Citrus Sinensis ID: 030653
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 174 | ||||||
| 296090249 | 565 | unnamed protein product [Vitis vinifera] | 0.419 | 0.129 | 0.733 | 9e-25 | |
| 225452163 | 541 | PREDICTED: 4-coumarate--CoA ligase-like | 0.419 | 0.134 | 0.733 | 1e-24 | |
| 224133070 | 548 | 4-coumarate-coa ligase [Populus trichoca | 0.459 | 0.145 | 0.659 | 6e-24 | |
| 255536983 | 540 | AMP dependent CoA ligase, putative [Rici | 0.419 | 0.135 | 0.72 | 1e-23 | |
| 125573000 | 579 | hypothetical protein OsJ_04438 [Oryza sa | 0.442 | 0.132 | 0.594 | 6e-23 | |
| 20161028 | 579 | putative 4-coumarate:CoA ligase [Oryza s | 0.442 | 0.132 | 0.594 | 6e-23 | |
| 225452165 | 543 | PREDICTED: 4-coumarate--CoA ligase-like | 0.402 | 0.128 | 0.708 | 8e-23 | |
| 296090250 | 513 | unnamed protein product [Vitis vinifera] | 0.402 | 0.136 | 0.708 | 8e-23 | |
| 224099965 | 112 | predicted protein [Populus trichocarpa] | 0.465 | 0.723 | 0.651 | 8e-23 | |
| 209572802 | 598 | RecName: Full=4-coumarate--CoA ligase-li | 0.425 | 0.123 | 0.618 | 1e-22 |
| >gi|296090249|emb|CBI40068.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 118 bits (295), Expect = 9e-25, Method: Compositional matrix adjust.
Identities = 55/75 (73%), Positives = 62/75 (82%), Gaps = 2/75 (2%)
Query: 102 ISAGYVGEQEVTSATLLPDGWMRTGDLCY--EDSFLFIVDGLKDLVKYKGCQVAPAELEH 159
I GYV + + TS TL PDGW+RTGDLCY ED FLFIVD LK+L+KYKG QVAPAELEH
Sbjct: 416 IMKGYVNDPKATSETLTPDGWLRTGDLCYIDEDGFLFIVDRLKELIKYKGYQVAPAELEH 475
Query: 160 LLLSHPEMVDAAVIP 174
LL SHP++VDAAVIP
Sbjct: 476 LLQSHPQIVDAAVIP 490
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225452163|ref|XP_002270555.1| PREDICTED: 4-coumarate--CoA ligase-like 9-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224133070|ref|XP_002327954.1| 4-coumarate-coa ligase [Populus trichocarpa] gi|224133074|ref|XP_002327955.1| acyl:coa ligase [Populus trichocarpa] gi|222837363|gb|EEE75742.1| 4-coumarate-coa ligase [Populus trichocarpa] gi|222837364|gb|EEE75743.1| acyl:coa ligase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255536983|ref|XP_002509558.1| AMP dependent CoA ligase, putative [Ricinus communis] gi|223549457|gb|EEF50945.1| AMP dependent CoA ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|125573000|gb|EAZ14515.1| hypothetical protein OsJ_04438 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|20161028|dbj|BAB89961.1| putative 4-coumarate:CoA ligase [Oryza sativa Japonica Group] gi|20161608|dbj|BAB90528.1| putative 4-coumarate-CoA ligase [Oryza sativa Japonica Group] gi|56784513|dbj|BAD82770.1| putative 4-coumarate:CoA ligase [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|225452165|ref|XP_002270592.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296090250|emb|CBI40069.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224099965|ref|XP_002334423.1| predicted protein [Populus trichocarpa] gi|222870385|gb|EEF07516.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|209572802|sp|Q8RU95.2|4CLL6_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 6 | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 174 | ||||||
| TAIR|locus:2034392 | 546 | OPCL1 "OPC-8:0 CoA ligase1" [A | 0.419 | 0.133 | 0.666 | 9.3e-22 | |
| TAIR|locus:2034403 | 550 | AT1G20500 [Arabidopsis thalian | 0.419 | 0.132 | 0.626 | 1.9e-20 | |
| TAIR|locus:2034423 | 565 | AT1G20480 [Arabidopsis thalian | 0.419 | 0.129 | 0.573 | 5e-18 | |
| TAIR|locus:2158559 | 562 | AT5G63380 [Arabidopsis thalian | 0.425 | 0.131 | 0.539 | 1.3e-17 | |
| TAIR|locus:2176662 | 550 | 4CL8 [Arabidopsis thaliana (ta | 0.396 | 0.125 | 0.592 | 1.6e-17 | |
| UNIPROTKB|Q5LVA1 | 535 | fadD "4-coumarate:CoA ligase" | 0.413 | 0.134 | 0.540 | 1.5e-16 | |
| TIGR_CMR|SPO_0801 | 535 | SPO_0801 "4-coumarate:CoA liga | 0.413 | 0.134 | 0.540 | 1.5e-16 | |
| WB|WBGene00008669 | 544 | acs-14 [Caenorhabditis elegans | 0.408 | 0.130 | 0.594 | 2.5e-16 | |
| UNIPROTKB|P08659 | 550 | P08659 "Luciferin 4-monooxygen | 0.413 | 0.130 | 0.554 | 3.3e-16 | |
| TAIR|locus:2117209 | 566 | AT4G19010 [Arabidopsis thalian | 0.408 | 0.125 | 0.493 | 5.7e-16 |
| TAIR|locus:2034392 OPCL1 "OPC-8:0 CoA ligase1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 261 (96.9 bits), Expect = 9.3e-22, P = 9.3e-22
Identities = 50/75 (66%), Positives = 60/75 (80%)
Query: 102 ISAGYVGEQEVTSATLLPDGWMRTGDLCY--EDSFLFIVDGLKDLVKYKGCQVAPAELEH 159
I GY +E TS+TL +GW+RTGDLCY ED F+F+VD LK+L+KYKG QVAPAELE
Sbjct: 399 IMKGYFSNEEATSSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEA 458
Query: 160 LLLSHPEMVDAAVIP 174
LLL+HPE+ DAAVIP
Sbjct: 459 LLLTHPEITDAAVIP 473
|
|
| TAIR|locus:2034403 AT1G20500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034423 AT1G20480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158559 AT5G63380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2176662 4CL8 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5LVA1 fadD "4-coumarate:CoA ligase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0801 SPO_0801 "4-coumarate:CoA ligase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00008669 acs-14 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08659 P08659 "Luciferin 4-monooxygenase" [Photinus pyralis (taxid:7054)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117209 AT4G19010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00020554001 | SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (427 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 174 | |||
| cd05904 | 504 | cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | 1e-33 | |
| cd05911 | 487 | cd05911, Firefly_Luc_like, Firefly luciferase of l | 3e-27 | |
| PLN02246 | 537 | PLN02246, PLN02246, 4-coumarate--CoA ligase | 2e-25 | |
| PLN02574 | 560 | PLN02574, PLN02574, 4-coumarate--CoA ligase-like | 8e-22 | |
| PLN02330 | 546 | PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | 9e-21 | |
| cd05917 | 347 | cd05917, FACL_like_2, Uncharacterized subfamily of | 1e-18 | |
| PRK06187 | 521 | PRK06187, PRK06187, long-chain-fatty-acid--CoA lig | 3e-18 | |
| cd04433 | 338 | cd04433, AFD_class_I, Adenylate forming domain, Cl | 1e-16 | |
| COG0318 | 534 | COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ | 2e-16 | |
| cd05936 | 468 | cd05936, FC-FACS_FadD_like, Prokaryotic long-chain | 2e-16 | |
| pfam00501 | 412 | pfam00501, AMP-binding, AMP-binding enzyme | 8e-16 | |
| PRK07656 | 513 | PRK07656, PRK07656, long-chain-fatty-acid--CoA lig | 2e-15 | |
| cd05929 | 342 | cd05929, BACL_like, Bacterial Bile acid CoA ligase | 2e-15 | |
| cd05935 | 430 | cd05935, LC_FACS_like, Putative long-chain fatty a | 1e-14 | |
| cd05926 | 345 | cd05926, FACL_fum10p_like, Subfamily of fatty acid | 3e-14 | |
| cd05920 | 483 | cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l | 6e-14 | |
| cd05903 | 437 | cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li | 9e-14 | |
| PRK08008 | 517 | PRK08008, caiC, putative crotonobetaine/carnitine- | 2e-13 | |
| PRK05605 | 573 | PRK05605, PRK05605, long-chain-fatty-acid--CoA lig | 3e-13 | |
| PRK06188 | 524 | PRK06188, PRK06188, acyl-CoA synthetase; Validated | 3e-13 | |
| cd05934 | 421 | cd05934, FACL_DitJ_like, Uncharacterized subfamily | 4e-13 | |
| cd05907 | 456 | cd05907, VL_LC_FACS_like, Long-chain fatty acid Co | 9e-13 | |
| cd12119 | 517 | cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth | 2e-12 | |
| PRK03640 | 483 | PRK03640, PRK03640, O-succinylbenzoic acid--CoA li | 1e-11 | |
| PRK09088 | 488 | PRK09088, PRK09088, acyl-CoA synthetase; Validated | 3e-11 | |
| PRK05677 | 562 | PRK05677, PRK05677, long-chain-fatty-acid--CoA lig | 4e-11 | |
| cd05922 | 350 | cd05922, FACL_like_6, Uncharacterized subfamily of | 6e-11 | |
| PRK08276 | 502 | PRK08276, PRK08276, long-chain-fatty-acid--CoA lig | 6e-11 | |
| COG1022 | 613 | COG1022, FAA1, Long-chain acyl-CoA synthetases (AM | 9e-11 | |
| cd05932 | 504 | cd05932, LC_FACS_bac, Bacterial long-chain fatty a | 2e-10 | |
| PRK06164 | 540 | PRK06164, PRK06164, acyl-CoA synthetase; Validated | 3e-10 | |
| PRK08974 | 560 | PRK08974, PRK08974, long-chain-fatty-acid--CoA lig | 3e-10 | |
| PRK07787 | 471 | PRK07787, PRK07787, acyl-CoA synthetase; Validated | 3e-10 | |
| PRK06178 | 567 | PRK06178, PRK06178, acyl-CoA synthetase; Validated | 3e-10 | |
| PRK12492 | 562 | PRK12492, PRK12492, long-chain-fatty-acid--CoA lig | 4e-10 | |
| COG0365 | 528 | COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat | 7e-10 | |
| cd05941 | 430 | cd05941, MCS, Malonyl-CoA synthetase (MCS) | 9e-10 | |
| PRK12583 | 558 | PRK12583, PRK12583, acyl-CoA synthetase; Provision | 1e-09 | |
| PRK08315 | 559 | PRK08315, PRK08315, AMP-binding domain protein; Va | 1e-09 | |
| PRK06145 | 497 | PRK06145, PRK06145, acyl-CoA synthetase; Validated | 5e-09 | |
| cd05972 | 430 | cd05972, MACS_like, Medium-chain acyl-CoA syntheta | 6e-09 | |
| cd05912 | 407 | cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase | 7e-09 | |
| PRK06710 | 563 | PRK06710, PRK06710, long-chain-fatty-acid--CoA lig | 9e-09 | |
| PRK08316 | 523 | PRK08316, PRK08316, acyl-CoA synthetase; Validated | 1e-08 | |
| cd05944 | 359 | cd05944, FACL_like_4, Uncharacterized subfamily of | 2e-08 | |
| PRK07638 | 487 | PRK07638, PRK07638, acyl-CoA synthetase; Validated | 2e-08 | |
| PRK07529 | 632 | PRK07529, PRK07529, AMP-binding domain protein; Va | 3e-08 | |
| PRK06087 | 547 | PRK06087, PRK06087, short chain acyl-CoA synthetas | 3e-08 | |
| PRK07470 | 528 | PRK07470, PRK07470, acyl-CoA synthetase; Validated | 3e-08 | |
| PRK08314 | 546 | PRK08314, PRK08314, long-chain-fatty-acid--CoA lig | 4e-08 | |
| PRK07786 | 542 | PRK07786, PRK07786, long-chain-fatty-acid--CoA lig | 5e-08 | |
| PRK07059 | 557 | PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig | 6e-08 | |
| cd05969 | 443 | cd05969, MACS_like_4, Uncharacterized subfamily of | 6e-08 | |
| cd05971 | 439 | cd05971, MACS_like_3, Uncharacterized subfamily of | 6e-08 | |
| PRK05620 | 576 | PRK05620, PRK05620, long-chain-fatty-acid--CoA lig | 6e-08 | |
| PRK09192 | 579 | PRK09192, PRK09192, acyl-CoA synthetase; Validated | 7e-08 | |
| TIGR01923 | 436 | TIGR01923, menE, O-succinylbenzoate-CoA ligase | 8e-08 | |
| cd05959 | 506 | cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and | 8e-08 | |
| cd05919 | 436 | cd05919, BCL_like, Benzoate CoA ligase (BCL) and s | 1e-07 | |
| cd05970 | 537 | cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s | 1e-07 | |
| cd05974 | 433 | cd05974, MACS_like_1, Uncharacterized subfamily of | 2e-07 | |
| cd05940 | 444 | cd05940, FATP_FACS, Fatty acid transport proteins | 3e-07 | |
| PRK08751 | 560 | PRK08751, PRK08751, putative long-chain fatty acyl | 3e-07 | |
| PRK06839 | 496 | PRK06839, PRK06839, acyl-CoA synthetase; Validated | 4e-07 | |
| cd05973 | 440 | cd05973, MACS_like_2, Uncharacterized subfamily of | 6e-07 | |
| PRK05852 | 534 | PRK05852, PRK05852, acyl-CoA synthetase; Validated | 6e-07 | |
| PRK13391 | 511 | PRK13391, PRK13391, acyl-CoA synthetase; Provision | 9e-07 | |
| PLN02860 | 563 | PLN02860, PLN02860, o-succinylbenzoate-CoA ligase | 1e-06 | |
| COG1021 | 542 | COG1021, EntE, Peptide arylation enzymes [Secondar | 1e-06 | |
| PRK06018 | 542 | PRK06018, PRK06018, putative acyl-CoA synthetase; | 2e-06 | |
| PRK13382 | 537 | PRK13382, PRK13382, acyl-CoA synthetase; Provision | 2e-06 | |
| PRK06155 | 542 | PRK06155, PRK06155, crotonobetaine/carnitine-CoA l | 4e-06 | |
| PRK12406 | 509 | PRK12406, PRK12406, long-chain-fatty-acid--CoA lig | 5e-06 | |
| cd05908 | 499 | cd05908, A_NRPS_MycA_like, The adenylation domain | 6e-06 | |
| TIGR02262 | 508 | TIGR02262, benz_CoA_lig, benzoate-CoA ligase famil | 1e-05 | |
| cd05923 | 495 | cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) | 1e-05 | |
| cd05968 | 474 | cd05968, AACS_like, Uncharacterized acyl-CoA synth | 1e-05 | |
| PRK07514 | 504 | PRK07514, PRK07514, malonyl-CoA synthase; Validate | 2e-05 | |
| TIGR02275 | 526 | TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP | 2e-05 | |
| cd05945 | 447 | cd05945, DltA, D-alanine:D-alanyl carrier protein | 2e-05 | |
| cd05933 | 594 | cd05933, ACSBG_like, Bubblegum-like very long-chai | 2e-05 | |
| cd12114 | 476 | cd12114, A_NRPS_TlmIV_like, The adenylation domain | 3e-05 | |
| PRK07867 | 529 | PRK07867, PRK07867, acyl-CoA synthetase; Validated | 3e-05 | |
| PRK08162 | 545 | PRK08162, PRK08162, acyl-CoA synthetase; Validated | 4e-05 | |
| cd05931 | 547 | cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | 4e-05 | |
| cd05928 | 530 | cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co | 4e-05 | |
| cd05958 | 487 | cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) | 5e-05 | |
| PRK07788 | 549 | PRK07788, PRK07788, acyl-CoA synthetase; Validated | 6e-05 | |
| cd12117 | 474 | cd12117, A_NRPS_Srf_like, The adenylation domain o | 6e-05 | |
| PRK07008 | 539 | PRK07008, PRK07008, long-chain-fatty-acid--CoA lig | 8e-05 | |
| cd05927 | 539 | cd05927, LC-FACS_euk, Eukaryotic long-chain fatty | 1e-04 | |
| cd12116 | 438 | cd12116, A_NRPS_Ta1_like, The adenylation domain o | 1e-04 | |
| cd12118 | 520 | cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt | 1e-04 | |
| PRK13383 | 516 | PRK13383, PRK13383, acyl-CoA synthetase; Provision | 1e-04 | |
| PRK04319 | 570 | PRK04319, PRK04319, acetyl-CoA synthetase; Provisi | 2e-04 | |
| TIGR01733 | 409 | TIGR01733, AA-adenyl-dom, amino acid adenylation d | 2e-04 | |
| PRK08279 | 600 | PRK08279, PRK08279, long-chain-acyl-CoA synthetase | 2e-04 | |
| cd12115 | 449 | cd12115, A_NRPS_Sfm_like, The adenylation domain o | 2e-04 | |
| PRK13388 | 540 | PRK13388, PRK13388, acyl-CoA synthetase; Provision | 3e-04 | |
| cd05915 | 509 | cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetase | 4e-04 | |
| PRK05851 | 525 | PRK05851, PRK05851, long-chain-fatty-acid--[acyl-c | 5e-04 | |
| cd05918 | 447 | cd05918, A_NRPS_SidN3_like, The adenylation (A) do | 5e-04 | |
| PLN03102 | 579 | PLN03102, PLN03102, acyl-activating enzyme; Provis | 6e-04 | |
| PRK13295 | 547 | PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig | 7e-04 | |
| cd05967 | 607 | cd05967, PrpE, Propionyl-CoA synthetase (PrpE) | 0.001 | |
| PRK10946 | 536 | PRK10946, entE, enterobactin synthase subunit E; P | 0.001 | |
| TIGR03208 | 538 | TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate | 0.001 | |
| cd05937 | 468 | cd05937, FATP_chFAT1_like, Uncharacterized subfami | 0.001 | |
| COG1020 | 642 | COG1020, EntF, Non-ribosomal peptide synthetase mo | 0.002 | |
| cd05930 | 445 | cd05930, A_NRPS, The adenylation domain of nonribo | 0.002 | |
| PRK13390 | 501 | PRK13390, PRK13390, acyl-CoA synthetase; Provision | 0.002 | |
| cd05909 | 489 | cd05909, AAS_C, C-terminal domain of the acyl-acyl | 0.003 | |
| TIGR03205 | 541 | TIGR03205, pimA, dicarboxylate--CoA ligase PimA | 0.004 | |
| PRK05857 | 540 | PRK05857, PRK05857, acyl-CoA synthetase; Validated | 0.004 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 0.004 |
| >gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
Score = 123 bits (312), Expect = 1e-33
Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 2/75 (2%)
Query: 102 ISAGYVGEQEVTSATLLPDGWMRTGDLCY--EDSFLFIVDGLKDLVKYKGCQVAPAELEH 159
+ GY+ E T+ T+ DGW+ TGDL Y ED +LFIVD LK+L+KYKG QVAPAELE
Sbjct: 367 VMKGYLNNPEATAETIDKDGWLHTGDLGYFDEDGYLFIVDRLKELIKYKGFQVAPAELEA 426
Query: 160 LLLSHPEMVDAAVIP 174
LLLSHPE+ DAAVIP
Sbjct: 427 LLLSHPEIADAAVIP 441
|
4-Coumarate:coenzyme A ligase is a key enzyme in the phenylpropanoid metabolic pathway for monolignol and flavonoid biosynthesis. It catalyzes the synthesis of hydroxycinnamate-CoA thioesters in a two-step reaction, involving the formation of hydroxycinnamate-AMP anhydride and the nucleophilic substitution of AMP by CoA. The phenylpropanoid pathway is one of the most important secondary metabolism pathways in plants and hydroxycinnamate-CoA thioesters are the precursors of lignin and other important phenylpropanoids. Length = 504 |
| >gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
| >gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I | Back alignment and domain information |
|---|
| >gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD | Back alignment and domain information |
|---|
| >gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis | Back alignment and domain information |
|---|
| >gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) | Back alignment and domain information |
|---|
| >gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles | Back alignment and domain information |
|---|
| >gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236096 PRK07787, PRK07787, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) | Back alignment and domain information |
|---|
| >gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) | Back alignment and domain information |
|---|
| >gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) | Back alignment and domain information |
|---|
| >gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) | Back alignment and domain information |
|---|
| >gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|180167 PRK05620, PRK05620, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase) | Back alignment and domain information |
|---|
| >gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like | Back alignment and domain information |
|---|
| >gnl|CDD|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215464 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|223952 COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235673 PRK06018, PRK06018, putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172019 PRK13382, PRK13382, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235719 PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) | Back alignment and domain information |
|---|
| >gnl|CDD|233803 TIGR02262, benz_CoA_lig, benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >gnl|CDD|213290 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) | Back alignment and domain information |
|---|
| >gnl|CDD|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) | Back alignment and domain information |
|---|
| >gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) | Back alignment and domain information |
|---|
| >gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes | Back alignment and domain information |
|---|
| >gnl|CDD|236120 PRK07867, PRK07867, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236169 PRK08162, PRK08162, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | Back alignment and domain information |
|---|
| >gnl|CDD|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM) | Back alignment and domain information |
|---|
| >gnl|CDD|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) | Back alignment and domain information |
|---|
| >gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) | Back alignment and domain information |
|---|
| >gnl|CDD|235908 PRK07008, PRK07008, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) | Back alignment and domain information |
|---|
| >gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis | Back alignment and domain information |
|---|
| >gnl|CDD|139531 PRK13383, PRK13383, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain | Back alignment and domain information |
|---|
| >gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae | Back alignment and domain information |
|---|
| >gnl|CDD|237374 PRK13388, PRK13388, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213283 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles | Back alignment and domain information |
|---|
| >gnl|CDD|180289 PRK05851, PRK05851, long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|215576 PLN03102, PLN03102, acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213314 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) | Back alignment and domain information |
|---|
| >gnl|CDD|236803 PRK10946, entE, enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi | Back alignment and domain information |
|---|
| >gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) | Back alignment and domain information |
|---|
| >gnl|CDD|132249 TIGR03205, pimA, dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >gnl|CDD|180293 PRK05857, PRK05857, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 174 | |||
| KOG1176 | 537 | consensus Acyl-CoA synthetase [Lipid transport and | 99.98 | |
| COG0318 | 534 | CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l | 99.96 | |
| PLN02614 | 666 | long-chain acyl-CoA synthetase | 99.95 | |
| COG1022 | 613 | FAA1 Long-chain acyl-CoA synthetases (AMP-forming) | 99.95 | |
| PRK06334 | 539 | long chain fatty acid--[acyl-carrier-protein] liga | 99.95 | |
| PLN02736 | 651 | long-chain acyl-CoA synthetase | 99.95 | |
| KOG1177 | 596 | consensus Long chain fatty acid acyl-CoA ligase [L | 99.94 | |
| PLN02574 | 560 | 4-coumarate--CoA ligase-like | 99.94 | |
| PLN02860 | 563 | o-succinylbenzoate-CoA ligase | 99.94 | |
| PTZ00342 | 746 | acyl-CoA synthetase; Provisional | 99.94 | |
| PRK07769 | 631 | long-chain-fatty-acid--CoA ligase; Validated | 99.94 | |
| PRK09274 | 552 | peptide synthase; Provisional | 99.94 | |
| PTZ00237 | 647 | acetyl-CoA synthetase; Provisional | 99.94 | |
| PLN02861 | 660 | long-chain-fatty-acid-CoA ligase | 99.94 | |
| PLN02387 | 696 | long-chain-fatty-acid-CoA ligase family protein | 99.93 | |
| PLN02246 | 537 | 4-coumarate--CoA ligase | 99.93 | |
| PRK06060 | 705 | acyl-CoA synthetase; Validated | 99.93 | |
| COG0365 | 528 | Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l | 99.93 | |
| PRK05677 | 562 | long-chain-fatty-acid--CoA ligase; Validated | 99.93 | |
| TIGR01734 | 502 | D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig | 99.93 | |
| PLN02654 | 666 | acetate-CoA ligase | 99.93 | |
| PRK12476 | 612 | putative fatty-acid--CoA ligase; Provisional | 99.93 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 99.93 | |
| PRK05851 | 525 | long-chain-fatty-acid--[acyl-carrier-protein] liga | 99.93 | |
| PRK00174 | 637 | acetyl-CoA synthetase; Provisional | 99.93 | |
| TIGR02188 | 625 | Ac_CoA_lig_AcsA acetate--CoA ligase. This model de | 99.93 | |
| PRK09088 | 488 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK06145 | 497 | acyl-CoA synthetase; Validated | 99.93 | |
| PLN02330 | 546 | 4-coumarate--CoA ligase-like 1 | 99.92 | |
| PRK07638 | 487 | acyl-CoA synthetase; Validated | 99.92 | |
| PRK12492 | 562 | long-chain-fatty-acid--CoA ligase; Provisional | 99.92 | |
| PTZ00216 | 700 | acyl-CoA synthetase; Provisional | 99.92 | |
| PRK07529 | 632 | AMP-binding domain protein; Validated | 99.92 | |
| TIGR02275 | 527 | DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot | 99.92 | |
| PLN02430 | 660 | long-chain-fatty-acid-CoA ligase | 99.92 | |
| PRK13295 | 547 | cyclohexanecarboxylate-CoA ligase; Reviewed | 99.92 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.92 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.92 | |
| PLN03051 | 499 | acyl-activating enzyme; Provisional | 99.92 | |
| PRK06839 | 496 | acyl-CoA synthetase; Validated | 99.92 | |
| PRK07788 | 549 | acyl-CoA synthetase; Validated | 99.92 | |
| PRK05852 | 534 | acyl-CoA synthetase; Validated | 99.92 | |
| PRK04813 | 503 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.92 | |
| PRK04319 | 570 | acetyl-CoA synthetase; Provisional | 99.92 | |
| PRK03584 | 655 | acetoacetyl-CoA synthetase; Provisional | 99.92 | |
| PRK12583 | 558 | acyl-CoA synthetase; Provisional | 99.92 | |
| PRK08316 | 523 | acyl-CoA synthetase; Validated | 99.91 | |
| TIGR02316 | 628 | propion_prpE propionate--CoA ligase. This family c | 99.91 | |
| PRK08751 | 560 | putative long-chain fatty acyl CoA ligase; Provisi | 99.91 | |
| KOG1256 | 691 | consensus Long-chain acyl-CoA synthetases (AMP-for | 99.91 | |
| TIGR01217 | 652 | ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym | 99.91 | |
| PRK10946 | 536 | entE enterobactin synthase subunit E; Provisional | 99.91 | |
| PRK08315 | 559 | AMP-binding domain protein; Validated | 99.91 | |
| PRK07787 | 471 | acyl-CoA synthetase; Validated | 99.91 | |
| PRK08314 | 546 | long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| PRK07786 | 542 | long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| TIGR03208 | 538 | cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. | 99.91 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.91 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.91 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 99.91 | |
| PRK13390 | 501 | acyl-CoA synthetase; Provisional | 99.91 | |
| PRK07059 | 557 | Long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| PRK07514 | 504 | malonyl-CoA synthase; Validated | 99.91 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.91 | |
| PRK05857 | 540 | acyl-CoA synthetase; Validated | 99.91 | |
| PRK13382 | 537 | acyl-CoA synthetase; Provisional | 99.91 | |
| PRK07656 | 513 | long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| TIGR01733 | 408 | AA-adenyl-dom amino acid adenylation domain. This | 99.91 | |
| PRK10524 | 629 | prpE propionyl-CoA synthetase; Provisional | 99.91 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.9 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 99.9 | |
| PRK09192 | 579 | acyl-CoA synthetase; Validated | 99.9 | |
| TIGR03098 | 515 | ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor | 99.9 | |
| PRK07445 | 452 | O-succinylbenzoic acid--CoA ligase; Reviewed | 99.9 | |
| PRK12582 | 624 | acyl-CoA synthetase; Provisional | 99.9 | |
| PRK08008 | 517 | caiC putative crotonobetaine/carnitine-CoA ligase; | 99.9 | |
| PRK07470 | 528 | acyl-CoA synthetase; Validated | 99.9 | |
| PRK06087 | 547 | short chain acyl-CoA synthetase; Reviewed | 99.9 | |
| PRK06710 | 563 | long-chain-fatty-acid--CoA ligase; Validated | 99.9 | |
| PRK05850 | 578 | acyl-CoA synthetase; Validated | 99.9 | |
| PRK05605 | 573 | long-chain-fatty-acid--CoA ligase; Validated | 99.9 | |
| PRK07824 | 358 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.9 | |
| PLN03102 | 579 | acyl-activating enzyme; Provisional | 99.9 | |
| PRK08974 | 560 | long-chain-fatty-acid--CoA ligase; Validated | 99.89 | |
| PRK03640 | 483 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.89 | |
| PRK08043 | 718 | bifunctional acyl-[acyl carrier protein] synthetas | 99.89 | |
| PRK09029 | 458 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.89 | |
| TIGR03205 | 541 | pimA dicarboxylate--CoA ligase PimA. PimA, a membe | 99.89 | |
| PRK08180 | 614 | feruloyl-CoA synthase; Reviewed | 99.89 | |
| PRK06155 | 542 | crotonobetaine/carnitine-CoA ligase; Provisional | 99.89 | |
| PRK06164 | 540 | acyl-CoA synthetase; Validated | 99.89 | |
| PRK05620 | 576 | long-chain-fatty-acid--CoA ligase; Validated | 99.89 | |
| PRK06188 | 524 | acyl-CoA synthetase; Validated | 99.89 | |
| PRK12406 | 509 | long-chain-fatty-acid--CoA ligase; Provisional | 99.89 | |
| TIGR02262 | 508 | benz_CoA_lig benzoate-CoA ligase family. Character | 99.89 | |
| PRK13391 | 511 | acyl-CoA synthetase; Provisional | 99.88 | |
| PRK07798 | 533 | acyl-CoA synthetase; Validated | 99.88 | |
| PRK08276 | 502 | long-chain-fatty-acid--CoA ligase; Validated | 99.88 | |
| COG1021 | 542 | EntE Peptide arylation enzymes [Secondary metaboli | 99.88 | |
| PRK06178 | 567 | acyl-CoA synthetase; Validated | 99.88 | |
| PRK07008 | 539 | long-chain-fatty-acid--CoA ligase; Validated | 99.88 | |
| PRK13383 | 516 | acyl-CoA synthetase; Provisional | 99.88 | |
| PLN02479 | 567 | acetate-CoA ligase | 99.88 | |
| PRK13388 | 540 | acyl-CoA synthetase; Provisional | 99.88 | |
| PRK07867 | 529 | acyl-CoA synthetase; Validated | 99.88 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 99.88 | |
| PRK08279 | 600 | long-chain-acyl-CoA synthetase; Validated | 99.88 | |
| PRK06187 | 521 | long-chain-fatty-acid--CoA ligase; Validated | 99.87 | |
| KOG1175 | 626 | consensus Acyl-CoA synthetase [Lipid transport and | 99.87 | |
| PRK07768 | 545 | long-chain-fatty-acid--CoA ligase; Validated | 99.87 | |
| PRK08162 | 545 | acyl-CoA synthetase; Validated | 99.86 | |
| PRK06018 | 542 | putative acyl-CoA synthetase; Provisional | 99.86 | |
| TIGR01923 | 436 | menE O-succinylbenzoate-CoA ligase. This model rep | 99.86 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 99.86 | |
| PLN03052 | 728 | acetate--CoA ligase; Provisional | 99.84 | |
| KOG1180 | 678 | consensus Acyl-CoA synthetase [Lipid transport and | 99.84 | |
| PF00501 | 417 | AMP-binding: AMP-binding enzyme; InterPro: IPR0008 | 99.81 | |
| PRK08308 | 414 | acyl-CoA synthetase; Validated | 99.76 | |
| TIGR02155 | 422 | PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet | 99.66 | |
| COG1020 | 642 | EntF Non-ribosomal peptide synthetase modules and | 99.64 | |
| TIGR02372 | 386 | 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv | 99.6 | |
| KOG1179 | 649 | consensus Very long-chain acyl-CoA synthetase/fatt | 99.55 | |
| TIGR03335 | 445 | F390_ftsA coenzyme F390 synthetase. This enzyme, c | 99.32 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 99.3 | |
| PTZ00297 | 1452 | pantothenate kinase; Provisional | 99.08 | |
| COG1541 | 438 | PaaK Coenzyme F390 synthetase [Coenzyme metabolism | 99.02 | |
| KOG1178 | 1032 | consensus Non-ribosomal peptide synthetase/alpha-a | 98.44 | |
| TIGR02304 | 430 | aden_form_hyp probable adenylate-forming enzyme. M | 97.98 | |
| KOG3628 | 1363 | consensus Predicted AMP-binding protein [General f | 97.7 | |
| PF03321 | 528 | GH3: GH3 auxin-responsive promoter; InterPro: IPR0 | 97.03 | |
| PLN02249 | 597 | indole-3-acetic acid-amido synthetase | 96.25 | |
| KOG3628 | 1363 | consensus Predicted AMP-binding protein [General f | 95.18 | |
| PF04443 | 365 | LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR | 91.89 | |
| PLN02247 | 606 | indole-3-acetic acid-amido synthetase | 81.62 | |
| PLN02620 | 612 | indole-3-acetic acid-amido synthetase | 80.36 |
| >KOG1176 consensus Acyl-CoA synthetase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.98 E-value=1.4e-32 Score=237.16 Aligned_cols=159 Identities=29% Similarity=0.399 Sum_probs=138.0
Q ss_pred ccceecccccCCccccceEEEccccCChhhHHHHHhhCCCCeEEcCCCCCcceeeeec-cCCc--------------ccc
Q 030653 16 SLLKTKIFLSNSLAFHSQIRTKSQMAEVRHHRPIPHTLPTRRLLLPSVLSSSSTCHSL-LPSV--------------VSS 80 (174)
Q Consensus 16 ~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~l~~~~p~~~i~~~yg~te~~~~~~~-~~~~--------------~~~ 80 (174)
.|.+...+....+.+++.+.++|.++++++++++++.+|+..+.+.||+||++..... .... ...
T Consensus 286 ~l~~~p~~~~~~l~sl~~v~~gga~~~~~~~~~~~~~l~~~~v~q~YGmTE~~~~~~~~~~~~e~k~~svG~~~~g~~~~ 365 (537)
T KOG1176|consen 286 MLAKSPIVKKYDLSSLRSVLSGGAPLSPATLEKVKERLPNVTVIQGYGMTEAGGLITSNDWGPERKPGSVGRLLPGVRVK 365 (537)
T ss_pred HHhcCCccCcccCCccEEEEecCCCCCHHHHHHHHHhCCCceEEEeeccccccCceeecCCCccCcccccCccccceEEE
Confidence 3445556777889999999999999999999999999999999999999999832222 1111 111
Q ss_pred cccccCcccccCCcCeEEe--CcccccccCCcccccccccCCCeEecCCeeee--CCeEEEEeccCCeEEECcEEeChHH
Q 030653 81 SLLIRTLSMWVAVLGSKFV--KLISAGYVGEQEVTSATLLPDGWMRTGDLCYE--DSFLFIVDGLKDLVKYKGCQVAPAE 156 (174)
Q Consensus 81 ~~~~~~~~~~~~~~Gel~v--~~v~~gY~~~~~~t~~~~~~~g~~~TGD~g~~--dG~l~~~GR~~d~i~~~G~~v~p~e 156 (174)
..+..+..++.++.|||++ ++++.||++||++|++.|+.+|||+|||+|++ ||+|+|.+|.+|+||.+|++|+|.|
T Consensus 366 v~~e~g~~l~~~~~GEI~vrg~~imkGY~~NpeaT~~~~~~~GW~~TGDiGy~D~DG~l~IvdR~KdlIk~~G~qv~P~E 445 (537)
T KOG1176|consen 366 VLDETGVSLGPNQTGEICVRGPQVMKGYLKNPEATKEAFDDDGWFHTGDLGYFDEDGYLYIVDRSKDLIKYGGEQVSPAE 445 (537)
T ss_pred eeCCCCCCCCCCCceEEEEECcccchhhcCChHHHHhhcccCCccccCceEEEcCCCeEEEecchhhheeeCCEEeCHHH
Confidence 1245567888899999999 99999999999999999977799999999999 9999999999999999999999999
Q ss_pred HHHHHhcCCCcceEEEeC
Q 030653 157 LEHLLLSHPEMVDAAVIP 174 (174)
Q Consensus 157 VE~~l~~~~~V~~~~Vvg 174 (174)
||++|..||.|.||||||
T Consensus 446 iE~vL~~hP~V~eaaVvg 463 (537)
T KOG1176|consen 446 IEAVLLTHPDVLEAAVVG 463 (537)
T ss_pred HHHHHHhCCCccEEEEEc
Confidence 999999999999999997
|
|
| >COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02614 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PLN02736 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >KOG1177 consensus Long chain fatty acid acyl-CoA ligase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02574 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >PLN02860 o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PTZ00342 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07769 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK09274 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PTZ00237 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02861 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PLN02387 long-chain-fatty-acid-CoA ligase family protein | Back alignment and domain information |
|---|
| >PLN02246 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >PRK06060 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05677 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >PLN02654 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK12476 putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PRK00174 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase | Back alignment and domain information |
|---|
| >PRK09088 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06145 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PLN02330 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >PRK07638 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12492 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PTZ00216 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07529 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >PLN02430 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PLN03051 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK06839 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07788 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05852 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK04319 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK03584 acetoacetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12583 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08316 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR02316 propion_prpE propionate--CoA ligase | Back alignment and domain information |
|---|
| >PRK08751 putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >KOG1256 consensus Long-chain acyl-CoA synthetases (AMP-forming) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK10946 entE enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >PRK08315 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK07787 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08314 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07786 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK13390 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07059 Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07514 malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK05857 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13382 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07656 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR01733 AA-adenyl-dom amino acid adenylation domain | Back alignment and domain information |
|---|
| >PRK10524 prpE propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK09192 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK12582 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07470 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06087 short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK06710 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK05850 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05605 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PLN03102 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK08974 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR03205 pimA dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >PRK08180 feruloyl-CoA synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06164 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05620 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06188 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12406 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR02262 benz_CoA_lig benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >PRK13391 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07798 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08276 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK06178 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07008 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK13383 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02479 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK13388 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07867 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08279 long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06187 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >KOG1175 consensus Acyl-CoA synthetase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07768 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08162 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06018 putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01923 menE O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PLN03052 acetate--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >KOG1180 consensus Acyl-CoA synthetase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] | Back alignment and domain information |
|---|
| >PRK08308 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase | Back alignment and domain information |
|---|
| >COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family | Back alignment and domain information |
|---|
| >KOG1179 consensus Very long-chain acyl-CoA synthetase/fatty acid transporter [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03335 F390_ftsA coenzyme F390 synthetase | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00297 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR02304 aden_form_hyp probable adenylate-forming enzyme | Back alignment and domain information |
|---|
| >KOG3628 consensus Predicted AMP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03321 GH3: GH3 auxin-responsive promoter; InterPro: IPR004993 Transcription of the gene family, GH3, has been shown to be specifically induced by the plant hormone auxin | Back alignment and domain information |
|---|
| >PLN02249 indole-3-acetic acid-amido synthetase | Back alignment and domain information |
|---|
| >KOG3628 consensus Predicted AMP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria | Back alignment and domain information |
|---|
| >PLN02247 indole-3-acetic acid-amido synthetase | Back alignment and domain information |
|---|
| >PLN02620 indole-3-acetic acid-amido synthetase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 174 | ||||
| 4g37_A | 555 | Structure Of Cross-Linked Firefly Luciferase In Sec | 2e-19 | ||
| 1ba3_A | 550 | Firefly Luciferase In Complex With Bromoform Length | 7e-18 | ||
| 3iep_A | 551 | Firefly Luciferase Apo Structure (P41 Form) Length | 7e-18 | ||
| 4g36_A | 555 | Photinus Pyralis Luciferase In The Adenylate-Formin | 7e-18 | ||
| 3qya_A | 582 | Crystal Structure Of A Red-Emitter Mutant Of Lampyr | 8e-17 | ||
| 2d1q_A | 548 | Crystal Structure Of The Thermostable Japanese Fire | 8e-15 | ||
| 2d1s_A | 548 | Crystal Structure Of The Thermostable Japanese Fire | 8e-15 | ||
| 2d1t_A | 548 | Crystal Structure Of The Thermostable Japanese Fire | 8e-15 | ||
| 3a9u_A | 536 | Crystal Structures And Enzymatic Mechanisms Of A Po | 2e-14 | ||
| 3tsy_A | 979 | 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr | 7e-13 | ||
| 1ult_A | 541 | Crystal Structure Of Tt0168 From Thermus Thermophil | 2e-11 | ||
| 3nyq_A | 505 | Malonyl-Coa Ligase Ternary Product Complex With Met | 6e-07 | ||
| 3g7s_A | 549 | Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Li | 7e-07 | ||
| 1mdb_A | 539 | Crystal Structure Of Dhbe In Complex With Dhb-adeny | 1e-06 | ||
| 3r44_A | 517 | Mycobacterium Tuberculosis Fatty Acyl Coa Synthetas | 5e-06 | ||
| 3pbk_A | 583 | Structural And Functional Studies Of Fatty Acyl-Ade | 5e-06 | ||
| 1md9_A | 539 | Crystal Structure Of Dhbe In Complex With Dhb And A | 7e-06 | ||
| 3etc_A | 580 | 2.1 A Structure Of Acyl-Adenylate Synthetase From M | 2e-05 | ||
| 2wd9_A | 569 | Crystal Structure Of Human Acyl-coa Synthetase Medi | 2e-05 | ||
| 3b7w_A | 570 | Crystal Structure Of Human Acyl-Coa Synthetase Medi | 2e-05 | ||
| 3o82_A | 544 | Structure Of Base N-Terminal Domain From Acinetobac | 1e-04 | ||
| 3ivr_A | 509 | Crystal Structure Of Putative Long-Chain-Fatty-Acid | 1e-04 | ||
| 2v7b_A | 529 | Crystal Structures Of A Benzoate Coa Ligase From Bu | 6e-04 |
| >pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 | Back alignment and structure |
|
| >pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 | Back alignment and structure |
| >pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 | Back alignment and structure |
| >pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 | Back alignment and structure |
| >pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 | Back alignment and structure |
| >pdb|2D1Q|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With Mgatp Length = 548 | Back alignment and structure |
| >pdb|2D1S|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With High-Energy Intermediate Analogue Length = 548 | Back alignment and structure |
| >pdb|2D1T|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Red-Color Emission S286n Mutant Complexed With High-Energy Intermediate Analogue Length = 548 | Back alignment and structure |
| >pdb|3A9U|A Chain A, Crystal Structures And Enzymatic Mechanisms Of A Populus Tomentosa 4- Coumarate--Coa Ligase Length = 536 | Back alignment and structure |
| >pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 | Back alignment and structure |
| >pdb|1ULT|A Chain A, Crystal Structure Of Tt0168 From Thermus Thermophilus Hb8 Length = 541 | Back alignment and structure |
| >pdb|3NYQ|A Chain A, Malonyl-Coa Ligase Ternary Product Complex With Methylmalonyl-Coa And Amp Bound Length = 505 | Back alignment and structure |
| >pdb|3G7S|A Chain A, Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Ligase (Fadd1) From Archaeoglobus Fulgidus Length = 549 | Back alignment and structure |
| >pdb|1MDB|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb-adenylate Length = 539 | Back alignment and structure |
| >pdb|3R44|A Chain A, Mycobacterium Tuberculosis Fatty Acyl Coa Synthetase Length = 517 | Back alignment and structure |
| >pdb|3PBK|A Chain A, Structural And Functional Studies Of Fatty Acyl-Adenylate Ligases From E. Coli And L. Pneumophila Length = 583 | Back alignment and structure |
| >pdb|1MD9|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb And Amp Length = 539 | Back alignment and structure |
| >pdb|3ETC|A Chain A, 2.1 A Structure Of Acyl-Adenylate Synthetase From Methanosarcina Acetivorans Containing A Link Between Lys256 And Cys298 Length = 580 | Back alignment and structure |
| >pdb|2WD9|A Chain A, Crystal Structure Of Human Acyl-coa Synthetase Medium-chain Family Member 2a (l64p Mutation) In Complex With Ibuprofen Length = 569 | Back alignment and structure |
| >pdb|3B7W|A Chain A, Crystal Structure Of Human Acyl-Coa Synthetase Medium-Chain Family Member 2a, With L64p Mutation Length = 570 | Back alignment and structure |
| >pdb|3O82|A Chain A, Structure Of Base N-Terminal Domain From Acinetobacter Baumannii Bound To 5'-O-[n-(2,3-Dihydroxybenzoyl)sulfamoyl] Adenosine Length = 544 | Back alignment and structure |
| >pdb|3IVR|A Chain A, Crystal Structure Of Putative Long-Chain-Fatty-Acid Coa Ligase From Rhodopseudomonas Palustris Cga009 Length = 509 | Back alignment and structure |
| >pdb|2V7B|A Chain A, Crystal Structures Of A Benzoate Coa Ligase From Burkholderia Xenovorans Lb400 Length = 529 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 174 | |||
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 3e-33 | |
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 6e-33 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 2e-32 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 3e-32 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 1e-25 | |
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 1e-19 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 6e-19 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 8e-18 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 1e-17 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 1e-17 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 3e-17 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 5e-17 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 2e-16 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 3e-16 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 5e-14 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 3e-12 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 7e-09 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 2e-08 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 1e-07 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 6e-06 |
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 | Back alignment and structure |
|---|
Score = 123 bits (311), Expect = 3e-33
Identities = 38/72 (52%), Positives = 50/72 (69%), Gaps = 2/72 (2%)
Query: 105 GYVGEQEVTSATLLPDGWMRTGDLCY--EDSFLFIVDGLKDLVKYKGCQVAPAELEHLLL 162
GY+ T+ T+ DGW+ TGD+ +D LFIVD LK+L+KYKG QVAPAELE LL+
Sbjct: 442 GYLNNPAATAETIDKDGWLHTGDIGLIDDDDELFIVDRLKELIKYKGFQVAPAELEALLI 501
Query: 163 SHPEMVDAAVIP 174
HP++ D AV+
Sbjct: 502 GHPDITDVAVVA 513
|
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 | Back alignment and structure |
|---|
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 174 | |||
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 99.97 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.97 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.97 | |
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 99.97 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.97 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 99.96 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 99.96 | |
| 4gr5_A | 570 | Non-ribosomal peptide synthetase; MBTH-like domain | 99.96 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 99.96 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 99.96 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 99.96 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 99.96 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 99.96 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 99.96 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 99.96 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 99.95 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 99.95 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 99.95 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 99.95 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 99.95 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 99.95 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 99.95 | |
| 1pg4_A | 652 | Acetyl-COA synthetase; AMP-forming, adenylate-form | 99.95 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 99.95 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 99.95 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 99.94 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 99.94 | |
| 1ry2_A | 663 | Acetyl-coenzyme A synthetase 1, acyl-activating en | 99.94 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 99.93 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 99.93 | |
| 3qov_A | 436 | Phenylacetate-coenzyme A ligase; acetyl-COA synthe | 99.87 | |
| 4gs5_A | 358 | Acyl-COA synthetase (AMP-forming)/AMP-acid ligase | 99.86 | |
| 2y4o_A | 443 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.84 | |
| 2y27_A | 437 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.83 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 99.79 | |
| 3hgu_A | 369 | EHPF; phenazine, antibiotic, biosynthetic protein; | 98.73 | |
| 4b2g_A | 609 | GH3-1 auxin conjugating enzyme; signaling protein, | 98.31 | |
| 4eql_A | 581 | 4-substituted benzoates-glutamate ligase GH3.12; f | 98.26 | |
| 4epl_A | 581 | Jasmonic acid-amido synthetase JAR1; ANL adenylati | 98.12 |
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* | Back alignment and structure |
|---|
Probab=99.97 E-value=1.7e-31 Score=229.40 Aligned_cols=151 Identities=33% Similarity=0.468 Sum_probs=131.0
Q ss_pred ccCCccccceEEEccccCChhhHHHHHhhCCCCeEEcCCCCCcceeeeec-------------------cCCccccccc-
Q 030653 24 LSNSLAFHSQIRTKSQMAEVRHHRPIPHTLPTRRLLLPSVLSSSSTCHSL-------------------LPSVVSSSLL- 83 (174)
Q Consensus 24 ~~~~~~~~~~i~~~~~~~~~~~~~~l~~~~p~~~i~~~yg~te~~~~~~~-------------------~~~~~~~~~~- 83 (174)
....+..++.+.+||+.+++++.+.+++.+|++++++.||+||++.+... .+.......+
T Consensus 292 ~~~~l~~lr~i~~gGe~l~~~~~~~~~~~~~~~~l~~~YG~TE~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~i~d~ 371 (536)
T 3ni2_A 292 DKHDLSSLRMIKSGGAPLGKELEDTVRAKFPQARLGQGYGMTEAGPVLAMCLAFAKEPFDIKPGACGTVVRNAEMKIVDP 371 (536)
T ss_dssp GGSCCTTCCEEEEESSCCCHHHHHHHHHHCTTSEEEEEEECGGGSSEEEECGGGSSSCCCCCTTCCCEECSSCEEEEECT
T ss_pred ccCCCccceEEEECCCCCCHHHHHHHHHHCCCCCccccccccccchhhhcccccCCccccCCCCCeeEeCCCcEEEEEeC
Confidence 34456779999999999999999999999999999999999998743221 1222222233
Q ss_pred ccCcccccCCcCeEEe--CcccccccCCcccccccccCCCeEecCCeeee--CCeEEEEeccCCeEEECcEEeChHHHHH
Q 030653 84 IRTLSMWVAVLGSKFV--KLISAGYVGEQEVTSATLLPDGWMRTGDLCYE--DSFLFIVDGLKDLVKYKGCQVAPAELEH 159 (174)
Q Consensus 84 ~~~~~~~~~~~Gel~v--~~v~~gY~~~~~~t~~~~~~~g~~~TGD~g~~--dG~l~~~GR~~d~i~~~G~~v~p~eVE~ 159 (174)
..+..++.++.|||++ |++++|||++|+.|++.|+.+|||+|||+|++ ||+|+|+||+||+||++|++|+|.|||+
T Consensus 372 ~~~~~~~~g~~GEl~v~g~~v~~GY~~~p~~t~~~~~~~g~~~TGDl~~~~~dG~l~~~GR~dd~ik~~G~~v~p~eIE~ 451 (536)
T 3ni2_A 372 ETGASLPRNQPGEICIRGDQIMKGYLNDPEATSRTIDKEGWLHTGDIGYIDDDDELFIVDRLKELIKYKGFQVAPAELEA 451 (536)
T ss_dssp TTCCBCCTTCCEEEEEESTTSCSEETTCHHHHHHHBCTTSCEEEEEEEEECTTSCEEEEEECSCCEEETTEEECHHHHHH
T ss_pred CCCcCCCCCCccEEEEeCcccchhhcCChhHHHhhccCCCceEcccEEEEcCCceEEEEecccceEEECCEEECHHHHHH
Confidence 3356778899999999 99999999999999999988999999999999 9999999999999999999999999999
Q ss_pred HHhcCCCcceEEEeC
Q 030653 160 LLLSHPEMVDAAVIP 174 (174)
Q Consensus 160 ~l~~~~~V~~~~Vvg 174 (174)
+|.+||+|.+|+|+|
T Consensus 452 ~l~~~p~V~~a~Vv~ 466 (536)
T 3ni2_A 452 LLIAHPEISDAAVVG 466 (536)
T ss_dssp HHHTSTTEEEEEEEE
T ss_pred HHHhCCCcceEEEEe
Confidence 999999999999985
|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* | Back alignment and structure |
|---|
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* | Back alignment and structure |
|---|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* | Back alignment and structure |
|---|
| >4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* | Back alignment and structure |
|---|
| >1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} | Back alignment and structure |
|---|
| >1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* | Back alignment and structure |
|---|
| >4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A | Back alignment and structure |
|---|
| >3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* | Back alignment and structure |
|---|
| >4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} | Back alignment and structure |
|---|
| >4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* | Back alignment and structure |
|---|
| >4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 174 | ||||
| d1v25a_ | 534 | e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 | 3e-18 | |
| d1lcia_ | 541 | e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali | 1e-17 | |
| d1ry2a_ | 640 | e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast | 6e-16 | |
| d1pg4a_ | 643 | e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en | 1e-15 | |
| d1amua_ | 514 | e.23.1.1 (A:) Phenylalanine activating domain of g | 3e-13 | |
| d3cw9a1 | 503 | e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc | 1e-11 | |
| d1mdba_ | 536 | e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B | 9e-11 |
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Long chain fatty acid-CoA ligase TT0168 species: Thermus thermophilus [TaxId: 274]
Score = 78.8 bits (193), Expect = 3e-18
Identities = 31/74 (41%), Positives = 49/74 (66%), Gaps = 2/74 (2%)
Query: 102 ISAGYVGEQEVTSATLLPDGWMRTGDLCY--EDSFLFIVDGLKDLVKYKGCQVAPAELEH 159
I+ GY G +E T + L PDG+ RTGD+ E+ ++ I D LKDL+K G ++ +LE+
Sbjct: 386 ITGGYYGNEEATRSALTPDGFFRTGDIAVWDEEGYVEIKDRLKDLIKSGGEWISSVDLEN 445
Query: 160 LLLSHPEMVDAAVI 173
L+ HP++ +AAV+
Sbjct: 446 ALMGHPKVKEAAVV 459
|
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 174 | |||
| d1lcia_ | 541 | Luciferase {Firefly (Photinus pyralis) [TaxId: 705 | 99.95 | |
| d1pg4a_ | 643 | Acetyl-CoA synthetase {Salmonella enterica [TaxId: | 99.94 | |
| d1v25a_ | 534 | Long chain fatty acid-CoA ligase TT0168 {Thermus t | 99.94 | |
| d1ry2a_ | 640 | Acetyl-CoA synthetase {Baker's yeast (Saccharomyce | 99.93 | |
| d1amua_ | 514 | Phenylalanine activating domain of gramicidin synt | 99.93 | |
| d1mdba_ | 536 | Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil | 99.9 | |
| d3cw9a1 | 503 | 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId | 99.88 |
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Luciferase species: Firefly (Photinus pyralis) [TaxId: 7054]
Probab=99.95 E-value=2.3e-28 Score=205.56 Aligned_cols=154 Identities=31% Similarity=0.471 Sum_probs=126.7
Q ss_pred cccccCCccccceEEEccccCChhhHHHHHhhCCCCeEEcCCCCCcceee--------------eeccCCcccccccc-c
Q 030653 21 KIFLSNSLAFHSQIRTKSQMAEVRHHRPIPHTLPTRRLLLPSVLSSSSTC--------------HSLLPSVVSSSLLI-R 85 (174)
Q Consensus 21 ~~~~~~~~~~~~~i~~~~~~~~~~~~~~l~~~~p~~~i~~~yg~te~~~~--------------~~~~~~~~~~~~~~-~ 85 (174)
.......+..++.+.+|++.+++...+.+.+.++...+++.||+||++.+ +.+.|+......+. .
T Consensus 296 ~~~~~~~~~~l~~v~~gG~~~~~~~~~~~~~~~~~~~~~~~YG~TE~~~~~~~~~~~~~~~~svG~p~~~~~~~i~d~d~ 375 (541)
T d1lcia_ 296 TLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDT 375 (541)
T ss_dssp SCGGGSCCTTCCEEECTTCCCCHHHHHHHHHHTTCSCCBCEECCGGGSSCSEECCCC---CCCCBEECTTCEEEEECTTT
T ss_pred ccccccccccceEEEecccccccccccccccccCCceeeecCCccccCceEEecCcccCCCCccccccCCCEEEEEECCC
Confidence 33445566789999999999999999999999998889999999998743 33333333333332 3
Q ss_pred CcccccCCcCeEEe--CcccccccCCcccccccccCCCeEecCCeeee--CCeEEEEeccCCeEEECcEEeChHHHHHHH
Q 030653 86 TLSMWVAVLGSKFV--KLISAGYVGEQEVTSATLLPDGWMRTGDLCYE--DSFLFIVDGLKDLVKYKGCQVAPAELEHLL 161 (174)
Q Consensus 86 ~~~~~~~~~Gel~v--~~v~~gY~~~~~~t~~~~~~~g~~~TGD~g~~--dG~l~~~GR~~d~i~~~G~~v~p~eVE~~l 161 (174)
+..++.++.|||++ |+++.||+++++.+...+..++||+|||+|++ ||+++++||.||+||++|++|+|.+||++|
T Consensus 376 ~~~~~~g~~Gel~v~g~~~~~gY~~~~~~~~~~~~~~~~~~TGDl~~~~~~G~~~~~GR~~d~i~~~G~~v~~~~IE~~l 455 (541)
T d1lcia_ 376 GKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL 455 (541)
T ss_dssp CCBCCTTCCEEEEEESTTSCSEETTBHHHHHHHBCTTSCEEEEEEEEECTTCCEEEC-----CEEETTEEECHHHHHHHH
T ss_pred CcCCCCCCeEEEEEccCccCCeeCCChhhhhhcccCCccccCCCeeEEcCCeEEEEeeeecCEEEECCEEECHHHHHHHH
Confidence 45677789999999 99999999999988888878999999999999 999999999999999999999999999999
Q ss_pred hcCCCcceEEEeC
Q 030653 162 LSHPEMVDAAVIP 174 (174)
Q Consensus 162 ~~~~~V~~~~Vvg 174 (174)
.+||+|.+|+|+|
T Consensus 456 ~~~p~V~~~~v~~ 468 (541)
T d1lcia_ 456 LQHPNIFDAGVAG 468 (541)
T ss_dssp HTSTTEEEEEEEE
T ss_pred HhCCCccEEEEEE
Confidence 9999999999875
|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|