Citrus Sinensis ID: 030712

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKSLQGRT
cccccHHHHHHHHHHHHHHHHccccccccccccccccEEEccHHHcccHHHHHHccccEEEEccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccc
ccccccHHHcccccccHHcccccccccccccEEEcccEEEccHHcHccHHHHHHcccEEEEEEcccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHcccccc
MDQMDNAYRNQIAAILRVLNLTtclredrvpfeieqglflgsigaasnkdalksrnITHILTVANalapahpndfVYKVIGvadkedtnlsQYFDECISFIDEAkrqrggvlvhcfagrsrSVTIVVAYLMKKHGMSLSQAMGhvksrrpqaapnsgfLLQLQELEKSLQGRT
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLvhcfagrsrsVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKSLQGRT
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFllqlqeleKSLQGRT
*******YRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKH***************************************
*******************NLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKSLQG**
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSL***************PNSGFLLQLQELEKSLQGRT
************AAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKSLQ***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKSLQGRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
Q9ZR37198 Dual specificity protein yes no 0.982 0.858 0.664 6e-66
Q9M8K7167 Dual specificity protein no no 0.803 0.832 0.690 5e-52
Q8WTR2217 Dual specificity protein yes no 0.774 0.617 0.462 8e-28
Q16829419 Dual specificity protein no no 0.803 0.331 0.453 7e-27
Q63340280 Dual specificity protein yes no 0.803 0.496 0.453 7e-27
Q91Z46422 Dual specificity protein yes no 0.803 0.329 0.453 7e-27
Q55CS7834 MAP kinase phosphatase wi yes no 0.797 0.165 0.457 5e-26
Q9DBB1381 Dual specificity protein no no 0.803 0.364 0.446 2e-25
Q64346381 Dual specificity protein no no 0.803 0.364 0.446 2e-25
Q16828381 Dual specificity protein no no 0.803 0.364 0.446 2e-25
>sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  249 bits (636), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 142/170 (83%)

Query: 1   MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHI 60
           +++ +   +NQI A++RV+ +    R+D VP  IEQGL+LGS+ AASNK+ LKS N+THI
Sbjct: 21  IEKYNEKVKNQIQALVRVIKVARTYRDDNVPSLIEQGLYLGSVAAASNKNVLKSYNVTHI 80

Query: 61  LTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRS 120
           LTVA++L PAHP+DFVYKV+ V DKEDTNL  YFDEC+ FIDEAKRQ G VLVHCF G+S
Sbjct: 81  LTVASSLRPAHPDDFVYKVVRVVDKEDTNLEMYFDECVDFIDEAKRQGGSVLVHCFVGKS 140

Query: 121 RSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKSLQ 170
           RSVTIVVAYLMKKHGM+L+QA+ HVKS+RP A+PN+GF+ QLQ+LEKS+Q
Sbjct: 141 RSVTIVVAYLMKKHGMTLAQALQHVKSKRPVASPNAGFIRQLQDLEKSMQ 190
Has a dual specificity toward Ser/Thr and Tyr-containing proteins. Dephosphorylates MPK4 in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q9M8K7|DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana GN=DSPTP1B PE=1 SV=1 Back     alignment and function description
>sp|Q8WTR2|DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens GN=DUSP19 PE=1 SV=1 Back     alignment and function description
>sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 Back     alignment and function description
>sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 Back     alignment and function description
>sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 Back     alignment and function description
>sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBB1|DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus GN=Dusp6 PE=1 SV=1 Back     alignment and function description
>sp|Q64346|DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus GN=Dusp6 PE=1 SV=1 Back     alignment and function description
>sp|Q16828|DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens GN=DUSP6 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
255552233174 Dual specificity protein phosphatase, pu 0.988 0.982 0.736 1e-72
224114217176 predicted protein [Populus trichocarpa] 0.982 0.965 0.711 9e-69
225432538173 PREDICTED: protein phosphatase Slingshot 0.982 0.982 0.717 3e-67
297831114203 dual specificity protein phosphatase [Ar 0.994 0.847 0.668 2e-65
186510352201 dual specificity protein phosphatase 1 [ 0.994 0.855 0.662 2e-65
334185572228 dual specificity protein phosphatase 1 [ 0.982 0.745 0.664 2e-64
15229482198 dual specificity protein phosphatase 1 [ 0.982 0.858 0.664 2e-64
9294518198 dual-specificity protein phosphatase-lik 0.982 0.858 0.664 5e-64
388502248183 unknown [Medicago truncatula] 0.982 0.928 0.658 5e-62
351724277182 uncharacterized protein LOC100306342 [Gl 0.982 0.934 0.635 1e-58
>gi|255552233|ref|XP_002517161.1| Dual specificity protein phosphatase, putative [Ricinus communis] gi|223543796|gb|EEF45324.1| Dual specificity protein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 126/171 (73%), Positives = 151/171 (88%)

Query: 1   MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHI 60
           M++ D + +NQIAA++RV+N+T C +ED +P +IE+GLFLGS GAA NKD LKS+NITHI
Sbjct: 1   MEKTDGSIKNQIAALMRVINVTRCFKEDNIPCKIEEGLFLGSFGAAHNKDILKSKNITHI 60

Query: 61  LTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRS 120
           LTVAN+LAPAH NDFVYK+IGVAD+EDTNL QYFDEC +FIDEAKRQ GGVLVHCF G+S
Sbjct: 61  LTVANSLAPAHRNDFVYKIIGVADREDTNLRQYFDECFNFIDEAKRQGGGVLVHCFVGKS 120

Query: 121 RSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKSLQG 171
           RSVTIVVAYLMKKHG+SL+QA+ HVKS RPQAAPNSGF+ QL++ EK+ QG
Sbjct: 121 RSVTIVVAYLMKKHGLSLTQALQHVKSTRPQAAPNSGFISQLRDYEKTQQG 171

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224114217|ref|XP_002332403.1| predicted protein [Populus trichocarpa] gi|222832336|gb|EEE70813.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225432538|ref|XP_002280487.1| PREDICTED: protein phosphatase Slingshot homolog [Vitis vinifera] gi|297736986|emb|CBI26187.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297831114|ref|XP_002883439.1| dual specificity protein phosphatase [Arabidopsis lyrata subsp. lyrata] gi|297329279|gb|EFH59698.1| dual specificity protein phosphatase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186510352|ref|NP_001118683.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] gi|332643264|gb|AEE76785.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185572|ref|NP_001189955.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] gi|332643265|gb|AEE76786.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15229482|ref|NP_189003.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] gi|75267847|sp|Q9ZR37.1|DUS1_ARATH RecName: Full=Dual specificity protein phosphatase 1; Short=AtDsPTP1 gi|4150963|emb|CAA77232.1| DsPTP1 protein [Arabidopsis thaliana] gi|332643263|gb|AEE76784.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9294518|dbj|BAB02780.1| dual-specificity protein phosphatase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388502248|gb|AFK39190.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|351724277|ref|NP_001237308.1| uncharacterized protein LOC100306342 [Glycine max] gi|255628251|gb|ACU14470.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
TAIR|locus:2082395167 MKP2 "MAPK phosphatase 2" [Ara 0.803 0.832 0.661 5e-44
UNIPROTKB|Q5VNG7199 OJ1460_H08.5 "Uncharacterized 0.971 0.844 0.552 1.2e-42
UNIPROTKB|F1NG52207 DUSP19 "Uncharacterized protei 0.699 0.584 0.479 2.2e-25
UNIPROTKB|Q8WTR2217 DUSP19 "Dual specificity prote 0.722 0.576 0.48 2.9e-25
UNIPROTKB|F1RYL2227 DUSP19 "Uncharacterized protei 0.722 0.550 0.456 5.9e-25
UNIPROTKB|A6H7A7227 DUSP19 "Uncharacterized protei 0.722 0.550 0.464 7.6e-25
UNIPROTKB|E2RKL4227 DUSP19 "Uncharacterized protei 0.699 0.533 0.462 2.6e-24
UNIPROTKB|Q4H3P3499 Ci-DUSP6.9 "Dual specificity p 0.803 0.278 0.468 5.6e-24
ZFIN|ZDB-GENE-030131-5457364 dusp7 "dual specificity phosph 0.739 0.351 0.461 2.3e-23
ZFIN|ZDB-GENE-081104-382213 dusp19 "dual specificity phosp 0.699 0.568 0.438 2.3e-23
TAIR|locus:2082395 MKP2 "MAPK phosphatase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 464 (168.4 bits), Expect = 5.0e-44, P = 5.0e-44
 Identities = 92/139 (66%), Positives = 108/139 (77%)

Query:    33 EIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQ 92
             EI+QGLF+GS+  A+NKD LKS NITH+LTVA ALAP +P+DFVYKVI V D+ +T+L+ 
Sbjct:    27 EIQQGLFIGSVAEANNKDFLKSSNITHVLTVAVALAPPYPDDFVYKVIEVVDRSETDLTV 86

Query:    93 YFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQA 152
             YFDEC SFID+A +  GGVLVHCF G SRSVTIVVAYLMKKHGM  S+AM  V+SRR QA
Sbjct:    87 YFDECYSFIDQAIQSGGGVLVHCFMGMSRSVTIVVAYLMKKHGMGFSKAMELVRSRRHQA 146

Query:   153 APNSGFXXXXXXXXKSLQG 171
              PN GF        KS+QG
Sbjct:   147 YPNPGFISQLQQFEKSIQG 165
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006470 "protein dephosphorylation" evidence=IEA;IBA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IEA;ISS;IBA
GO:0016311 "dephosphorylation" evidence=IEA
GO:0016791 "phosphatase activity" evidence=IEA
GO:0005516 "calmodulin binding" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0007243 "intracellular protein kinase cascade" evidence=IC;RCA
GO:0010193 "response to ozone" evidence=IMP
GO:0033549 "MAP kinase phosphatase activity" evidence=IDA
GO:0043407 "negative regulation of MAP kinase activity" evidence=RCA;IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0034051 "negative regulation of plant-type hypersensitive response" evidence=IMP
GO:0034599 "cellular response to oxidative stress" evidence=IMP
UNIPROTKB|Q5VNG7 OJ1460_H08.5 "Uncharacterized protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG52 DUSP19 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WTR2 DUSP19 "Dual specificity protein phosphatase 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYL2 DUSP19 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A6H7A7 DUSP19 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKL4 DUSP19 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q4H3P3 Ci-DUSP6.9 "Dual specificity phosphatase" [Ciona intestinalis (taxid:7719)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5457 dusp7 "dual specificity phosphatase 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-382 dusp19 "dual specificity phosphatase 19" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZR37DUS1_ARATH3, ., 1, ., 3, ., 4, 80.66470.98260.8585yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.824
3rd Layer3.1.30.766
3rd Layer3.1.3.480.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_2190008
hypothetical protein (176 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.VIII.2383.1
hypothetical protein (239 aa)
  •     0.414

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 2e-59
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 4e-49
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 6e-41
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 2e-15
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 6e-13
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 3e-04
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 3e-04
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information 
 Score =  181 bits (461), Expect = 2e-59
 Identities = 68/136 (50%), Positives = 91/136 (66%), Gaps = 2/136 (1%)

Query: 33  EIEQGLFLGSIGAASNKDALKSRNITHILTVANAL--APAHPNDFVYKVIGVADKEDTNL 90
           EI  GL+LGS  AAS+K+ LK   ITH+L VA  +       +DF Y  + + D    ++
Sbjct: 4   EITPGLYLGSYPAASDKELLKKLGITHVLNVAKEVPNENLFLSDFNYLYVPILDLPSQDI 63

Query: 91  SQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRP 150
           S+YFDE + FID+A+ + G VLVHC AG SRS T+V+AYLMK  G+SL +A   VKSRRP
Sbjct: 64  SKYFDEAVDFIDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLGLSLREAYEFVKSRRP 123

Query: 151 QAAPNSGFLLQLQELE 166
             +PN+GF+ QL+E E
Sbjct: 124 IISPNAGFMRQLKEYE 139

Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 100.0
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 100.0
KOG1718198 consensus Dual specificity phosphatase [Defense me 100.0
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 100.0
KOG1717343 consensus Dual specificity phosphatase [Defense me 99.97
KOG1716285 consensus Dual specificity phosphatase [Defense me 99.97
PRK12361 547 hypothetical protein; Provisional 99.96
PTZ00393241 protein tyrosine phosphatase; Provisional 99.96
PTZ00242166 protein tyrosine phosphatase; Provisional 99.94
KOG1719183 consensus Dual specificity phosphatase [Defense me 99.92
KOG1720225 consensus Protein tyrosine phosphatase CDC14 [Defe 99.87
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.75
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.74
KOG2836173 consensus Protein tyrosine phosphatase IVA1 [Signa 99.73
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.7
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.68
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 99.52
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.51
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.51
PLN02727 986 NAD kinase 99.42
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.33
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.32
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 99.32
COG3453130 Uncharacterized protein conserved in bacteria [Fun 99.27
KOG2283 434 consensus Clathrin coat dissociation kinase GAK/PT 99.19
COG5350172 Predicted protein tyrosine phosphatase [General fu 99.18
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 99.18
PHA02742303 protein tyrosine phosphatase; Provisional 99.17
KOG1572249 consensus Predicted protein tyrosine phosphatase [ 99.13
PHA02740298 protein tyrosine phosphatase; Provisional 99.12
PHA02747312 protein tyrosine phosphatase; Provisional 99.08
PHA02746323 protein tyrosine phosphatase; Provisional 99.05
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 98.99
PHA02738320 hypothetical protein; Provisional 98.99
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 98.82
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 98.79
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 98.74
KOG07921144 consensus Protein tyrosine phosphatase PTPMEG, con 98.73
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 98.72
KOG0790600 consensus Protein tyrosine phosphatase Corkscrew a 98.7
KOG2386 393 consensus mRNA capping enzyme, guanylyltransferase 98.64
KOG07931004 consensus Protein tyrosine phosphatase [Signal tra 98.54
KOG0791374 consensus Protein tyrosine phosphatase, contains f 98.39
KOG0789415 consensus Protein tyrosine phosphatase [Signal tra 98.28
KOG4228 1087 consensus Protein tyrosine phosphatase [Signal tra 97.94
KOG42281087 consensus Protein tyrosine phosphatase [Signal tra 97.73
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 97.26
KOG4471 717 consensus Phosphatidylinositol 3-phosphate 3-phosp 96.6
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 95.47
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 95.25
KOG1089 573 consensus Myotubularin-related phosphatidylinosito 94.63
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 94.54
PLN02160136 thiosulfate sulfurtransferase 93.94
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 92.57
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 91.99
PRK01415247 hypothetical protein; Validated 90.99
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 90.75
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 90.2
PRK05320257 rhodanese superfamily protein; Provisional 89.8
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 89.35
COG1054308 Predicted sulfurtransferase [General function pred 88.24
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 87.56
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 87.05
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 86.02
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 85.74
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 85.32
TIGR03642124 cas_csx13 CRISPR-associated protein, Csx13 family. 85.02
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 84.61
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 83.74
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 83.63
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 83.41
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 82.9
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information 
Probab=100.00  E-value=5e-36  Score=211.15  Aligned_cols=138  Identities=44%  Similarity=0.706  Sum_probs=130.1

Q ss_pred             CeeccCCeEecCcccCCCHHHHHhCCCcEEEEcCCCCCCCCCCCeEEEEEeeecCCCCChHHHHHHHHHHHHHHHhCCCc
Q 030712           31 PFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGG  110 (173)
Q Consensus        31 ~~~I~~~l~~G~~~~~~~~~~l~~~gi~~vi~l~~~~~~~~~~~~~~~~~p~~d~~~~~~~~~~~~~~~~i~~~~~~~~~  110 (173)
                      |++|.|+||+|+.+++.+.+.+++.||++|||++.+.+.....+++|+++|+.|....++...+..+.++|+...++|++
T Consensus         1 ~~~I~~~l~~G~~~~~~~~~~l~~~gi~~Vi~l~~~~~~~~~~~~~~~~ipi~D~~~~~~~~~~~~~~~~i~~~~~~~~~   80 (138)
T smart00195        1 PSEILPHLYLGSYSSALNLALLKKLGITHVINVTNEVPNLNKKGFTYLGVPILDNTETKISPYFPEAVEFIEDAEKKGGK   80 (138)
T ss_pred             CcEEeCCeEECChhHcCCHHHHHHcCCCEEEEccCCCCCCCCCCCEEEEEECCCCCCCChHHHHHHHHHHHHHHhcCCCe
Confidence            78999999999999999999999999999999998876656788999999999977777777899999999999999999


Q ss_pred             EEEEcCCCCChHHHHHHHHHHhhcCCCHHHHHHHHHhhCCCCCCCHhHHHHHHHHHHH
Q 030712          111 VLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKS  168 (173)
Q Consensus       111 VlVHC~~G~~RS~~v~~ayL~~~~~~~~~~A~~~vr~~rp~~~~~~~~~~~L~~~~~~  168 (173)
                      |+|||.+|.||||+++++|||...|+++++|+++++.+||.+.||++|+++|.+|+++
T Consensus        81 VlVHC~~G~~RS~~v~~~yl~~~~~~~~~~A~~~v~~~R~~~~p~~~~~~qL~~~e~~  138 (138)
T smart00195       81 VLVHCQAGVSRSATLIIAYLMKYRNLSLNDAYDFVKDRRPIISPNFGFLRQLIEYERK  138 (138)
T ss_pred             EEEECCCCCchHHHHHHHHHHHHhCCCHHHHHHHHHHHCCccCCCHhHHHHHHHHhhC
Confidence            9999999999999999999999999999999999999999999999999999999873

>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] Back     alignment and domain information
>KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] Back     alignment and domain information
>KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>KOG1089 consensus Myotubularin-related phosphatidylinositol 3-phosphate 3-phosphatase MTM6 [General function prediction only] Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03642 cas_csx13 CRISPR-associated protein, Csx13 family Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
3s4e_A144 Crystal Structrue Of A Novel Mitogen-Activated Prot 2e-26
3lj8_A146 Crystal Structure Of Mkp-4 Length = 146 1e-23
1mkp_A144 Crystal Structure Of Pyst1 (Mkp3) Length = 144 3e-23
2hxp_A155 Crystal Structure Of The Human Phosphatase (Dusp9) 2e-22
2nt2_A145 Crystal Structure Of Slingshot Phosphatase 2 Length 4e-20
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 1e-19
1yz4_A160 Crystal Structure Of Dusp15 Length = 160 2e-19
3ezz_A144 Crystal Structure Of Human Mkp-2 Length = 144 5e-19
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 1e-18
1m3g_A145 Solution Structure Of The Catalytic Domain Of Mapk 2e-18
2esb_A188 Crystal Structure Of Human Dusp18 Length = 188 6e-18
1wrm_A165 Crystal Structure Of Jsp-1 Length = 165 4e-17
2r0b_A154 Crystal Structure Of Human Tyrosine Phosphatase-lik 8e-17
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 1e-15
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 1e-15
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 8e-15
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 9e-15
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 2e-14
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 3e-14
4hrf_A160 Atomic Structure Of Dusp26 Length = 160 4e-13
2hcm_A164 Crystal Structure Of Mouse Putative Dual Specificit 3e-12
2y96_A219 Structure Of Human Dual-Specificity Phosphatase 27 6e-11
2pq5_A205 Crystal Structure Of Dual Specificity Protein Phosp 1e-10
2gwo_A198 Crystal Structure Of Tmdp Length = 198 2e-10
2j16_B182 Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 2e-08
2j17_A182 Ptyr Bound Form Of Sdp-1 Length = 182 4e-07
2j16_A182 Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 5e-07
3emu_A161 Crystal Structure Of A Leucine Rich Repeat And Phos 1e-06
2rf6_A176 Crystal Structure Of The Vaccinia Virus Dual-Specif 1e-06
2q05_A195 Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FRO 1e-06
2p4d_A172 Structure-Assisted Discovery Of Variola Major H1 Ph 2e-06
1ohc_A348 Structure Of The Proline Directed Phosphatase Cdc14 1e-04
4erc_A150 Structure Of Vhz Bound To Metavanadate Length = 150 5e-04
3rgo_A157 Crystal Structure Of Ptpmt1 Length = 157 7e-04
>pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (287), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 74/125 (59%)
Query: 34  IEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQY 93
           I+  L LGS  AA + D LK   +THIL VA  +  A  +DF YK I + D  +TN+  Y
Sbjct: 7   IKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSY 66
Query: 94  FDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAA 153
           F EC  FI+EAKR+ G VLVH  AG SR+  IV+ +LM     S + A   VK+ RP   
Sbjct: 67  FPECFEFIEEAKRKDGVVLVHSNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSIC 126
Query: 154 PNSGF 158
           PNSGF
Sbjct: 127 PNSGF 131
>pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 Back     alignment and structure
>pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 Back     alignment and structure
>pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 Back     alignment and structure
>pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 Back     alignment and structure
>pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 Back     alignment and structure
>pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure
>pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 Back     alignment and structure
>pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 Back     alignment and structure
>pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 Back     alignment and structure
>pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure
>pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 Back     alignment and structure
>pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 Back     alignment and structure
>pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 Back     alignment and structure
>pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 Back     alignment and structure
>pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 Back     alignment and structure
>pdb|2J16|B Chain B, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|2J17|A Chain A, Ptyr Bound Form Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|2J16|A Chain A, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|3EMU|A Chain A, Crystal Structure Of A Leucine Rich Repeat And Phosphatase Domain Containing Protein From Entamoeba Histolytica Length = 161 Back     alignment and structure
>pdb|2RF6|A Chain A, Crystal Structure Of The Vaccinia Virus Dual-Specificity Phosphatase Vh1 Length = 176 Back     alignment and structure
>pdb|2Q05|A Chain A, Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FROM VACCINIA VIRUS Wr Length = 195 Back     alignment and structure
>pdb|2P4D|A Chain A, Structure-Assisted Discovery Of Variola Major H1 Phosphatase Inhibitors Length = 172 Back     alignment and structure
>pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 Back     alignment and structure
>pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 Back     alignment and structure
>pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 2e-77
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 6e-77
3emu_A161 Leucine rich repeat and phosphatase domain contain 1e-76
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 2e-76
2hcm_A164 Dual specificity protein phosphatase; structural g 2e-76
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 2e-76
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 7e-76
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 1e-75
2hxp_A155 Dual specificity protein phosphatase 9; human phos 2e-74
2oud_A177 Dual specificity protein phosphatase 10; A central 8e-74
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 1e-73
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 1e-73
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 5e-73
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 4e-72
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 1e-69
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 2e-69
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 3e-67
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 6e-67
2q05_A195 Late protein H1, dual specificity protein phosphat 6e-67
3cm3_A176 Late protein H1, dual specificity protein phosphat 1e-65
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 1e-61
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 7e-60
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 2e-37
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 4e-30
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 4e-21
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 2e-17
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 2e-14
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 1e-13
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 5e-13
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 6e-11
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 7e-11
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 3e-10
1xri_A151 AT1G05000; structural genomics, protein structure 5e-07
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 3e-06
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 2e-05
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 3e-04
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 1e-04
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 1e-04
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 1e-04
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
 Score =  226 bits (578), Expect = 2e-77
 Identities = 55/142 (38%), Positives = 81/142 (57%)

Query: 31  PFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNL 90
           P +I + +FLGS   ASN + L++R + +IL V   +    P  F Y  I V D+E T+L
Sbjct: 4   PTQIFEHVFLGSEWNASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVYDEEATDL 63

Query: 91  SQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRP 150
             Y+++   FI +AK+     LVH   G SRS + V+AY MK++G +L +A  +VK RR 
Sbjct: 64  LAYWNDTYKFISKAKKHGSKCLVHSKMGVSRSASTVIAYAMKEYGWNLDRAYDYVKERRT 123

Query: 151 QAAPNSGFLLQLQELEKSLQGR 172
              PN  F+ QL+E +  L  R
Sbjct: 124 VTKPNPSFMRQLEEYQGILLAR 145
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
3emu_A161 Leucine rich repeat and phosphatase domain contain 100.0
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 100.0
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 100.0
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 100.0
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 100.0
2hcm_A164 Dual specificity protein phosphatase; structural g 100.0
2hxp_A155 Dual specificity protein phosphatase 9; human phos 100.0
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 100.0
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 100.0
2oud_A177 Dual specificity protein phosphatase 10; A central 100.0
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 100.0
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 100.0
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 100.0
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 100.0
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 100.0
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 100.0
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 100.0
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 100.0
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 100.0
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 100.0
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.98
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.97
2q05_A195 Late protein H1, dual specificity protein phosphat 99.97
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.97
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.95
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.95
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.92
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.91
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.9
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.9
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.9
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.89
1xri_A151 AT1G05000; structural genomics, protein structure 99.88
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.88
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.81
2f46_A156 Hypothetical protein; structural genomics, joint c 99.78
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.74
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 99.73
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.71
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 99.45
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.4
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.39
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 99.38
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.36
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.32
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.32
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.31
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.3
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.3
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.3
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.29
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.29
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.29
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.28
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.28
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.27
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.27
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.26
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.26
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.26
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.25
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.25
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.23
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.22
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.22
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.22
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.19
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.19
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.18
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.16
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 99.15
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.15
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.12
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.09
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.08
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 99.07
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 99.06
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.06
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 99.02
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.98
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 98.95
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 98.86
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 98.85
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 97.82
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 95.4
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 95.08
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 94.62
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 84.88
1vee_A134 Proline-rich protein family; hypothetical protein, 84.09
2jtq_A85 Phage shock protein E; solution structure rhodanes 83.1
3sxu_A150 DNA polymerase III subunit CHI; DNA replication, C 82.99
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 82.41
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 80.02
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
Probab=100.00  E-value=6.9e-39  Score=230.34  Aligned_cols=146  Identities=28%  Similarity=0.380  Sum_probs=133.0

Q ss_pred             CCCCeeccCCeEecCcccCCCHHHHHhCCCcEEEEcCCCCCCCCCCCeEEEEEeeecCCCCChHHHHHHHHHHHHHHHhC
Q 030712           28 DRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQ  107 (173)
Q Consensus        28 ~~~~~~I~~~l~~G~~~~~~~~~~l~~~gi~~vi~l~~~~~~~~~~~~~~~~~p~~d~~~~~~~~~~~~~~~~i~~~~~~  107 (173)
                      ...+++|.|+||+|+.+.+.+.+.|++.||++|||++.+.+..++.+++|+++|+.|.+.+++...|+.++++|+++++.
T Consensus         7 ~~~~~~I~~~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~~~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~   86 (161)
T 3emu_A            7 TLSPTQIIQYIHLGSFLNAHNVDYIHNNNISSILLVGIEVPSLFKDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQR   86 (161)
T ss_dssp             GGSCEEEETTEEEEETTGGGCHHHHHHTTEEEEEEEC-------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCceEEECCEEECChHHhhCHHHHHHCCCCEEEEeCCCCccccCCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHhc
Confidence            36689999999999999999999999999999999998877667889999999999999888888899999999999999


Q ss_pred             CCcEEEEcCCCCChHHHHHHHHHHhhcCCCHHHHHHHHHhhCCCCCCCHhHHHHHHHHHHHhccCC
Q 030712          108 RGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKSLQGRT  173 (173)
Q Consensus       108 ~~~VlVHC~~G~~RS~~v~~ayL~~~~~~~~~~A~~~vr~~rp~~~~~~~~~~~L~~~~~~l~~~~  173 (173)
                      +++|||||.+|.|||+++++||||...|+++++|+++|+++||.+.||++|+++|.+|+++|.+++
T Consensus        87 ~~~VlVHC~~G~sRS~~vv~ayLm~~~~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~~~~  152 (161)
T 3emu_A           87 KEGVLIISGTGVNKAPAIVIAFLMYYQRLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLEKMN  152 (161)
T ss_dssp             TCEEEEEESSSSSHHHHHHHHHHHHHTTCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHHHT
T ss_pred             CCeEEEEcCCCCcHHHHHHHHHHHHHhCCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHhcCC
Confidence            999999999999999999999999999999999999999999999999999999999999998753
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3sxu_A DNA polymerase III subunit CHI; DNA replication, CHI binds to SSB and PSI, transferase; HET: DNA; 1.85A {Escherichia coli} SCOP: c.128.1.1 PDB: 1em8_A* Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 7e-45
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 3e-42
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 8e-42
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 8e-24
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 9e-19
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 4e-14
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 3e-10
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 4e-09
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 1e-08
d1xria_151 c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal 1e-06
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pac-1 [TaxId: 9606]

 Score =  142 bits (360), Expect = 7e-45
 Identities = 56/139 (40%), Positives = 74/139 (53%)

Query: 31  PFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNL 90
           P EI   LFLGS   +S+   L++  IT +L V+ +        F YK I V D +   +
Sbjct: 4   PVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEI 63

Query: 91  SQYFDECISFIDEAKRQRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRP 150
           S +F E I FID  K   G VLVH  AG SRS TI +AYLM+   + L +A   VK RR 
Sbjct: 64  SAWFQEAIGFIDWVKNSGGRVLVHSQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRG 123

Query: 151 QAAPNSGFLLQLQELEKSL 169
             +PN  F+ QL + E  +
Sbjct: 124 VISPNFSFMGQLLQFETQV 142
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 100.0
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 100.0
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 100.0
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.93
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.92
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.9
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.88
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.85
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.82
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 99.26
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.25
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.18
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.13
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 99.13
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 99.08
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.07
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 99.04
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.02
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.0
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 98.99
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 98.98
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 98.98
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 97.43
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 95.61
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 93.22
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 87.86
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

Probab=100.00  E-value=1.8e-38  Score=222.56  Aligned_cols=141  Identities=43%  Similarity=0.638  Sum_probs=132.5

Q ss_pred             CCCeeccCCeEecCcccCCCHHHHHhCCCcEEEEcCCCCCCC--CCCCeEEEEEeeecCCCCChHHHHHHHHHHHHHHHh
Q 030712           29 RVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPA--HPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKR  106 (173)
Q Consensus        29 ~~~~~I~~~l~~G~~~~~~~~~~l~~~gi~~vi~l~~~~~~~--~~~~~~~~~~p~~d~~~~~~~~~~~~~~~~i~~~~~  106 (173)
                      ++|+||.|+||+|+..++.+.+.|+..||++|||++.+.+..  ...++.|+++|+.|.+.+++...|+.+.++|.+.++
T Consensus         2 ~~P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~   81 (144)
T d1mkpa_           2 SFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARG   81 (144)
T ss_dssp             CCCEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSCCCEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHH
T ss_pred             CCCCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccCCccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhh
Confidence            579999999999999999999999999999999998776543  267899999999999888888889999999999999


Q ss_pred             CCCcEEEEcCCCCChHHHHHHHHHHhhcCCCHHHHHHHHHhhCCCCCCCHhHHHHHHHHHHHh
Q 030712          107 QRGGVLVHCFAGRSRSVTIVVAYLMKKHGMSLSQAMGHVKSRRPQAAPNSGFLLQLQELEKSL  169 (173)
Q Consensus       107 ~~~~VlVHC~~G~~RS~~v~~ayL~~~~~~~~~~A~~~vr~~rp~~~~~~~~~~~L~~~~~~l  169 (173)
                      +|++|||||.+|.|||+++++||||...|+++++|+++|+++||.+.||.+|+++|.+|++.|
T Consensus        82 ~~~~VlVHC~~G~~RS~~vv~aYLm~~~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L  144 (144)
T d1mkpa_          82 KNCGVLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL  144 (144)
T ss_dssp             TTCEEEEECSSCSHHHHHHHHHHHHHHHTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHTC
T ss_pred             ccceEEEEecccccchHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhhC
Confidence            999999999999999999999999999999999999999999999999999999999999875
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure