Citrus Sinensis ID: 030660


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MDQELPTTMDHELLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHNAVRNKHENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLNKCLSIV
cccHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccccHHHHHHHHcccccccc
ccccccccccHHHHHHHHHccHHHHccccccccHHHHHHHcccHHHHHHHHHHcccccccccccHHHHHHccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccccEEEEEEEcccEEEc
mdqelpttmdHELLNVLRRRDSLlrknnwkgetplhiaarvgdpAIVSTILKYapaitngtesepesllritddegntplhnavrNKHENVVRMLVKkdriplgylnnaeqtplsiaidsslTDIACFIidqrpeslnhrlpeELTLLHSAVMRQNYGEPMIFISLNKCLSIV
mdqelpttmdhellNVLRRRDSLlrknnwkgetplhiaarvgdPAIVSTILKYAPAitngtesepeSLLRITDdegntplhnavrnkhenvVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLNKCLSIV
MDQELPTTMDHELLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHNAVRNKHENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLNKCLSIV
************LLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAIT***************************NKHENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLNKCLS**
MDQELPTTMDHELLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHNAVRNKHENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLNKCLSIV
********MDHELLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHNAVRNKHENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLNKCLSIV
**QELPTTMDHELLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHNAVRNKHENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLNKCLSIV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQELPTTMDHELLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHNAVRNKHENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLNKCLSIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
Q96NW4 1050 Ankyrin repeat domain-con yes no 0.526 0.086 0.302 1e-06
Q5REW9 1050 Ankyrin repeat domain-con yes no 0.526 0.086 0.302 2e-06
Q5ZLC8 1073 Serine/threonine-protein yes no 0.780 0.125 0.267 2e-06
Q4UMH61179 Putative ankyrin repeat p yes no 0.751 0.110 0.305 3e-06
P97819 807 85/88 kDa calcium-indepen no no 0.456 0.097 0.333 4e-06
P97570 807 85/88 kDa calcium-indepen yes no 0.456 0.097 0.333 4e-06
Q6P6B7361 Ankyrin repeat domain-con no no 0.583 0.279 0.303 7e-06
Q14DN9465 Ankyrin repeat and death no no 0.589 0.219 0.354 1e-05
Q9P2R3 1169 Ankyrin repeat and FYVE d no no 0.791 0.117 0.272 1e-05
Q54KA7 986 Ankyrin repeat, PH and SE yes no 0.508 0.089 0.316 1e-05
>sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 18/109 (16%)

Query: 13  LLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRIT 72
           L+++L  + +++   ++ G TPLH+A + G  ++   +L Y  +              + 
Sbjct: 478 LIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASA------------EVQ 525

Query: 73  DDEGNTPLHNAVRNKHENVVRMLVKKD----RIPLGYLNNAEQTPLSIA 117
           D+ GNTPLH A    HE+ V+ LV  D    R+ +G  N    TPL IA
Sbjct: 526 DNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIG--NEKGDTPLHIA 572




May be a Rab21 guanine exchange factor and regulate endosome dynamics.
Homo sapiens (taxid: 9606)
>sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 Back     alignment and function description
>sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 Back     alignment and function description
>sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 Back     alignment and function description
>sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=2 Back     alignment and function description
>sp|Q9P2R3|ANFY1_HUMAN Ankyrin repeat and FYVE domain-containing protein 1 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
147799695 595 hypothetical protein VITISV_033922 [Viti 0.780 0.226 0.369 1e-17
302143222 617 unnamed protein product [Vitis vinifera] 0.820 0.230 0.406 2e-16
147820412 624 hypothetical protein VITISV_004974 [Viti 0.820 0.227 0.406 2e-16
147798514 1884 hypothetical protein VITISV_007944 [Viti 0.809 0.074 0.360 4e-14
147826716 545 hypothetical protein VITISV_009182 [Viti 0.774 0.245 0.372 4e-14
147865209 563 hypothetical protein VITISV_038601 [Viti 0.774 0.238 0.373 4e-14
296087900 589 unnamed protein product [Vitis vinifera] 0.734 0.215 0.345 5e-14
147794488 625 hypothetical protein VITISV_007072 [Viti 0.734 0.203 0.345 6e-14
297745183270 unnamed protein product [Vitis vinifera] 0.820 0.525 0.363 9e-14
255547568 679 ankyrin repeat-containing protein, putat 0.791 0.201 0.328 1e-13
>gi|147799695|emb|CAN77325.1| hypothetical protein VITISV_033922 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 87/149 (58%), Gaps = 14/149 (9%)

Query: 23  LLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHN 82
           LL + N KG+TPLH A+R G P +V   +  + A+ +  E+ P +LLR+ + EG+T LH 
Sbjct: 43  LLSEANMKGDTPLHTASRTGCPRMVELFISCSEALCDDIENAPRNLLRMVNQEGDTALHV 102

Query: 83  AVRNK-------------HENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFI 129
           AVRN              H +VV++LVK D   L   N A ++PL +A++  L D   ++
Sbjct: 103 AVRNGHLDTALHAAVKYDHLDVVKLLVKADIELLHMDNKANESPLYLAVERGLFDFTKYM 162

Query: 130 IDQRPESLNHRLPEELTLLHSAVMRQNYG 158
           +++ P+  +HR  + LT LH+AV+R + G
Sbjct: 163 LNKCPKC-SHRGTKGLTALHAAVVRTHQG 190




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|302143222|emb|CBI20517.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147820412|emb|CAN63354.1| hypothetical protein VITISV_004974 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147798514|emb|CAN74381.1| hypothetical protein VITISV_007944 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147826716|emb|CAN61889.1| hypothetical protein VITISV_009182 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865209|emb|CAN79828.1| hypothetical protein VITISV_038601 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087900|emb|CBI35183.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147794488|emb|CAN67080.1| hypothetical protein VITISV_007072 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745183|emb|CBI39175.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547568|ref|XP_002514841.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223545892|gb|EEF47395.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
TAIR|locus:2128771 641 AT4G03450 "AT4G03450" [Arabido 0.774 0.209 0.323 8.9e-09
TAIR|locus:2045233 662 AT2G31820 [Arabidopsis thalian 0.630 0.164 0.346 1.8e-07
FB|FBgn0016920 1726 nompC "no mechanoreceptor pote 0.809 0.081 0.308 2.2e-07
TAIR|locus:2128781 677 AT4G03460 "AT4G03460" [Arabido 0.589 0.150 0.342 3e-07
TAIR|locus:2020833 616 AT1G03670 "AT1G03670" [Arabido 0.739 0.207 0.284 8.8e-07
TAIR|locus:2031948 627 AT1G05640 "AT1G05640" [Arabido 0.566 0.156 0.351 1.7e-06
UNIPROTKB|F1RZ13 1153 ANKS1A "Uncharacterized protei 0.797 0.119 0.282 1.9e-06
FB|FBgn0014018 971 Rel "Relish" [Drosophila melan 0.670 0.119 0.277 3e-06
WB|WBGene00185078240 F40G9.17 [Caenorhabditis elega 0.849 0.612 0.302 3.3e-06
CGD|CAL0003397249 orf19.5961 [Candida albicans ( 0.768 0.534 0.240 5.2e-06
TAIR|locus:2128771 AT4G03450 "AT4G03450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 142 (55.0 bits), Expect = 8.9e-09, P = 8.9e-09
 Identities = 45/139 (32%), Positives = 71/139 (51%)

Query:    23 LLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNG-TESEPE--SLLRITDDEGNTP 79
             LL + N K + PLH AA  G  A+V   +     I++G +E E E  +L  + D +GNT 
Sbjct:    97 LLLETNSKDQIPLHAAAAAGRLAVVEAFVARVNEISDGLSEEERERVNLYAMKDIDGNTA 156

Query:    80 LHNAVRNKHENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDS-SLTDI-ACFIIDQRPESL 137
             LH A++  H      LVK + +     NN   +PL  AI + SLT + A   +  +  +L
Sbjct:   157 LHLALKGGHLKTAACLVKANHLASFLANNHGVSPLFTAIIAGSLTLVEAMMYVPGQTCNL 216

Query:   138 NHRLPEELTLLHSAVMRQN 156
               +L    +L+H+A+  +N
Sbjct:   217 ASKLEGRKSLVHAALKAKN 235




GO:0000165 "MAPK cascade" evidence=RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0009581 "detection of external stimulus" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0045088 "regulation of innate immune response" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0016920 nompC "no mechanoreceptor potential C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZ13 ANKS1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0014018 Rel "Relish" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00185078 F40G9.17 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
CGD|CAL0003397 orf19.5961 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00027408001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (668 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-08
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-05
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 3e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 7e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.002
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
smart0024830 smart00248, ANK, ankyrin repeats 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 73.2 bits (180), Expect = 3e-17
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 28  NWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHNAVRNK 87
           +  G TPLH+AA  G   +V  +L+    +               D++G TPLH A +N 
Sbjct: 4   DEDGRTPLHLAASNGHLEVVKLLLENGADVN------------AKDNDGRTPLHLAAKNG 51

Query: 88  HENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTL 147
           H  +V++L++K        +    TPL +A  +   D+   ++      +N R  +  T 
Sbjct: 52  HLEIVKLLLEKGADVN-ARDKDGNTPLHLAARNGNLDVVKLLLK-HGADVNARDKDGRTP 109

Query: 148 LHSAVMRQN 156
           LH A    +
Sbjct: 110 LHLAAKNGH 118


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.98
PHA02791284 ankyrin-like protein; Provisional 99.97
PHA02875 413 ankyrin repeat protein; Provisional 99.97
PHA02874 434 ankyrin repeat protein; Provisional 99.96
PHA02791284 ankyrin-like protein; Provisional 99.96
PHA02878 477 ankyrin repeat protein; Provisional 99.96
PHA02878 477 ankyrin repeat protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02875 413 ankyrin repeat protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA03100 480 ankyrin repeat protein; Provisional 99.96
PHA02874 434 ankyrin repeat protein; Provisional 99.96
PHA03100 480 ankyrin repeat protein; Provisional 99.96
PHA02946 446 ankyin-like protein; Provisional 99.96
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.95
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.95
PHA02795 437 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA03095 471 ankyrin-like protein; Provisional 99.95
PHA03095 471 ankyrin-like protein; Provisional 99.95
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.95
KOG0508 615 consensus Ankyrin repeat protein [General function 99.95
PHA02798 489 ankyrin-like protein; Provisional 99.95
PHA02989 494 ankyrin repeat protein; Provisional 99.95
PHA02876 682 ankyrin repeat protein; Provisional 99.94
PHA02946 446 ankyin-like protein; Provisional 99.94
PHA02876 682 ankyrin repeat protein; Provisional 99.94
PHA02743166 Viral ankyrin protein; Provisional 99.94
KOG0510 929 consensus Ankyrin repeat protein [General function 99.94
PHA02798 489 ankyrin-like protein; Provisional 99.94
PHA02795 437 ankyrin-like protein; Provisional 99.94
PHA02741169 hypothetical protein; Provisional 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.93
PHA02859209 ankyrin repeat protein; Provisional 99.93
PHA02989 494 ankyrin repeat protein; Provisional 99.93
PHA02736154 Viral ankyrin protein; Provisional 99.93
PHA02730 672 ankyrin-like protein; Provisional 99.92
PHA02730 672 ankyrin-like protein; Provisional 99.92
KOG0508 615 consensus Ankyrin repeat protein [General function 99.92
PHA02917 661 ankyrin-like protein; Provisional 99.91
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.91
PHA02884 300 ankyrin repeat protein; Provisional 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
PHA02917 661 ankyrin-like protein; Provisional 99.9
PHA02884 300 ankyrin repeat protein; Provisional 99.89
KOG0514452 consensus Ankyrin repeat protein [General function 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.89
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.88
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.88
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.88
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.88
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.86
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.85
PHA02792 631 ankyrin-like protein; Provisional 99.85
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.85
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.85
PHA02792 631 ankyrin-like protein; Provisional 99.84
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.84
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.83
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.82
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.82
PHA02741169 hypothetical protein; Provisional 99.82
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.81
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.76
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.76
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.74
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.73
KOG0514452 consensus Ankyrin repeat protein [General function 99.69
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.64
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.63
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.63
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.62
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.61
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.6
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.59
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.59
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.58
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.57
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.57
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.57
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.55
KOG0515 752 consensus p53-interacting protein 53BP/ASPP, conta 99.54
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.53
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.47
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.46
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.1
PF1360630 Ank_3: Ankyrin repeat 99.09
PF1360630 Ank_3: Ankyrin repeat 99.09
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.03
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.01
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.95
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.95
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.94
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.92
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.91
KOG0522 560 consensus Ankyrin repeat protein [General function 98.81
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.8
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.79
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.77
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.73
KOG0522 560 consensus Ankyrin repeat protein [General function 98.68
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.65
KOG2384223 consensus Major histocompatibility complex protein 98.49
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.47
KOG0511 516 consensus Ankyrin repeat protein [General function 98.41
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.35
KOG2384 223 consensus Major histocompatibility complex protein 98.27
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.25
KOG0511 516 consensus Ankyrin repeat protein [General function 98.19
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.16
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.07
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 97.78
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.67
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.6
KOG2505591 consensus Ankyrin repeat protein [General function 97.44
KOG2505591 consensus Ankyrin repeat protein [General function 97.27
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.08
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.25
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.82
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 92.17
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=3.5e-34  Score=183.71  Aligned_cols=149  Identities=23%  Similarity=0.290  Sum_probs=137.9

Q ss_pred             hHHHHHHHH-hcccchhccCCCCCcHHHHHHHhCCHHHHHHHHhh-CcccCCCCCCCCCccccccCCCCCcHHHHHHhcC
Q 030660           10 DHELLNVLR-RRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKY-APAITNGTESEPESLLRITDDEGNTPLHNAVRNK   87 (173)
Q Consensus        10 ~~~~~~~l~-~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~-~~~~~~~~~~~~~~~~~~~~~~g~t~l~~a~~~~   87 (173)
                      +.+++.||+ ..+..+|..|..||||||+|++.|+.++|+.|+.. |+++            +..+..|.||||+|+..|
T Consensus        50 ~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~adv------------na~tn~G~T~LHyAagK~  117 (226)
T KOG4412|consen   50 HVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADV------------NATTNGGQTCLHYAAGKG  117 (226)
T ss_pred             chhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCc------------ceecCCCcceehhhhcCC
Confidence            578999998 56778899999999999999999999999999988 8775            467789999999999999


Q ss_pred             CHHHHHHHHhcCCCCCCCCCCCCCCHHHHHHhcCcHHHHHHHHhcCCCcccccCCCCCcHHHHHHHhCCCcHHHHHHhcc
Q 030660           88 HENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLN  167 (173)
Q Consensus        88 ~~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll~~~  167 (173)
                      +.+++.+|+++|+.+ ..+|..|.||||-|+..|.++++++|+..+ +.+|..|.+|+||||.|..-|+.++...|+.+|
T Consensus       118 r~eIaqlLle~ga~i-~~kD~~~qtplHRAAavGklkvie~Li~~~-a~~n~qDk~G~TpL~~al~e~~~d~a~lLV~~g  195 (226)
T KOG4412|consen  118 RLEIAQLLLEKGALI-RIKDKQGQTPLHRAAAVGKLKVIEYLISQG-APLNTQDKYGFTPLHHALAEGHPDVAVLLVRAG  195 (226)
T ss_pred             hhhHHHHHHhcCCCC-cccccccCchhHHHHhccchhhHHHHHhcC-CCCCcccccCccHHHHHHhccCchHHHHHHHhc
Confidence            999999999999888 999999999999999999999999999999 999999999999999998889999999999999


Q ss_pred             cccCC
Q 030660          168 KCLSI  172 (173)
Q Consensus       168 ~~~~~  172 (173)
                      |++.+
T Consensus       196 Ad~~~  200 (226)
T KOG4412|consen  196 ADTDR  200 (226)
T ss_pred             cceee
Confidence            98754



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-06
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-06
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-06
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 6e-06
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 7e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 7e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-05
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-05
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-05
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-05
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-05
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-05
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 8e-05
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 9e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-04
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-04
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 2e-04
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-04
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-04
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-04
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-04
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 4e-04
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 4e-04
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 5e-04
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 7e-04
3kea_A285 Structure Function Studies Of Vaccinia Virus Host-R 9e-04
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 39/119 (32%), Positives = 56/119 (47%), Gaps = 21/119 (17%) Query: 12 ELLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRI 71 E++ VL + + + + G TPLH+AAR G IV +LK + Sbjct: 49 EIVEVLLKAGADVNAKDKDGYTPLHLAAREGHLEIVEVLLKAGADVN------------A 96 Query: 72 TDDEGNTPLHNAVRNKHENVVRMLVKKDRIPLGYLNNAE----QTPLSIAIDSSLTDIA 126 D +G TPLH A R H +V +L+K G NA+ +TP +AID+ DIA Sbjct: 97 KDKDGYTPLHLAAREGHLEIVEVLLKA-----GADVNAQDKFGKTPFDLAIDNGNEDIA 150
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3KEA|A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function Length = 285 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-09
2etb_A256 Transient receptor potential cation channel subfam 8e-13
2etb_A256 Transient receptor potential cation channel subfam 5e-08
2etb_A 256 Transient receptor potential cation channel subfam 6e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-11
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-08
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-08
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-08
2pnn_A273 Transient receptor potential cation channel subfa 1e-11
2pnn_A273 Transient receptor potential cation channel subfa 1e-10
2pnn_A273 Transient receptor potential cation channel subfa 3e-10
2pnn_A 273 Transient receptor potential cation channel subfa 1e-09
2pnn_A273 Transient receptor potential cation channel subfa 1e-05
2rfa_A232 Transient receptor potential cation channel subfa 2e-11
2rfa_A232 Transient receptor potential cation channel subfa 8e-11
2rfa_A232 Transient receptor potential cation channel subfa 8e-10
2rfa_A232 Transient receptor potential cation channel subfa 2e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-06
3jxi_A 260 Vanilloid receptor-related osmotically activated p 1e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-11
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-09
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-08
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-07
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-05
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-10
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 3e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-08
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-07
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-09
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-10
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-06
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-06
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-08
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-08
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-08
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 6e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-09
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-09
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-04
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 3e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-08
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 4e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-08
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-04
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-04
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-09
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-07
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-07
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
 Score = 63.7 bits (156), Expect = 5e-13
 Identities = 28/133 (21%), Positives = 53/133 (39%), Gaps = 21/133 (15%)

Query: 31  GETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHNAVRNKHEN 90
           G TPLH+A   G  A V  + +      + T     S+L+ T+  G+T LH A  + +  
Sbjct: 78  GNTPLHLACEQGCLASVGVLTQ------SCTTPHLHSILKATNYNGHTCLHLASIHGYLG 131

Query: 91  VVRMLVK-------KDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPE 143
           +V +LV        ++           +T L +A+D    D+   ++    + +N    +
Sbjct: 132 IVELLVSLGADVNAQE-------PCNGRTALHLAVDLQNPDLVSLLLKCGAD-VNRVTYQ 183

Query: 144 ELTLLHSAVMRQN 156
             +       R +
Sbjct: 184 GYSPYQLTWGRPS 196


>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.98
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.98
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.98
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.98
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
2rfa_A232 Transient receptor potential cation channel subfa 99.98
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.98
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.98
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.98
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.97
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.97
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.97
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.97
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.97
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.96
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.95
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
3hra_A201 Ankyrin repeat family protein; structural protein; 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.94
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.94
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.93
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.92
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.91
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.9
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.9
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.89
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.83
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=3.8e-38  Score=208.74  Aligned_cols=150  Identities=23%  Similarity=0.319  Sum_probs=139.2

Q ss_pred             cchHHHHHHHHhcccchhccCCCCCcHHHHHHHhCCHHHHHHHHhhCcccCCCCCCCCCccccccCCCCCcHHHHHHhcC
Q 030660            8 TMDHELLNVLRRRDSLLRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEPESLLRITDDEGNTPLHNAVRNK   87 (173)
Q Consensus         8 ~~~~~~~~~l~~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~g~t~l~~a~~~~   87 (173)
                      .-+.+++++|++.|++++.+|..|+||||+|+..++.+++++|++.|+++            +..+..|.||||+|+..|
T Consensus        14 ~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~------------~~~d~~g~TpLh~A~~~g   81 (169)
T 4gpm_A           14 NGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADV------------NAKDSDGRTPLHHAAENG   81 (169)
T ss_dssp             TTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCT------------TCCCTTSCCHHHHHHHTT
T ss_pred             cCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccch------------hhhccCCCCHHHHHHHcC
Confidence            35789999999999999999999999999999999999999999999885            467889999999999999


Q ss_pred             CHHHHHHHHhcCCCCCCCCCCCCCCHHHHHHhcCcHHHHHHHHhcCCCcccccCCCCCcHHHHHHHhCCCcHHHHHHhcc
Q 030660           88 HENVVRMLVKKDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLN  167 (173)
Q Consensus        88 ~~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll~~~  167 (173)
                      +.+++++|++.|+++ +.++..|+||||+|++.++.+++++|+++| ++++..|..|+|||++|+..|+.+++++|+++|
T Consensus        82 ~~~~v~~Ll~~gadv-n~~d~~G~TpLh~A~~~g~~~~v~~Ll~~g-ad~~~~d~~G~TpL~~A~~~g~~~iv~~Ll~~G  159 (169)
T 4gpm_A           82 HKEVVKLLISKGADV-NAKDSDGRTPLHHAAENGHKEVVKLLISKG-ADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQG  159 (169)
T ss_dssp             CHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTCHHHHHHHHHTT-CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHTC-
T ss_pred             CHHHHHHHHHCcCCC-CCCCCCCCCHHHHHHHcCCHHHHHHHHHcC-CCccccCCCCCCHHHHHHHcCCHHHHHHHHHCC
Confidence            999999999999998 889999999999999999999999999999 999999999999999999999999999999999


Q ss_pred             cccC
Q 030660          168 KCLS  171 (173)
Q Consensus       168 ~~~~  171 (173)
                      |++.
T Consensus       160 A~ie  163 (169)
T 4gpm_A          160 GWLE  163 (169)
T ss_dssp             ----
T ss_pred             CCcC
Confidence            9875



>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-12
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-05
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-04
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-06
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-04
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-04
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-04
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.001
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-08
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-06
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-06
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-06
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.003
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-04
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: RNase L, 2-5a-dependent ribonuclease
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.4 bits (145), Expect = 5e-12
 Identities = 29/133 (21%), Positives = 51/133 (38%), Gaps = 26/133 (19%)

Query: 26  KNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGT--------------------ESEP 65
           +    G T L  AA  G   ++  +L    A  N                      E+  
Sbjct: 143 RLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAIT 202

Query: 66  ESLLR------ITDDEGNTPLHNAVRNKHENVVRMLVKKDRIPLGYLNNAEQTPLSIAID 119
             LL       +  + G TPL  AV  KH  +V+ L++++ I +   ++  +T L +A++
Sbjct: 203 HLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVE 262

Query: 120 SSLTDIACFIIDQ 132
             L  IA  +  +
Sbjct: 263 LKLKKIAELLCKR 275


>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.96
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.93
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.9
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.83
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.82
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=6.6e-34  Score=197.66  Aligned_cols=160  Identities=22%  Similarity=0.245  Sum_probs=140.1

Q ss_pred             chHHHHHHHHhcccc---hhccCCCCCcHHHHHHHhCCHHHHHHHHhhCcccCCCCCCCC--------------------
Q 030660            9 MDHELLNVLRRRDSL---LRKNNWKGETPLHIAARVGDPAIVSTILKYAPAITNGTESEP--------------------   65 (173)
Q Consensus         9 ~~~~~~~~l~~~g~~---~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~--------------------   65 (173)
                      -+.+++++|++.|++   ++.++..|.||||+|+..|+.+++++|++.|++++.....+.                    
T Consensus        20 ~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~tpL~~A~~~~~~~~~~~Ll~   99 (255)
T d1oy3d_          20 QHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQ   99 (255)
T ss_dssp             TCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCHHHHHTTTTCHHHHHHHSS
T ss_pred             CCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhcccccccccccccccccccccccchhhhhhhccCchHHHHHHHh
Confidence            467788888888776   666778888999999999999999999988888776554443                    


Q ss_pred             ------------------------------------------------CccccccCCCCCcHHHHHHhcCCHHHHHHHHh
Q 030660           66 ------------------------------------------------ESLLRITDDEGNTPLHNAVRNKHENVVRMLVK   97 (173)
Q Consensus        66 ------------------------------------------------~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~   97 (173)
                                                                      ...++..+..|.||||+|+..++.+++++|++
T Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~~~~~~~~v~~Ll~  179 (255)
T d1oy3d_         100 PRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRD  179 (255)
T ss_dssp             SCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHH
T ss_pred             hccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCcccccccccccccccccchhc
Confidence                                                            22345577889999999999999999999999


Q ss_pred             cCCCCCCCCCCCCCCHHHHHHhcCcHHHHHHHHhcCCCcccccCCCCCcHHHHHHHhCCCcHHHHHHhcccc
Q 030660           98 KDRIPLGYLNNAEQTPLSIAIDSSLTDIACFIIDQRPESLNHRLPEELTLLHSAVMRQNYGEPMIFISLNKC  169 (173)
Q Consensus        98 ~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll~~~~~  169 (173)
                      .+.......+..|.||||+|++.++.+++++|+++| ++++.+|..|.||||+|+..++.+++++|+++||+
T Consensus       180 ~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~g-adin~~d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga~  250 (255)
T d1oy3d_         180 AGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAG-ADPTARMYGGRTPLGSALLRPNPILARLLRAHGAP  250 (255)
T ss_dssp             HTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTT-CCTTCCCTTSCCHHHHHHTSSCHHHHHHHHHTTCC
T ss_pred             ccccccccccccccccccccccccHHHHHHHHHHCC-CCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHcCCC
Confidence            999886667788999999999999999999999999 99999999999999999999999999999999996



>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure