Citrus Sinensis ID: 030661
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| 359494376 | 254 | PREDICTED: nicotinamide mononucleotide a | 0.716 | 0.488 | 0.774 | 1e-52 | |
| 296089926 | 249 | unnamed protein product [Vitis vinifera] | 0.716 | 0.497 | 0.774 | 2e-52 | |
| 356552585 | 245 | PREDICTED: nicotinamide mononucleotide a | 0.722 | 0.510 | 0.746 | 2e-52 | |
| 356563422 | 245 | PREDICTED: nicotinamide mononucleotide a | 0.722 | 0.510 | 0.738 | 3e-52 | |
| 357495089 | 251 | Nicotinamide mononucleotide adenylyltran | 0.722 | 0.498 | 0.731 | 7e-52 | |
| 388514509 | 197 | unknown [Medicago truncatula] | 0.722 | 0.634 | 0.731 | 5e-51 | |
| 297796461 | 238 | hypothetical protein ARALYDRAFT_495663 [ | 0.682 | 0.495 | 0.796 | 3e-50 | |
| 42568561 | 238 | nicotinamide mononucleotide adenylyltran | 0.682 | 0.495 | 0.788 | 3e-50 | |
| 357455741 | 236 | Nicotinamide mononucleotide adenylyltran | 0.624 | 0.457 | 0.814 | 1e-46 | |
| 115449565 | 315 | Os02g0814900 [Oryza sativa Japonica Grou | 0.734 | 0.403 | 0.643 | 1e-43 |
| >gi|359494376|ref|XP_002268571.2| PREDICTED: nicotinamide mononucleotide adenylyltransferase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 210 bits (535), Expect = 1e-52, Method: Compositional matrix adjust.
Identities = 103/133 (77%), Positives = 110/133 (82%), Gaps = 9/133 (6%)
Query: 1 MDVPLPLEKLSLES---------KTQGKTYVVLVATGSFNPPTFMHLRMFELARDTLNSE 51
MD+PLPLEKLSLES + K YV LVATGSFNPPT MHLRMFELARD L SE
Sbjct: 6 MDIPLPLEKLSLESIDEDRSLETTNREKMYVALVATGSFNPPTNMHLRMFELARDALRSE 65
Query: 52 GYCVIGGYMSPVNDAYKKRGLISAEHRINLCNLACKSSDFIMVDPWEANQSGYQRTLTVL 111
GYCVIGGYMSPVNDAYKKRGLISAEHRI +C+LACKSS+FIMVDPWEANQS +QRTLTVL
Sbjct: 66 GYCVIGGYMSPVNDAYKKRGLISAEHRIQMCDLACKSSEFIMVDPWEANQSTFQRTLTVL 125
Query: 112 SRVKNFLIEAGLI 124
SR+K L E GLI
Sbjct: 126 SRIKCSLCENGLI 138
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296089926|emb|CBI39745.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356552585|ref|XP_003544646.1| PREDICTED: nicotinamide mononucleotide adenylyltransferase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356563422|ref|XP_003549962.1| PREDICTED: nicotinamide mononucleotide adenylyltransferase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357495089|ref|XP_003617833.1| Nicotinamide mononucleotide adenylyltransferase [Medicago truncatula] gi|355519168|gb|AET00792.1| Nicotinamide mononucleotide adenylyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388514509|gb|AFK45316.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297796461|ref|XP_002866115.1| hypothetical protein ARALYDRAFT_495663 [Arabidopsis lyrata subsp. lyrata] gi|297311950|gb|EFH42374.1| hypothetical protein ARALYDRAFT_495663 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42568561|ref|NP_200392.3| nicotinamide mononucleotide adenylyltransferase [Arabidopsis thaliana] gi|332009299|gb|AED96682.1| nicotinamide mononucleotide adenylyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357455741|ref|XP_003598151.1| Nicotinamide mononucleotide adenylyltransferase [Medicago truncatula] gi|355487199|gb|AES68402.1| Nicotinamide mononucleotide adenylyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|115449565|ref|NP_001048497.1| Os02g0814900 [Oryza sativa Japonica Group] gi|113538028|dbj|BAF10411.1| Os02g0814900 [Oryza sativa Japonica Group] gi|125584131|gb|EAZ25062.1| hypothetical protein OsJ_08854 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| SGD|S000003242 | 395 | NMA2 "Nicotinic acid mononucle | 0.739 | 0.324 | 0.443 | 1.2e-24 | |
| UNIPROTKB|E1C0M1 | 252 | E1C0M1 "Uncharacterized protei | 0.537 | 0.369 | 0.585 | 1.4e-23 | |
| UNIPROTKB|F1NH63 | 229 | F1NH63 "Uncharacterized protei | 0.537 | 0.406 | 0.585 | 1.4e-23 | |
| UNIPROTKB|D4AAS6 | 285 | Nmnat1 "Protein Nmnat1" [Rattu | 0.537 | 0.326 | 0.606 | 3.8e-23 | |
| UNIPROTKB|Q0VC59 | 307 | NMNAT2 "Nicotinamide mononucle | 0.578 | 0.325 | 0.504 | 4.8e-23 | |
| UNIPROTKB|J9NZG3 | 307 | NMNAT2 "Uncharacterized protei | 0.578 | 0.325 | 0.504 | 4.8e-23 | |
| UNIPROTKB|J9P463 | 307 | NMNAT2 "Uncharacterized protei | 0.578 | 0.325 | 0.504 | 4.8e-23 | |
| UNIPROTKB|Q9BZQ4 | 307 | NMNAT2 "Nicotinamide mononucle | 0.578 | 0.325 | 0.504 | 4.8e-23 | |
| MGI|MGI:2444155 | 307 | Nmnat2 "nicotinamide nucleotid | 0.578 | 0.325 | 0.504 | 4.8e-23 | |
| RGD|1307331 | 307 | Nmnat2 "nicotinamide nucleotid | 0.578 | 0.325 | 0.504 | 4.8e-23 |
| SGD|S000003242 NMA2 "Nicotinic acid mononucleotide adenylyltransferase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Score = 281 (104.0 bits), Expect = 1.2e-24, P = 1.2e-24
Identities = 59/133 (44%), Positives = 88/133 (66%)
Query: 2 DVPLPLEKLSLESKTQGKTYVVLVATGSFNPPTFMHLRMFELARDTLNSEG-YCVIGGYM 60
D P+ +L+ + + K +++VA GSF+P T++HLRMFE+A D +N + + V+GGY
Sbjct: 140 DYEFPVHRLTKKLQDPEKLPLIIVACGSFSPITYLHLRMFEMALDDINEQTRFEVVGGYF 199
Query: 61 SPVNDAYKKRGLISAEHRINLCNLAC-KSSDFIMVDPWEANQSGYQRTLTVLSRVKNFL- 118
SPV+D Y+KRGL A HR+ +C LAC ++S ++MVD WE+ QS Y RT VL + +
Sbjct: 200 SPVSDNYQKRGLAPAYHRVRMCELACERTSSWLMVDAWESLQSSYTRTAKVLDHFNHEIN 259
Query: 119 IEAGLIST--GKK 129
I+ G I T G+K
Sbjct: 260 IKRGGIMTVDGEK 272
|
|
| UNIPROTKB|E1C0M1 E1C0M1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NH63 F1NH63 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4AAS6 Nmnat1 "Protein Nmnat1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VC59 NMNAT2 "Nicotinamide mononucleotide adenylyltransferase 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NZG3 NMNAT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P463 NMNAT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BZQ4 NMNAT2 "Nicotinamide mononucleotide adenylyltransferase 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2444155 Nmnat2 "nicotinamide nucleotide adenylyltransferase 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1307331 Nmnat2 "nicotinamide nucleotide adenylyltransferase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.8__1479__AT5G55810.1 | annotation not avaliable (238 aa) | ||||||||||
(Arabidopsis lyrata) | |||||||||||
| fgenesh2_kg.1__4517__AT1G55090.1 | • | • | 0.729 | ||||||||
| fgenesh2_kg.6__2041__AT5G20070.1 | • | • | 0.678 | ||||||||
| fgenesh2_kg.5__44__AT2G01350.1 | • | • | 0.572 | ||||||||
| Al_scaffold_0007_328 | • | • | • | 0.520 | |||||||
| fgenesh1_pg.C_scaffold_3002016 | • | • | 0.511 | ||||||||
| fgenesh2_kg.4__272__AT2G23420.1 | • | • | • | 0.496 | |||||||
| fgenesh2_kg.7__2831__AT4G14930.1 | • | 0.411 | |||||||||
| fgenesh2_kg.1__2871__AT1G24290.1 | • | 0.411 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| PLN02945 | 236 | PLN02945, PLN02945, nicotinamide-nucleotide adenyl | 2e-82 | |
| cd09286 | 225 | cd09286, NMNAT_Eukarya, Nicotinamide/nicotinate mo | 7e-53 | |
| TIGR00482 | 193 | TIGR00482, TIGR00482, nicotinate (nicotinamide) nu | 6e-20 | |
| COG1057 | 197 | COG1057, NadD, Nicotinic acid mononucleotide adeny | 2e-15 | |
| pfam01467 | 148 | pfam01467, CTP_transf_2, Cytidylyltransferase | 2e-15 | |
| cd02165 | 192 | cd02165, NMNAT, Nicotinamide/nicotinate mononucleo | 2e-10 | |
| cd02039 | 143 | cd02039, cytidylyltransferase_like, Cytidylyltrans | 4e-06 | |
| PRK00071 | 203 | PRK00071, nadD, nicotinic acid mononucleotide aden | 1e-05 |
| >gnl|CDD|178531 PLN02945, PLN02945, nicotinamide-nucleotide adenylyltransferase/nicotinate-nucleotide adenylyltransferase | Back alignment and domain information |
|---|
Score = 243 bits (621), Expect = 2e-82
Identities = 94/129 (72%), Positives = 103/129 (79%), Gaps = 1/129 (0%)
Query: 1 MDVPLPLEKLSLES-KTQGKTYVVLVATGSFNPPTFMHLRMFELARDTLNSEGYCVIGGY 59
MDVPLP EKLS + T +T VVLVATGSFNPPT+MHLRMFELARD L SEGY V+GGY
Sbjct: 1 MDVPLPTEKLSCGANSTGPRTRVVLVATGSFNPPTYMHLRMFELARDALMSEGYHVLGGY 60
Query: 60 MSPVNDAYKKRGLISAEHRINLCNLACKSSDFIMVDPWEANQSGYQRTLTVLSRVKNFLI 119
MSPVNDAYKK+GL SAEHRI +C LAC+ SDFIMVDPWEA QS YQRTLTVL+RV+ L
Sbjct: 61 MSPVNDAYKKKGLASAEHRIQMCQLACEDSDFIMVDPWEARQSTYQRTLTVLARVETSLN 120
Query: 120 EAGLISTGK 128
GL S
Sbjct: 121 NNGLASEES 129
|
Length = 236 |
| >gnl|CDD|185681 cd09286, NMNAT_Eukarya, Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic | Back alignment and domain information |
|---|
| >gnl|CDD|232994 TIGR00482, TIGR00482, nicotinate (nicotinamide) nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223985 COG1057, NadD, Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216517 pfam01467, CTP_transf_2, Cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|185680 cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|185678 cd02039, cytidylyltransferase_like, Cytidylyltransferase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|234611 PRK00071, nadD, nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| PLN02945 | 236 | nicotinamide-nucleotide adenylyltransferase/nicoti | 100.0 | |
| COG1057 | 197 | NadD Nicotinic acid mononucleotide adenylyltransfe | 100.0 | |
| PRK06973 | 243 | nicotinic acid mononucleotide adenylyltransferase; | 100.0 | |
| TIGR00482 | 193 | nicotinate (nicotinamide) nucleotide adenylyltrans | 100.0 | |
| PRK00071 | 203 | nadD nicotinic acid mononucleotide adenylyltransfe | 100.0 | |
| PRK08887 | 174 | nicotinic acid mononucleotide adenylyltransferase; | 100.0 | |
| PRK07152 | 342 | nadD putative nicotinate-nucleotide adenylyltransf | 100.0 | |
| cd02165 | 192 | NMNAT Nicotinamide/nicotinate mononucleotide adeny | 100.0 | |
| cd09286 | 225 | NMNAT_Eukarya Nicotinamide/nicotinate mononucleoti | 99.98 | |
| TIGR01510 | 155 | coaD_prev_kdtB pantetheine-phosphate adenylyltrans | 99.93 | |
| PF01467 | 157 | CTP_transf_2: Cytidylyltransferase; InterPro: IPR0 | 99.91 | |
| cd02163 | 153 | PPAT Phosphopantetheine adenylyltransferase. Phosp | 99.91 | |
| PRK00168 | 159 | coaD phosphopantetheine adenylyltransferase; Provi | 99.89 | |
| KOG3199 | 234 | consensus Nicotinamide mononucleotide adenylyl tra | 99.85 | |
| cd02039 | 143 | cytidylyltransferase_like Cytidylyltransferase-lik | 99.79 | |
| cd02167 | 158 | NMNAT_NadR Nicotinamide/nicotinate mononucleotide | 99.77 | |
| PRK13964 | 140 | coaD phosphopantetheine adenylyltransferase; Provi | 99.73 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 99.68 | |
| cd02166 | 163 | NMNAT_Archaea Nicotinamide/nicotinate mononucleoti | 99.68 | |
| TIGR01527 | 165 | arch_NMN_Atrans nicotinamide-nucleotide adenylyltr | 99.66 | |
| COG0669 | 159 | CoaD Phosphopantetheine adenylyltransferase [Coenz | 99.64 | |
| cd02168 | 181 | NMNAT_Nudix Nicotinamide/nicotinate mononucleotide | 99.63 | |
| PRK01153 | 174 | nicotinamide-nucleotide adenylyltransferase; Provi | 99.62 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.58 | |
| TIGR00125 | 66 | cyt_tran_rel cytidyltransferase-related domain. Pr | 99.58 | |
| cd02170 | 136 | cytidylyltransferase cytidylyltransferase. The cyt | 99.5 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 99.49 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 99.45 | |
| cd02164 | 143 | PPAT_CoAS phosphopantetheine adenylyltransferase d | 99.44 | |
| PRK00777 | 153 | phosphopantetheine adenylyltransferase; Provisiona | 99.4 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 99.39 | |
| smart00764 | 182 | Citrate_ly_lig Citrate lyase ligase C-terminal dom | 99.35 | |
| cd02156 | 105 | nt_trans nucleotidyl transferase superfamily. nt_t | 99.31 | |
| TIGR00339 | 383 | sopT ATP sulphurylase. Members of this family also | 99.29 | |
| cd02171 | 129 | G3P_Cytidylyltransferase glycerol-3-phosphate cyti | 99.28 | |
| cd02174 | 150 | CCT CTP:phosphocholine cytidylyltransferase. CTP:p | 99.17 | |
| PRK13671 | 298 | hypothetical protein; Provisional | 99.14 | |
| PRK13793 | 196 | nicotinamide-nucleotide adenylyltransferase; Provi | 99.14 | |
| cd02173 | 152 | ECT CTP:phosphoethanolamine cytidylyltransferase ( | 99.09 | |
| PLN02406 | 418 | ethanolamine-phosphate cytidylyltransferase | 99.05 | |
| PTZ00308 | 353 | ethanolamine-phosphate cytidylyltransferase; Provi | 98.94 | |
| COG1056 | 172 | NadR Nicotinamide mononucleotide adenylyltransfera | 98.87 | |
| cd02064 | 180 | FAD_synthetase_N FAD synthetase, N-terminal domain | 98.84 | |
| TIGR01518 | 125 | g3p_cytidyltrns glycerol-3-phosphate cytidylyltran | 98.51 | |
| PLN02388 | 177 | phosphopantetheine adenylyltransferase | 98.45 | |
| cd02172 | 144 | RfaE_N N-terminal domain of RfaE. RfaE is a protei | 98.44 | |
| COG0615 | 140 | TagD Cytidylyltransferase [Cell envelope biogenesi | 98.33 | |
| COG1019 | 158 | Predicted nucleotidyltransferase [General function | 98.33 | |
| TIGR02199 | 144 | rfaE_dom_II rfaE bifunctional protein, domain II. | 98.3 | |
| PRK01170 | 322 | phosphopantetheine adenylyltransferase/unknown dom | 98.25 | |
| PTZ00308 | 353 | ethanolamine-phosphate cytidylyltransferase; Provi | 98.16 | |
| PF08218 | 182 | Citrate_ly_lig: Citrate lyase ligase C-terminal do | 97.95 | |
| PLN02413 | 294 | choline-phosphate cytidylyltransferase | 97.93 | |
| PRK11316 | 473 | bifunctional heptose 7-phosphate kinase/heptose 1- | 97.57 | |
| KOG3351 | 293 | consensus Predicted nucleotidyltransferase [Genera | 97.21 | |
| PRK05627 | 305 | bifunctional riboflavin kinase/FMN adenylyltransfe | 97.05 | |
| PRK07143 | 279 | hypothetical protein; Provisional | 97.03 | |
| PRK13670 | 388 | hypothetical protein; Provisional | 96.98 | |
| PLN02406 | 418 | ethanolamine-phosphate cytidylyltransferase | 96.96 | |
| PF05636 | 388 | HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPr | 96.83 | |
| PF06574 | 157 | FAD_syn: FAD synthetase; InterPro: IPR015864 Ribof | 96.73 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 96.64 | |
| TIGR00083 | 288 | ribF riboflavin kinase/FMN adenylyltransferase. mu | 96.32 | |
| COG2046 | 397 | MET3 ATP sulfurylase (sulfate adenylyltransferase) | 96.15 | |
| PF01747 | 215 | ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002 | 96.01 | |
| cd00517 | 353 | ATPS ATP-sulfurylase. ATP-sulfurylase (ATPS), also | 95.52 | |
| COG1323 | 358 | Predicted nucleotidyltransferase [General function | 95.37 | |
| KOG2803 | 358 | consensus Choline phosphate cytidylyltransferase/P | 94.8 | |
| PRK04149 | 391 | sat sulfate adenylyltransferase; Reviewed | 94.22 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 93.23 | |
| COG0196 | 304 | RibF FAD synthase [Coenzyme metabolism] | 93.06 | |
| KOG2804 | 348 | consensus Phosphorylcholine transferase/cholinepho | 92.84 | |
| KOG2803 | 358 | consensus Choline phosphate cytidylyltransferase/P | 88.97 | |
| COG2870 | 467 | RfaE ADP-heptose synthase, bifunctional sugar kina | 88.21 | |
| PLN02660 | 284 | pantoate--beta-alanine ligase | 87.82 | |
| cd00560 | 277 | PanC Pantoate-beta-alanine ligase. PanC Pantoate-b | 85.85 | |
| PRK00380 | 281 | panC pantoate--beta-alanine ligase; Reviewed | 83.04 | |
| TIGR00018 | 282 | panC pantoate--beta-alanine ligase. This family is | 81.82 |
| >PLN02945 nicotinamide-nucleotide adenylyltransferase/nicotinate-nucleotide adenylyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-39 Score=270.02 Aligned_cols=147 Identities=64% Similarity=0.911 Sum_probs=137.4
Q ss_pred CCCCCChhhhhcccc-cCCcceEEEEecCcCChhhHHHHHHHHHHHHhhCCCcEEEEecccCCCCcccccCCCCCHHHHH
Q 030661 1 MDVPLPLEKLSLESK-TQGKTYVVLVATGSFNPPTFMHLRMFELARDTLNSEGYCVIGGYMSPVNDAYKKRGLISAEHRI 79 (173)
Q Consensus 1 ~~~~~p~~~~~~~~~-~~~~~~ii~lfGGSFdP~H~GHl~ia~~a~~~l~ld~v~vvp~~~~P~k~~~~K~~~~s~~~Rl 79 (173)
||+|+|+++|+..++ .+++..++++|||||||||+||+.+|+.|.+.+++|++++||++.+|.++++.|+..+++++|+
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~v~i~GGSFdP~H~gHl~ia~~a~~~l~~d~~~~v~~~~~P~~~~~~k~~~~~~~~Rl 80 (236)
T PLN02945 1 MDVPLPTEKLSCGANSTGPRTRVVLVATGSFNPPTYMHLRMFELARDALMSEGYHVLGGYMSPVNDAYKKKGLASAEHRI 80 (236)
T ss_pred CCCCchHHHHhhhhcCccCCceEEEEEcCCCCCCcHHHHHHHHHHHHHHhhcCcEEEEEEECCCCcccccCCCCCHHHHH
Confidence 899999999999996 6788899999999999999999999999999999999999999999998888888889999999
Q ss_pred HHHHHHhcCCCCeEEeeccccCCcccchHHHHHHHHHHc--------C---------CcccCCccc---hH----HHhcC
Q 030661 80 NLCNLACKSSDFIMVDPWEANQSGYQRTLTVLSRVKNFL--------I---------EAGLISTGK---KQ----NYIFP 135 (173)
Q Consensus 80 ~Ml~lai~~~~~i~v~~~E~~~~~~syT~~TL~~lk~~~--------p---------~D~l~~l~~---W~----e~L~~ 135 (173)
+|+++|+++++++.|++||+++++++||++||++++++| | +|++.+|++ |+ ++|++
T Consensus 81 ~Ml~lai~~~~~~~V~~~E~~~~~~syT~dtL~~l~~~~~~~~~~~~~~~~~~fiiG~D~l~~l~~~~~W~~~~~~~l~~ 160 (236)
T PLN02945 81 QMCQLACEDSDFIMVDPWEARQSTYQRTLTVLARVETSLNNNGLASEESVRVMLLCGSDLLESFSTPGVWIPDQVRTICR 160 (236)
T ss_pred HHHHHHhcCCCCeEecHHHhCCCCCccHHHHHHHHHHHhccccccCCCCceEEEEechhHHHhcCCCCcCCHHHHHHHHH
Confidence 999999999999999999999999999999999999987 3 799999997 87 45999
Q ss_pred CccEEEEecCCc
Q 030661 136 PCSASVELSCMS 147 (173)
Q Consensus 136 ~~~~vV~~r~~~ 147 (173)
.|+|+|+.|.-.
T Consensus 161 ~~~~vV~~R~g~ 172 (236)
T PLN02945 161 DYGVVCIRREGQ 172 (236)
T ss_pred hCCEEEEeCCCC
Confidence 999999999753
|
|
| >COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated | Back alignment and domain information |
|---|
| >cd02165 NMNAT Nicotinamide/nicotinate mononucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >cd09286 NMNAT_Eukarya Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic | Back alignment and domain information |
|---|
| >TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase, bacterial | Back alignment and domain information |
|---|
| >PF01467 CTP_transf_2: Cytidylyltransferase; InterPro: IPR004820 This family includes []: Cholinephosphate cytidyltransferase (P49585 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd02163 PPAT Phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
| >PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3199 consensus Nicotinamide mononucleotide adenylyl transferase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain | Back alignment and domain information |
|---|
| >cd02167 NMNAT_NadR Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins | Back alignment and domain information |
|---|
| >PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >cd02166 NMNAT_Archaea Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal | Back alignment and domain information |
|---|
| >TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd02168 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain | Back alignment and domain information |
|---|
| >PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00125 cyt_tran_rel cytidyltransferase-related domain | Back alignment and domain information |
|---|
| >cd02170 cytidylyltransferase cytidylyltransferase | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes | Back alignment and domain information |
|---|
| >PRK00777 phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain | Back alignment and domain information |
|---|
| >cd02156 nt_trans nucleotidyl transferase superfamily | Back alignment and domain information |
|---|
| >TIGR00339 sopT ATP sulphurylase | Back alignment and domain information |
|---|
| >cd02171 G3P_Cytidylyltransferase glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd02174 CCT CTP:phosphocholine cytidylyltransferase | Back alignment and domain information |
|---|
| >PRK13671 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) | Back alignment and domain information |
|---|
| >PLN02406 ethanolamine-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme | Back alignment and domain information |
|---|
| >TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >PLN02388 phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
| >cd02172 RfaE_N N-terminal domain of RfaE | Back alignment and domain information |
|---|
| >COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1019 Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II | Back alignment and domain information |
|---|
| >PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08218 Citrate_ly_lig: Citrate lyase ligase C-terminal domain; InterPro: IPR013166 [Citrate (pro-3S)-lyase] ligase (6 | Back alignment and domain information |
|---|
| >PLN02413 choline-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3351 consensus Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07143 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13670 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02406 ethanolamine-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >PF05636 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPro: IPR008513 This family consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PF06574 FAD_syn: FAD synthetase; InterPro: IPR015864 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase | Back alignment and domain information |
|---|
| >COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01747 ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002650 This entry consists of sulphate adenylyltransferase or ATP-sulfurylase (2 | Back alignment and domain information |
|---|
| >cd00517 ATPS ATP-sulfurylase | Back alignment and domain information |
|---|
| >COG1323 Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04149 sat sulfate adenylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >COG0196 RibF FAD synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02660 pantoate--beta-alanine ligase | Back alignment and domain information |
|---|
| >cd00560 PanC Pantoate-beta-alanine ligase | Back alignment and domain information |
|---|
| >PRK00380 panC pantoate--beta-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00018 panC pantoate--beta-alanine ligase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 173 | ||||
| 1kqn_A | 279 | Crystal Structure Of NmnNAMN ADENYLYLTRANSFERASE CO | 1e-24 | ||
| 1kku_A | 279 | Crystal Structure Of Nuclear Human Nicotinamide Mon | 1e-24 | ||
| 1nup_A | 252 | Crystal Structure Of Human Cytosolic NmnNAMN ADENYL | 4e-24 | ||
| 1gzu_A | 290 | Crystal Structure Of Human Nicotinamide Mononucleot | 3e-23 | ||
| 3f3m_A | 168 | Six Crystal Structures Of Two Phosphopantetheine Ad | 3e-04 |
| >pdb|1KQN|A Chain A, Crystal Structure Of NmnNAMN ADENYLYLTRANSFERASE COMPLEXED With Nad Length = 279 | Back alignment and structure |
|
| >pdb|1KKU|A Chain A, Crystal Structure Of Nuclear Human Nicotinamide Mononucleotide Adenylyltransferase Length = 279 | Back alignment and structure |
| >pdb|1NUP|A Chain A, Crystal Structure Of Human Cytosolic NmnNAMN ADENYLYLTRANSFERASE Complex With Nmn Length = 252 | Back alignment and structure |
| >pdb|1GZU|A Chain A, Crystal Structure Of Human Nicotinamide Mononucleotide Adenylyltransferase In Complex With Nmn Length = 290 | Back alignment and structure |
| >pdb|3F3M|A Chain A, Six Crystal Structures Of Two Phosphopantetheine Adenylyltransferases Reveal An Alternative Ligand Binding Mode And An Associated Structural Change Length = 168 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| 1nup_A | 252 | FKSG76; NAD biosynthesis, mitochondria, pyridine a | 7e-40 | |
| 1kqn_A | 279 | Nmnat, nicotinamide mononucleotide adenylyl transf | 9e-35 | |
| 1k4m_A | 213 | NAMN adenylyltransferase; nucleotidyltransferase; | 5e-07 | |
| 1yum_A | 242 | 'probable nicotinate-nucleotide adenylyltransferas | 7e-07 | |
| 2h29_A | 189 | Probable nicotinate-nucleotide adenylyltransferase | 3e-06 | |
| 1kam_A | 194 | Deamido-NAD(+), nicotinate-nucleotide adenylyltran | 6e-06 | |
| 3h05_A | 177 | Uncharacterized protein VPA0413; nucleotidylyl, tr | 2e-05 | |
| 2qtr_A | 189 | Nicotinate (nicotinamide) nucleotide adenylyltran; | 2e-05 |
| >1nup_A FKSG76; NAD biosynthesis, mitochondria, pyridine adenylyltransferase catalysis, transferase; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Length = 252 | Back alignment and structure |
|---|
Score = 134 bits (339), Expect = 7e-40
Identities = 56/141 (39%), Positives = 82/141 (58%), Gaps = 2/141 (1%)
Query: 17 QGKTYVVLVATGSFNPPTFMHLRMFELARDTLNSEG-YCVIGGYMSPVNDAYKKRGLISA 75
+ + VVL+A GSFNP T MHLRMFE+ARD L+ G Y VI G +SPVND Y K+ L ++
Sbjct: 2 KSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAAS 61
Query: 76 EHRINLCNLACKSSDFIMVDPWEANQSGYQRTLTVLSRVKNFLIEA-GLISTGKKQNYIF 134
HR+ + LA ++SD+I VDPWE+ Q+ + T+ VL + L+ + + +F
Sbjct: 62 HHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALF 121
Query: 135 PPCSASVELSCMSVSLCLIYL 155
+A EL + + L
Sbjct: 122 STPAAVPELKLLCGADVLKTF 142
|
| >1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Length = 279 | Back alignment and structure |
|---|
| >1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Length = 213 | Back alignment and structure |
|---|
| >1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Length = 242 | Back alignment and structure |
|---|
| >2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Length = 189 | Back alignment and structure |
|---|
| >1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Length = 194 | Back alignment and structure |
|---|
| >3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structu genomics, PSI; 1.65A {Vibrio parahaemolyticus} Length = 177 | Back alignment and structure |
|---|
| >2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltran; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesi transferase; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* Length = 189 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| 3h05_A | 177 | Uncharacterized protein VPA0413; nucleotidylyl, tr | 100.0 | |
| 1yum_A | 242 | 'probable nicotinate-nucleotide adenylyltransferas | 99.98 | |
| 2h29_A | 189 | Probable nicotinate-nucleotide adenylyltransferase | 99.97 | |
| 1kam_A | 194 | Deamido-NAD(+), nicotinate-nucleotide adenylyltran | 99.97 | |
| 1k4m_A | 213 | NAMN adenylyltransferase; nucleotidyltransferase; | 99.97 | |
| 1nup_A | 252 | FKSG76; NAD biosynthesis, mitochondria, pyridine a | 99.96 | |
| 2qtr_A | 189 | Nicotinate (nicotinamide) nucleotide adenylyltran; | 99.96 | |
| 1kqn_A | 279 | Nmnat, nicotinamide mononucleotide adenylyl transf | 99.96 | |
| 3f3m_A | 168 | Phosphopantetheine adenylyltransferase; PPAT, coen | 99.9 | |
| 1vlh_A | 173 | Phosphopantetheine adenylyltransferase; TM0741, st | 99.89 | |
| 3nbk_A | 177 | Phosphopantetheine adenylyltransferase; PPAT, PHP; | 99.87 | |
| 3nd5_A | 171 | Phosphopantetheine adenylyltransferase; PPAT, coen | 99.86 | |
| 1qjc_A | 158 | Phosphopantetheine adenylyltransferase; coenzyme A | 99.84 | |
| 1o6b_A | 169 | Phosphopantetheine adenylyltransferase; structural | 99.83 | |
| 1od6_A | 160 | PPAT, phosphopantetheine adenylyltransferase; coen | 99.83 | |
| 4f3r_A | 162 | Phosphopantetheine adenylyltransferase; phosphopan | 99.82 | |
| 3k9w_A | 187 | Phosphopantetheine adenylyltransferase; niaid, ssg | 99.81 | |
| 1f9a_A | 168 | Hypothetical protein MJ0541; alpha/beta, transfera | 99.76 | |
| 3nv7_A | 157 | Phosphopantetheine adenylyltransferase; helicobact | 99.75 | |
| 1ej2_A | 181 | Nicotinamide mononucleotide adenylyltransferase; d | 99.71 | |
| 1coz_A | 129 | Protein (glycerol-3-phosphate cytidylyltransferase | 99.71 | |
| 2b7l_A | 132 | Glycerol-3-phosphate cytidylyltransferase; rossman | 99.71 | |
| 3do8_A | 148 | Phosphopantetheine adenylyltransferase; protein wi | 99.7 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.69 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 99.68 | |
| 1jhd_A | 396 | Sulfate adenylyltransferase; sulfurylase, APS, che | 99.68 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.65 | |
| 1v47_A | 349 | ATP sulfurylase; product binding complex, zinc, ri | 99.63 | |
| 3hl4_A | 236 | Choline-phosphate cytidylyltransferase A; rossmann | 99.29 | |
| 3glv_A | 143 | Lipopolysaccharide core biosynthesis protein; stru | 99.1 | |
| 3elb_A | 341 | Ethanolamine-phosphate cytidylyltransferase; kenne | 99.04 | |
| 3elb_A | 341 | Ethanolamine-phosphate cytidylyltransferase; kenne | 99.04 | |
| 2x0k_A | 338 | Riboflavin biosynthesis protein RIBF; riboflavin k | 98.25 | |
| 1r6x_A | 395 | ATP:sulfate adenylyltransferase; APS kinase-like d | 97.69 | |
| 3gmi_A | 357 | UPF0348 protein MJ0951; protein with unknown funct | 97.59 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 97.55 | |
| 1mrz_A | 293 | Riboflavin kinase/FMN adenylyltransferase; rossman | 97.49 | |
| 3op1_A | 308 | Macrolide-efflux protein; structural genomics, PSI | 97.32 | |
| 2ejc_A | 280 | Pantoate--beta-alanine ligase; X-RAY diffraction, | 96.48 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 96.19 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 96.13 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 93.66 | |
| 3ag6_A | 283 | Pantothenate synthetase; ATP-dependent enzyme, ATP | 90.02 | |
| 1v8f_A | 276 | Pantoate-beta-alanine ligase; rossmann fold, dimer | 89.15 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 87.93 | |
| 3cov_A | 301 | Pantothenate synthetase; pantothenate biosynthesis | 87.65 | |
| 3inn_A | 314 | Pantothenate synthetase; ssgcid, SBRI, UW, decode, | 87.04 | |
| 3uk2_A | 283 | Pantothenate synthetase; AMP, structural genomics, | 82.92 |
| >3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structu genomics, PSI; 1.65A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
Probab=100.00 E-value=9.2e-36 Score=237.28 Aligned_cols=131 Identities=13% Similarity=0.115 Sum_probs=108.1
Q ss_pred cceEEEEecCcCChhhHHHHHHHHHHHHhhCCCcEEEEecccCCCCcccccCCCCCHHHHHHHHHHHhcCCC--CeEEee
Q 030661 19 KTYVVLVATGSFNPPTFMHLRMFELARDTLNSEGYCVIGGYMSPVNDAYKKRGLISAEHRINLCNLACKSSD--FIMVDP 96 (173)
Q Consensus 19 ~~~ii~lfGGSFdP~H~GHl~ia~~a~~~l~ld~v~vvp~~~~P~k~~~~K~~~~s~~~Rl~Ml~lai~~~~--~i~v~~ 96 (173)
|+++ ++|||||||||+||+.+++ |++.+ |+|+|+|+..+|. |++.+++++|++|+++|+++++ ++.|++
T Consensus 1 M~~i-gi~gGsFdPih~GHl~i~~-a~~~~--d~v~~~p~~~~~~-----k~~~~~~~~R~~m~~~a~~~~~~~~~~v~~ 71 (177)
T 3h05_A 1 MKKI-AIFGSAFNPPSLGHKSVIE-SLSHF--DLVLLEPSIAHAW-----GKNMLDYPIRCKLVDAFIKDMGLSNVQRSD 71 (177)
T ss_dssp CCEE-EEEEECCSSCCHHHHHHHT-TCTTS--SEEEEEECC------------CCCHHHHHHHHHHHHHHHCCTTEEECC
T ss_pred CcEE-EEEEeccchhhHHHHHHHH-HHHHC--CEEEEEECCCCCC-----CCCCCCHHHHHHHHHHHHhcCCCCcEEEEe
Confidence 3455 4679999999999999998 77766 9999999986654 3568999999999999999874 899999
Q ss_pred cccc--CCc-ccchHHHHHHHHHHcC---------CcccCCccchH--HHhcCCccEEEEecCCchHHHHHHHHHH
Q 030661 97 WEAN--QSG-YQRTLTVLSRVKNFLI---------EAGLISTGKKQ--NYIFPPCSASVELSCMSVSLCLIYLIFH 158 (173)
Q Consensus 97 ~E~~--~~~-~syT~~TL~~lk~~~p---------~D~l~~l~~W~--e~L~~~~~~vV~~r~~~~~~~~~~~~~~ 158 (173)
+|.+ +++ +|||++||++|+++|| +|++.+|++|+ ++|+++|+++|+.|...+|.+.|-..+.
T Consensus 72 ~E~~l~~~~~~syT~dTl~~l~~~~p~~~~~~iiG~D~l~~l~~W~~~~~l~~~~~~vv~~r~~~iSST~IR~~i~ 147 (177)
T 3h05_A 72 LEQALYQPGQSVTTYALLEKIQEIYPTADITFVIGPDNFFKFAKFYKAEEITERWTVMACPEKVKIRSTDIRNALI 147 (177)
T ss_dssp HHHHHC----CCCHHHHHHHHHHHSTTSEEEEEECHHHHHTGGGSTTHHHHHHHSEEEECCCSSCCCHHHHHHHHH
T ss_pred hhhhcccCCCCcchHHHHHHHHHHhcCCCeEEEEecchhhhcccchhHHHHHHhCCEEEEcCCCCCcHHHHHHHHH
Confidence 9987 666 9999999999999998 79999999999 9999999999999977777777665554
|
| >1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* | Back alignment and structure |
|---|
| >2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* | Back alignment and structure |
|---|
| >1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* | Back alignment and structure |
|---|
| >1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* | Back alignment and structure |
|---|
| >1nup_A FKSG76; NAD biosynthesis, mitochondria, pyridine adenylyltransferase catalysis, transferase; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* | Back alignment and structure |
|---|
| >2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltran; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesi transferase; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* | Back alignment and structure |
|---|
| >1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* | Back alignment and structure |
|---|
| >3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway, coenzyme A biosynthesis, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} SCOP: c.26.1.0 | Back alignment and structure |
|---|
| >1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3pnb_A* 4e1a_A 3lcj_A 3rba_A* 1tfu_A* 3rff_A 3rhs_A* 3uc5_A* | Back alignment and structure |
|---|
| >3nd5_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway; 2.30A {Enterococcus faecalis} SCOP: c.26.1.0 PDB: 3nd6_A* 3nd7_A* | Back alignment and structure |
|---|
| >1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A | Back alignment and structure |
|---|
| >1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infect disease, coenzyme A, COA; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei} PDB: 3ikz_A* 3pxu_A* | Back alignment and structure |
|---|
| >1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >3nv7_A Phosphopantetheine adenylyltransferase; helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopa adenylyltransferase; 1.75A {Helicobacter pylori} PDB: 3otw_A* | Back alignment and structure |
|---|
| >1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* | Back alignment and structure |
|---|
| >1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* | Back alignment and structure |
|---|
| >2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} | Back alignment and structure |
|---|
| >1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; 1.91A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A | Back alignment and structure |
|---|
| >3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* | Back alignment and structure |
|---|
| >1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken STR genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3cov_A Pantothenate synthetase; pantothenate biosynthesis, enzym ligase, drug design, ATP-binding, magnesium, metal-binding; 1.50A {Mycobacterium tuberculosis} SCOP: c.26.1.4 PDB: 3cow_A* 3coy_A* 3coz_A* 3imc_A* 3ime_A* 3img_A* 3iob_A* 3ioc_A* 3iod_A* 3ioe_A* 3iub_A* 3iue_A* 3ivc_A* 3ivg_A* 3ivx_A* 2a84_A* 1n2b_A* 1n2e_A* 1n2g_A* 1n2h_A* ... | Back alignment and structure |
|---|
| >3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} | Back alignment and structure |
|---|
| >3uk2_A Pantothenate synthetase; AMP, structural genomics, seattle S genomics center for infectious disease, ssgcid, ligase; HET: AMP; 2.25A {Burkholderia thailandensis} SCOP: c.26.1.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 173 | ||||
| d1kr2a_ | 271 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 2e-28 | |
| d1nuua_ | 233 | c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransfera | 9e-22 | |
| d1kama_ | 189 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 4e-07 | |
| d1k4ma_ | 213 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 7e-07 | |
| d1jhda2 | 223 | c.26.1.5 (A:174-396) ATP sulfurylase catalytic dom | 8e-06 | |
| d1qjca_ | 157 | c.26.1.3 (A:) Phosphopantetheine adenylyltransfera | 0.004 |
| >d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Adenylyltransferase domain: Nicotinamide mononucleotide (NMN) adenylyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Score = 104 bits (259), Expect = 2e-28
Identities = 55/118 (46%), Positives = 72/118 (61%), Gaps = 1/118 (0%)
Query: 19 KTYVVLVATGSFNPPTFMHLRMFELARDTLNSEG-YCVIGGYMSPVNDAYKKRGLISAEH 77
KT VVL+A GSFNP T MHLR+FELA+D +N G Y V+ G +SPV DAYKK+GLI A H
Sbjct: 2 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYH 61
Query: 78 RINLCNLACKSSDFIMVDPWEANQSGYQRTLTVLSRVKNFLIEAGLISTGKKQNYIFP 135
R+ + LA K+S ++ VD WE+ Q ++ TL VL + L + P
Sbjct: 62 RVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERP 119
|
| >d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 189 | Back information, alignment and structure |
|---|
| >d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Length = 223 | Back information, alignment and structure |
|---|
| >d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} Length = 157 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| d1nuua_ | 233 | Cytosolic NMN/NAMN adenylyltransferase {Human (Hom | 99.98 | |
| d1kr2a_ | 271 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.97 | |
| d1k4ma_ | 213 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.94 | |
| d1jhda2 | 223 | ATP sulfurylase catalytic domain {Sulfur-oxidizing | 99.94 | |
| d1kama_ | 189 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.92 | |
| d1qjca_ | 157 | Phosphopantetheine adenylyltransferase {Escherichi | 99.75 | |
| d1ej2a_ | 167 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.75 | |
| d1od6a_ | 160 | Phosphopantetheine adenylyltransferase {Thermus th | 99.74 | |
| d1o6ba_ | 163 | Phosphopantetheine adenylyltransferase {Bacillus s | 99.73 | |
| d1f9aa_ | 164 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.71 | |
| d1lw7a1 | 163 | Transcriptional regulator NadR, NMN-adenylyltransf | 99.59 | |
| d1vlha_ | 157 | Phosphopantetheine adenylyltransferase {Thermotoga | 99.57 | |
| d1tfua_ | 157 | Phosphopantetheine adenylyltransferase {Mycobacter | 99.57 | |
| d1coza_ | 126 | CTP:glycerol-3-phosphate cytidylyltransferase {Bac | 99.29 | |
| d1mrza2 | 157 | FMN adenylyltransferase domain of bifunctional FAD | 97.0 | |
| d1g8fa2 | 221 | ATP sulfurylase catalytic domain {Baker's yeast (S | 96.5 | |
| d1v47a2 | 214 | ATP sulfurylase catalytic domain {Thermus thermoph | 95.72 | |
| d1x6va2 | 235 | ATP sulfurylase catalytic domain {Human (Homo sapi | 94.83 | |
| d1v8fa_ | 276 | Pantothenate synthetase (Pantoate-beta-alanine lig | 83.41 |
| >d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Adenylyltransferase domain: Cytosolic NMN/NAMN adenylyltransferase species: Human (Homo sapiens), FKSG76 [TaxId: 9606]
Probab=99.98 E-value=1.6e-33 Score=227.33 Aligned_cols=127 Identities=41% Similarity=0.608 Sum_probs=114.4
Q ss_pred cceEEEEecCcCChhhHHHHHHHHHHHHhhCCCcEE-EEecccCCCCcccccCCCCCHHHHHHHHHHHhcCCCCeEEeec
Q 030661 19 KTYVVLVATGSFNPPTFMHLRMFELARDTLNSEGYC-VIGGYMSPVNDAYKKRGLISAEHRINLCNLACKSSDFIMVDPW 97 (173)
Q Consensus 19 ~~~ii~lfGGSFdP~H~GHl~ia~~a~~~l~ld~v~-vvp~~~~P~k~~~~K~~~~s~~~Rl~Ml~lai~~~~~i~v~~~ 97 (173)
|.+++++|||||||||+||+.|++.|++++++++++ ++++..+|.++++.++..+++++|++|+++|+++++++.|+++
T Consensus 2 ~~p~vl~~~GSFdP~H~GHl~i~~~a~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~R~~M~~la~~~~~~~~v~~~ 81 (233)
T d1nuua_ 2 RIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPW 81 (233)
T ss_dssp CEEEEEEEEECCTTCCHHHHHHHHHHHHHHHHHSSEEEEEEEEEECCTTCSSSCCCCHHHHHHHHHHHGGGCSSEEECCH
T ss_pred CCCEEEEEeeeeCccHHHHHHHHHHHHHHhCcccceeeeeEEEccCCCCcccCccCCHHHHHHHHHHHHhccCCEEEehH
Confidence 568899999999999999999999999999877754 5556677777766678899999999999999999999999999
Q ss_pred cccCCcccchHHHHHHHHHHc---------------------C---------CcccCCccchH-------HHhcCCccEE
Q 030661 98 EANQSGYQRTLTVLSRVKNFL---------------------I---------EAGLISTGKKQ-------NYIFPPCSAS 140 (173)
Q Consensus 98 E~~~~~~syT~~TL~~lk~~~---------------------p---------~D~l~~l~~W~-------e~L~~~~~~v 140 (173)
|..+++++||++||++|+++| | +|++.+|++|+ ++|++.|+++
T Consensus 82 e~~~~~~s~ti~tl~~l~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~fiiG~D~l~~~~~wk~~~~~~~~~il~~~~~i 161 (233)
T d1nuua_ 82 ESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLV 161 (233)
T ss_dssp HHHSSSCCCHHHHHHHHHHHHC--------------------CCCEEEEEEEHHHHHHTTSTTTSCHHHHHHHHHHTCEE
T ss_pred HHhCCCCccHHHHHHHHHHHhcccccccccccccchhccccCCCccEEEEEccchhhhcchhhhhcchhHHHHHhhCcEE
Confidence 999999999999999999986 2 79999999995 7899999999
Q ss_pred EEecC
Q 030661 141 VELSC 145 (173)
Q Consensus 141 V~~r~ 145 (173)
|+.|.
T Consensus 162 v~~R~ 166 (233)
T d1nuua_ 162 CVGRV 166 (233)
T ss_dssp EECCT
T ss_pred EEeCC
Confidence 99996
|
| >d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} | Back information, alignment and structure |
|---|
| >d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g8fa2 c.26.1.5 (A:169-389) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v47a2 c.26.1.5 (A:136-349) ATP sulfurylase catalytic domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|