Citrus Sinensis ID: 030808
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| 225443618 | 231 | PREDICTED: protein DEHYDRATION-INDUCED 1 | 0.795 | 0.588 | 0.919 | 2e-64 | |
| 255536745 | 231 | conserved hypothetical protein [Ricinus | 0.795 | 0.588 | 0.919 | 5e-64 | |
| 356521402 | 233 | PREDICTED: protein DEHYDRATION-INDUCED 1 | 0.777 | 0.570 | 0.888 | 2e-59 | |
| 217075142 | 234 | unknown [Medicago truncatula] gi|3884911 | 0.795 | 0.581 | 0.839 | 1e-58 | |
| 388508052 | 176 | unknown [Medicago truncatula] | 0.795 | 0.772 | 0.839 | 7e-58 | |
| 356548672 | 237 | PREDICTED: protein DEHYDRATION-INDUCED 1 | 0.789 | 0.569 | 0.875 | 1e-56 | |
| 449433818 | 199 | PREDICTED: protein DEHYDRATION-INDUCED 1 | 0.795 | 0.683 | 0.802 | 7e-56 | |
| 118483033 | 180 | unknown [Populus trichocarpa] | 0.795 | 0.755 | 0.861 | 2e-54 | |
| 192910804 | 230 | fiber protein Fb2 [Elaeis guineensis] | 0.789 | 0.586 | 0.795 | 7e-52 | |
| 294463922 | 229 | unknown [Picea sitchensis] | 0.783 | 0.585 | 0.737 | 3e-50 |
| >gi|225443618|ref|XP_002279435.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 249 bits (637), Expect = 2e-64, Method: Compositional matrix adjust.
Identities = 126/137 (91%), Positives = 132/137 (96%), Gaps = 1/137 (0%)
Query: 1 MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIAS 60
M++DFW SRLAAAKRQY LQ HHH SSQ+DRLSIDDFEVED+ RPDFPCPYCYED+DIAS
Sbjct: 1 MNTDFWASRLAAAKRQYALQ-HHHNSSQLDRLSIDDFEVEDEARPDFPCPYCYEDYDIAS 59
Query: 61 LCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQAL 120
LCSHLEDEHSCES+VTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQAL
Sbjct: 60 LCSHLEDEHSCESRVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQAL 119
Query: 121 SLLGRDLREAHLQVLLG 137
SLLGRDLREAHLQVLLG
Sbjct: 120 SLLGRDLREAHLQVLLG 136
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255536745|ref|XP_002509439.1| conserved hypothetical protein [Ricinus communis] gi|223549338|gb|EEF50826.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356521402|ref|XP_003529345.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|217075142|gb|ACJ85931.1| unknown [Medicago truncatula] gi|388491118|gb|AFK33625.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388508052|gb|AFK42092.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356548672|ref|XP_003542724.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449433818|ref|XP_004134694.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Cucumis sativus] gi|449529572|ref|XP_004171772.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|118483033|gb|ABK93427.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|192910804|gb|ACF06510.1| fiber protein Fb2 [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
| >gi|294463922|gb|ADE77482.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| TAIR|locus:2148528 | 222 | AT5G26990 [Arabidopsis thalian | 0.760 | 0.585 | 0.414 | 1.6e-24 | |
| TAIR|locus:2078062 | 223 | AT3G05700 [Arabidopsis thalian | 0.771 | 0.591 | 0.394 | 1.4e-23 | |
| TAIR|locus:2155934 | 211 | HRB1 "HYPERSENSITIVE TO RED AN | 0.766 | 0.620 | 0.379 | 5.7e-20 | |
| TAIR|locus:2196125 | 221 | AT1G02750 [Arabidopsis thalian | 0.584 | 0.452 | 0.346 | 3.7e-16 | |
| TAIR|locus:2137819 | 228 | AT4G02200 [Arabidopsis thalian | 0.391 | 0.293 | 0.370 | 9.1e-13 | |
| TAIR|locus:2083363 | 234 | AT3G06760 [Arabidopsis thalian | 0.233 | 0.170 | 0.525 | 2e-12 | |
| UNIPROTKB|I3LV30 | 181 | RNF114 "RING finger protein 11 | 0.228 | 0.215 | 0.5 | 0.00019 | |
| UNIPROTKB|Q4U5R4 | 230 | RNF114 "RING finger protein 11 | 0.228 | 0.169 | 0.5 | 0.00022 | |
| MGI|MGI:1933159 | 229 | Rnf114 "ring finger protein 11 | 0.228 | 0.170 | 0.5 | 0.0003 | |
| RGD|1303139 | 229 | Rnf114 "ring finger protein 11 | 0.228 | 0.170 | 0.5 | 0.0003 |
| TAIR|locus:2148528 AT5G26990 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 280 (103.6 bits), Expect = 1.6e-24, P = 1.6e-24
Identities = 56/135 (41%), Positives = 83/135 (61%)
Query: 1 MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIAS 60
MDSD W+ RLA+A R+Y L S + L ++ E EDD R ++ CP+C + FDI S
Sbjct: 1 MDSDSWSDRLASASRRYQLD---FLSRSDNFLGFEEIEGEDDFREEYACPFCSDYFDIVS 57
Query: 61 LCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQXXXXXXXVAIPSSQAL 120
LC H++++H ++K VCPIC+VKV+ DM++HITLQH ++FK+ S L
Sbjct: 58 LCCHIDEDHPMDAKNGVCPICAVKVSSDMIAHITLQHANMFKVTRKRKSRRGGAQSM--L 115
Query: 121 SLLGRDLREAHLQVL 135
S+L R+ + + Q L
Sbjct: 116 SILKREFPDGNFQSL 130
|
|
| TAIR|locus:2078062 AT3G05700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155934 HRB1 "HYPERSENSITIVE TO RED AND BLUE" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196125 AT1G02750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2137819 AT4G02200 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083363 AT3G06760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LV30 RNF114 "RING finger protein 114" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4U5R4 RNF114 "RING finger protein 114" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1933159 Rnf114 "ring finger protein 114" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1303139 Rnf114 "ring finger protein 114" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 171 | |||
| pfam05605 | 209 | pfam05605, Di19, Drought induced 19 protein (Di19) | 8e-53 |
| >gnl|CDD|218654 pfam05605, Di19, Drought induced 19 protein (Di19) | Back alignment and domain information |
|---|
Score = 166 bits (423), Expect = 8e-53
Identities = 69/128 (53%), Positives = 89/128 (69%), Gaps = 6/128 (4%)
Query: 10 LAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEH 69
A+A Y D +D E ED+VR +FPCP+CYEDFDI SLC H+++EH
Sbjct: 1 HASASASYQRALPSRS----DLYLFEDIEGEDEVREEFPCPFCYEDFDIVSLCCHIDEEH 56
Query: 70 SCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQALSLLGRDLRE 129
E+K VCP+C+ +V +DM++HIT+QHGHLFK+QRRRRLRR SS ALSLL R+LR+
Sbjct: 57 PFEAKNGVCPVCADRVGKDMVAHITVQHGHLFKMQRRRRLRR--GGSSSALSLLKRELRD 114
Query: 130 AHLQVLLG 137
+LQ LLG
Sbjct: 115 GNLQSLLG 122
|
This family consists of several drought induced 19 (Di19) like proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought. The precise function of Di19 is unknown. Length = 209 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 99.81 | |
| PF14571 | 105 | Di19_C: Stress-induced protein Di19, C-terminal | 99.15 | |
| KOG1280 | 381 | consensus Uncharacterized conserved protein contai | 98.76 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 94.71 | |
| KOG2923 | 67 | consensus Uncharacterized conserved protein [Funct | 94.55 | |
| COG5216 | 67 | Uncharacterized conserved protein [Function unknow | 94.14 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 93.5 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 92.85 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 92.51 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 92.37 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 91.79 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 90.17 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 89.5 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 88.44 | |
| PHA00732 | 79 | hypothetical protein | 87.75 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 87.48 | |
| PHA00733 | 128 | hypothetical protein | 87.34 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 86.84 | |
| PF14354 | 61 | Lar_restr_allev: Restriction alleviation protein L | 85.11 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 84.86 | |
| TIGR01206 | 54 | lysW lysine biosynthesis protein LysW. This very s | 84.61 | |
| PRK09710 | 64 | lar restriction alleviation and modification prote | 84.33 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 83.97 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 83.49 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 83.04 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 81.99 | |
| smart00734 | 26 | ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 | 81.1 |
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
Probab=99.81 E-value=1.8e-20 Score=125.53 Aligned_cols=54 Identities=48% Similarity=0.938 Sum_probs=52.1
Q ss_pred CcccCCCCCCCCCHHHHHHhhhhhhcCCCCccccCCccccchhhHHhhhhhccc
Q 030808 45 PDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHG 98 (171)
Q Consensus 45 ~~F~CPfC~e~fD~~~L~~H~~eeH~~e~k~vVCPVCaa~~s~d~l~HL~~qH~ 98 (171)
++|+||||+++||+.+|++|+.++|+.+.++||||||+.+++.||++||+.+|+
T Consensus 1 ~~f~CP~C~~~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~~l~~Hl~~~H~ 54 (54)
T PF05605_consen 1 DSFTCPYCGKGFSESSLVEHCEDEHRSESKNVVCPICSSRVTDNLIRHLNSQHR 54 (54)
T ss_pred CCcCCCCCCCccCHHHHHHHHHhHCcCCCCCccCCCchhhhhhHHHHHHHHhcC
Confidence 379999999999999999999999999999999999999999999999999996
|
Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown. |
| >PF14571 Di19_C: Stress-induced protein Di19, C-terminal | Back alignment and domain information |
|---|
| >KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >KOG2923 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5216 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF14354 Lar_restr_allev: Restriction alleviation protein Lar | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >TIGR01206 lysW lysine biosynthesis protein LysW | Back alignment and domain information |
|---|
| >PRK09710 lar restriction alleviation and modification protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 97.52 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 97.49 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 97.06 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 96.91 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 96.69 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 96.67 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 96.67 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 96.55 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 96.42 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 96.33 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 96.3 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 96.27 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 96.25 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 96.12 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 96.1 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 96.05 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 96.03 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 96.02 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 96.0 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 95.99 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 95.99 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 95.97 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 95.91 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 95.82 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 95.8 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 95.77 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 95.6 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 95.56 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 95.55 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 95.49 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 95.33 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 95.25 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 95.08 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 95.07 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 95.05 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 95.0 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 95.0 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.86 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.85 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.81 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.79 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.67 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.62 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 94.61 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.58 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.55 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.48 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 94.42 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 94.39 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.37 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 94.34 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 94.33 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.32 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.29 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.29 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.26 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 94.26 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.2 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.18 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.14 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.08 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.08 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 94.06 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 94.05 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 93.98 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 93.94 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 93.92 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.91 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.87 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 93.86 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.86 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 93.86 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 93.86 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.81 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 93.81 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 93.8 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 93.78 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.73 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 93.71 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 93.6 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.55 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.52 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 93.44 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 93.43 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 93.42 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.31 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.28 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.26 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 93.21 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.18 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.15 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 93.04 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.98 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 92.96 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 92.94 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.91 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.89 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.89 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 92.76 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 92.76 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.7 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.68 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.62 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 92.42 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 92.23 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 91.96 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 91.95 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 91.84 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 91.52 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 91.49 | |
| 2jr7_A | 89 | DPH3 homolog; DESR1, CSL zinc finger, metal bindin | 91.01 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 90.94 | |
| 1wge_A | 83 | Hypothetical protein 2610018L09RIK; diphthamide,CS | 90.91 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 90.7 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 90.34 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 90.3 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 90.28 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.2 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 90.06 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.92 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 89.86 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 89.82 | |
| 1yop_A | 83 | KTI11P; zinc finger, metal binding protein; NMR {S | 89.6 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 89.14 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 88.92 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 88.84 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 88.46 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 88.43 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.36 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.36 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.28 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 88.22 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 88.01 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.99 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.95 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.93 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.88 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 87.85 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 87.84 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.76 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.66 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 87.5 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 87.14 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 87.07 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 86.97 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 86.49 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 86.46 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 86.38 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 85.98 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 85.59 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 85.49 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 85.39 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 85.33 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 85.08 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 84.94 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 84.91 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 84.71 | |
| 1wir_A | 121 | Protein arginine N-methyltransferase 3; C2H2 zinc | 84.65 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 84.51 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 84.41 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 84.31 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 84.3 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 84.22 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 84.17 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 84.1 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 83.94 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 83.89 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 83.67 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 83.07 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 82.79 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 82.37 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 81.68 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 81.59 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 81.5 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 81.02 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.88 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 80.84 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 80.74 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 80.55 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 80.54 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 80.49 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 80.48 |
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
Probab=97.52 E-value=0.0001 Score=46.64 Aligned_cols=54 Identities=26% Similarity=0.647 Sum_probs=45.0
Q ss_pred CcccCCCCCCCC-CHHHHHHhhhhhhcCCCCccccCCccccc--hhhHHhhhhhccc
Q 030808 45 PDFPCPYCYEDF-DIASLCSHLEDEHSCESKVTVCPICSVKV--ARDMLSHITLQHG 98 (171)
Q Consensus 45 ~~F~CPfC~e~f-D~~~L~~H~~eeH~~e~k~vVCPVCaa~~--s~d~l~HL~~qH~ 98 (171)
..|.|+.|++.| ....|..|....|..+.+.-.|++|...- ..++..|+...|+
T Consensus 9 k~~~C~~C~k~f~~~~~l~~H~~~~H~~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~ 65 (66)
T 2drp_A 9 HTYRCKVCSRVYTHISNFCRHYVTSHKRNVKVYPCPFCFKEFTRKDNMTAHVKIIHK 65 (66)
T ss_dssp TEEECTTTCCEESSHHHHHHHHHHHSSSSCCCEECTTTCCEESCHHHHHHHHHHHTC
T ss_pred cceECCCCcchhCCHHHHHHHHHHHcCCCCcCeECCCCCCccCCHHHHHHHHHHHcC
Confidence 369999999944 68889999999897667788999997763 5689999988886
|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| d1wgea1 | 70 | DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus | 94.1 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 92.88 | |
| d1ywsa1 | 82 | Diphthamide biosynthesis protein 3, DPH3 {Baker's | 91.98 | |
| d1yuja_ | 54 | GAGA factor {Drosophila melanogaster [TaxId: 7227] | 88.77 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 88.62 | |
| d1wira_ | 121 | Protein arginine N-methyltransferase 3 {Mouse (Mus | 88.57 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 87.61 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 86.59 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 85.78 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 85.0 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 84.17 | |
| d2ctda2 | 30 | Zinc finger protein 512, ZNF512 {Human (Homo sapie | 82.96 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 81.94 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 80.33 |
| >d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: CSL zinc finger family: CSL zinc finger domain: DelGEF-interacting protein 1, DelGIP1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=94.10 E-value=0.0082 Score=40.70 Aligned_cols=45 Identities=31% Similarity=0.758 Sum_probs=31.2
Q ss_pred cCCCcCCCCCCC-CCcccCCCCCC--CCCHHHHHHhhhhhhcCCCCccccCCccccc
Q 030808 32 LSIDDFEVEDDV-RPDFPCPYCYE--DFDIASLCSHLEDEHSCESKVTVCPICSVKV 85 (171)
Q Consensus 32 ~g~e~~~~ddd~-r~~F~CPfC~e--~fD~~~L~~H~~eeH~~e~k~vVCPVCaa~~ 85 (171)
+.+||++-|++. .-+|+|| ||. .+....|-++ .-.+.||-|+-.+
T Consensus 8 v~leD~~~dee~~~~~ypCp-CGd~F~it~~dLe~g--------e~V~~C~sCSL~i 55 (70)
T d1wgea1 8 VEIEDFQYDEDSETYFYPCP-CGDNFAITKEDLENG--------EDVATCPSCSLII 55 (70)
T ss_dssp EEGGGSCCBTTTTEEEECCS-SSSCEEEEHHHHHTT--------CCEEECTTTCCEE
T ss_pred EEeeeeeEeCCCCEEEeCCC-CCCeEEECHHHHhCC--------CeEEeCCCCceEE
Confidence 456777655443 5689999 998 6666777542 2245699999875
|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|