erh_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d1unfx2134 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSO 4e-27
d1unfx191 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD 3e-24
d1my6a188 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) 3e-22
d1coja189 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) 5e-22
d1jr9a190 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) 1e-21
d1ix9a190 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) 6e-21
d1gv3a1102 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD 1e-20
d1mnga192 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) 4e-20
d1ma1a2113 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD 8e-20
d1uera184 a.2.11.1 (A:1-84) Cambialistic superoxide dismutas 9e-20
d2nyba182 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) 4e-19
d1my6a2110 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD 7e-19
d1p7ga192 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD 1e-18
d1mnga2111 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD 1e-18
d1gv3a2111 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSO 3e-18
d1wb8a2116 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD 8e-18
d1bsma186 a.2.11.1 (A:1-86) Cambialistic superoxide dismutas 1e-17
d1bsma2115 d.44.1.1 (A:87-201) Cambialistic superoxide dismut 2e-17
d1kkca184 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) 2e-17
d1p7ga2119 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSO 3e-17
d1ma1a188 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) 4e-17
d1jr9a2111 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD 6e-17
d1coja2122 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD 2e-16
d2nyba2110 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD 2e-16
d1dt0a2114 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD 2e-16
d1idsa2114 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD 2e-16
d2p4ka183 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) 2e-16
d1uera2107 d.44.1.1 (A:85-191) Cambialistic superoxide dismut 4e-16
d1wb8a189 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) 6e-16
d1idsa184 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) 1e-15
d2p4ka2115 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD 4e-15
d1y67a2116 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD 4e-15
d1kkca2116 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD 4e-15
d1ix9a2115 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD 7e-14
>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 134 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Fe,Mn superoxide dismutase (SOD), C-terminal domain
superfamily: Fe,Mn superoxide dismutase (SOD), C-terminal domain
family: Fe,Mn superoxide dismutase (SOD), C-terminal domain
domain: Fe superoxide dismutase (FeSOD)
species: Cowpea (Vigna unguiculata) [TaxId: 3917]

 Score = 97.5 bits (242), Expect = 4e-27
 Identities = 73/100 (73%), Positives = 81/100 (81%), Gaps = 2/100 (2%)

Query: 72  GGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPL 131
           GGGGKPSGELL LIERDFGSFEKFL+EFKAAAATQFGSGWAWL YKA+   D  NA NP 
Sbjct: 1   GGGGKPSGELLELIERDFGSFEKFLDEFKAAAATQFGSGWAWLAYKASKL-DGENAANPP 59

Query: 132 PSEKDKSLLVVKTPNAVNPLVWD-YSPLLTIDVWEVNIYH 170
            +++D  L+V+K+PNAVNPLVW  Y PLLTIDVWE   Y 
Sbjct: 60  SADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVWEHAYYL 99
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 91 Back     information, alignment and structure
>d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 88 Back     information, alignment and structure
>d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 89 Back     information, alignment and structure
>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 90 Back     information, alignment and structure
>d1ix9a1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 90 Back     information, alignment and structure
>d1gv3a1 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 102 Back     information, alignment and structure
>d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 92 Back     information, alignment and structure
>d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 113 Back     information, alignment and structure
>d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 84 Back     information, alignment and structure
>d2nyba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Length = 82 Back     information, alignment and structure
>d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 110 Back     information, alignment and structure
>d1p7ga1 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 92 Back     information, alignment and structure
>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 111 Back     information, alignment and structure
>d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 111 Back     information, alignment and structure
>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 116 Back     information, alignment and structure
>d1bsma1 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 86 Back     information, alignment and structure
>d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 115 Back     information, alignment and structure
>d1kkca1 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Length = 84 Back     information, alignment and structure
>d1p7ga2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 119 Back     information, alignment and structure
>d1ma1a1 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 88 Back     information, alignment and structure
>d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 111 Back     information, alignment and structure
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 122 Back     information, alignment and structure
>d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Length = 110 Back     information, alignment and structure
>d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} Length = 114 Back     information, alignment and structure
>d1idsa2 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 114 Back     information, alignment and structure
>d2p4ka1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 107 Back     information, alignment and structure
>d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 89 Back     information, alignment and structure
>d1idsa1 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 84 Back     information, alignment and structure
>d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} Length = 116 Back     information, alignment and structure
>d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Length = 116 Back     information, alignment and structure
>d1ix9a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d1wb8a2116 Fe superoxide dismutase (FeSOD) {Archaeon Sulfolob 100.0
d1gv3a2111 Mn superoxide dismutase (MnSOD) {Anabaena sp. [Tax 100.0
d1mnga2111 Mn superoxide dismutase (MnSOD) {Thermus thermophi 100.0
d1ma1a2113 Fe superoxide dismutase (FeSOD) {Archaeon Methanob 100.0
d1my6a2110 Fe superoxide dismutase (FeSOD) {Thermosynechococc 100.0
d1uera2107 Cambialistic superoxide dismutase {Porphyromonas g 100.0
d2nyba2110 Fe superoxide dismutase (FeSOD) {Escherichia coli 100.0
d1idsa2114 Fe superoxide dismutase (FeSOD) {Mycobacterium tub 100.0
d1bsma2115 Cambialistic superoxide dismutase {Propionibacteri 100.0
d1p7ga2119 Fe superoxide dismutase (FeSOD) {Archaeon Pyrobacu 100.0
d1dt0a2114 Fe superoxide dismutase (FeSOD) {Pseudomonas ovali 100.0
d1unfx2134 Fe superoxide dismutase (FeSOD) {Cowpea (Vigna ung 100.0
d1jr9a2111 Mn superoxide dismutase (MnSOD) {Bacillus halodeni 100.0
d2p4ka2115 Mn superoxide dismutase (MnSOD) {Human (Homo sapie 100.0
d1ix9a2115 Mn superoxide dismutase (MnSOD) {Escherichia coli 100.0
d1y67a2116 Mn superoxide dismutase (MnSOD) {Deinococcus radio 100.0
d1kkca2116 Mn superoxide dismutase (MnSOD) {Aspergillus fumig 100.0
d1coja2122 Fe superoxide dismutase (FeSOD) {Aquifex pyrophilu 100.0
d1my6a188 Fe superoxide dismutase (FeSOD) {Thermosynechococc 99.94
d1unfx191 Fe superoxide dismutase (FeSOD) {Cowpea (Vigna ung 99.92
d1uera184 Cambialistic superoxide dismutase {Porphyromonas g 99.92
d2nyba182 Fe superoxide dismutase (FeSOD) {Escherichia coli 99.92
d1mnga192 Mn superoxide dismutase (MnSOD) {Thermus thermophi 99.91
d1gv3a1102 Mn superoxide dismutase (MnSOD) {Anabaena sp. [Tax 99.91
d1jr9a190 Mn superoxide dismutase (MnSOD) {Bacillus halodeni 99.9
d1ix9a190 Mn superoxide dismutase (MnSOD) {Escherichia coli 99.88
d1bsma186 Cambialistic superoxide dismutase {Propionibacteri 99.87
d1p7ga192 Fe superoxide dismutase (FeSOD) {Archaeon Pyrobacu 99.86
d1idsa184 Fe superoxide dismutase (FeSOD) {Mycobacterium tub 99.86
d2p4ka183 Mn superoxide dismutase (MnSOD) {Human (Homo sapie 99.86
d1kkca184 Mn superoxide dismutase (MnSOD) {Aspergillus fumig 99.85
d1ma1a188 Fe superoxide dismutase (FeSOD) {Archaeon Methanob 99.85
d1coja189 Fe superoxide dismutase (FeSOD) {Aquifex pyrophilu 99.84
d1wb8a189 Fe superoxide dismutase (FeSOD) {Archaeon Sulfolob 99.82
>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Fe,Mn superoxide dismutase (SOD), C-terminal domain
superfamily: Fe,Mn superoxide dismutase (SOD), C-terminal domain
family: Fe,Mn superoxide dismutase (SOD), C-terminal domain
domain: Fe superoxide dismutase (FeSOD)
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=100.00  E-value=2.7e-38  Score=231.97  Aligned_cols=85  Identities=32%  Similarity=0.601  Sum_probs=80.9

Q ss_pred             CCCCCcHHHHHHHHhhcCCHHHHHHHHHHHHhcCCCccEEEEEEecCccccccccCCCCCCCCCCceeEEeecCCCCCCC
Q 030435           73 GGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLV  152 (177)
Q Consensus        73 ~~~~p~~~L~~~I~~~FGS~e~fk~~f~~~a~~~~GsGW~WLv~~~~~~l~~~~~~~~~~~~~~~~L~i~~t~n~~~p~~  152 (177)
                      +++.|++.|+++|+++|||+|+||++|.++|.++|||||+|||+|+                .+++|.|+++.||++|+.
T Consensus         5 Gg~~P~g~l~~~I~~~FGS~d~fk~~f~~~a~~~~GsGW~wLv~~~----------------~~~~l~i~~~~n~~~~~~   68 (116)
T d1wb8a2           5 GGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDT----------------ESGNLQIMTFENHFQNHI   68 (116)
T ss_dssp             BSSCCCHHHHHHHHHHHSSHHHHHHHHHHHHHTCCSSEEEEEEECT----------------TTCCEEEEEEETTTBSCC
T ss_pred             CCCCCCHHHHHHHHHHhCCHHHHHHHHHHHHhcCcccceEEEEEeC----------------cCCcccccccccCCCCcc
Confidence            4568999999999999999999999999999999999999999995                468999999999999999


Q ss_pred             CCCeeeEEeccchhhhhhhhc
Q 030435          153 WDYSPLLTIDVWEVNIYHCVL  173 (177)
Q Consensus       153 ~~~~PlL~iDvWEHAYyld~~  173 (177)
                      .+..|||||||||||||+||+
T Consensus        69 ~~~~piL~lDvWEHAYyldY~   89 (116)
T d1wb8a2          69 AEIPIILILDEFEHAYYLQYK   89 (116)
T ss_dssp             SSCCEEEEEECSGGGTHHHHT
T ss_pred             CCCceeeeecchhhhhHHHHh
Confidence            999999999999999999998
>d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Back     information, alignment and structure
>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1idsa2 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1p7ga2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} Back     information, alignment and structure
>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Back     information, alignment and structure
>d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix9a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Back     information, alignment and structure
>d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2nyba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gv3a1 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Back     information, alignment and structure
>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1ix9a1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bsma1 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1p7ga1 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1idsa1 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4ka1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkca1 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1ma1a1 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure