Citrus Sinensis ID: 030857
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 170 | ||||||
| 255565419 | 234 | lactoylglutathione lyase, putative [Rici | 0.9 | 0.653 | 0.875 | 8e-76 | |
| 326514208 | 239 | predicted protein [Hordeum vulgare subsp | 1.0 | 0.711 | 0.770 | 7e-75 | |
| 449459114 | 185 | PREDICTED: lactoylglutathione lyase-like | 0.882 | 0.810 | 0.88 | 3e-74 | |
| 117203563 | 187 | glyoxalase I [Arachis hypogaea] | 0.9 | 0.818 | 0.843 | 3e-74 | |
| 357167257 | 236 | PREDICTED: lactoylglutathione lyase-like | 0.976 | 0.703 | 0.783 | 6e-74 | |
| 388516521 | 186 | unknown [Medicago truncatula] | 0.976 | 0.892 | 0.789 | 8e-74 | |
| 3334244 | 185 | RecName: Full=Lactoylglutathione lyase; | 0.9 | 0.827 | 0.843 | 9e-74 | |
| 224104697 | 184 | predicted protein [Populus trichocarpa] | 0.9 | 0.831 | 0.876 | 1e-73 | |
| 3334245 | 186 | RecName: Full=Lactoylglutathione lyase; | 0.947 | 0.865 | 0.807 | 2e-73 | |
| 225436504 | 235 | PREDICTED: lactoylglutathione lyase isof | 0.952 | 0.689 | 0.808 | 3e-73 |
| >gi|255565419|ref|XP_002523700.1| lactoylglutathione lyase, putative [Ricinus communis] gi|223537004|gb|EEF38640.1| lactoylglutathione lyase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 287 bits (735), Expect = 8e-76, Method: Compositional matrix adjust.
Identities = 134/153 (87%), Positives = 143/153 (93%)
Query: 17 TMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFG 76
TM+RIKDPK SLDFYS VLGMSLLKRLDFPEMKFSLYF+GYE+TASAP DPV+RTVWTFG
Sbjct: 80 TMYRIKDPKQSLDFYSHVLGMSLLKRLDFPEMKFSLYFMGYENTASAPTDPVERTVWTFG 139
Query: 77 KPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFERLGVEFAKKP 136
+ ATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERF+ LGVEF KKP
Sbjct: 140 QKATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFKSLGVEFVKKP 199
Query: 137 DGGKLKGVAFIKDPDDYWIEIFDLKTIGKIGGS 169
+ GK+KG+AFIKDPD YWIEIFDLKTIGK GS
Sbjct: 200 EDGKMKGIAFIKDPDGYWIEIFDLKTIGKTTGS 232
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|326514208|dbj|BAJ92254.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|449459114|ref|XP_004147291.1| PREDICTED: lactoylglutathione lyase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|117203563|gb|ABJ88950.2| glyoxalase I [Arachis hypogaea] | Back alignment and taxonomy information |
|---|
| >gi|357167257|ref|XP_003581076.1| PREDICTED: lactoylglutathione lyase-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|388516521|gb|AFK46322.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|3334244|sp|O04885.1|LGUL_BRAJU RecName: Full=Lactoylglutathione lyase; AltName: Full=Aldoketomutase; AltName: Full=Glyoxalase I; Short=Glx I; AltName: Full=Ketone-aldehyde mutase; AltName: Full=Methylglyoxalase; AltName: Full=S-D-lactoylglutathione methylglyoxal lyase gi|2113825|emb|CAA73691.1| Glyoxalase I [Brassica juncea] | Back alignment and taxonomy information |
|---|
| >gi|224104697|ref|XP_002313532.1| predicted protein [Populus trichocarpa] gi|118481594|gb|ABK92739.1| unknown [Populus trichocarpa] gi|222849940|gb|EEE87487.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|3334245|sp|O49818.1|LGUL_CICAR RecName: Full=Lactoylglutathione lyase; AltName: Full=Aldoketomutase; AltName: Full=Glyoxalase I; Short=Glx I; AltName: Full=Ketone-aldehyde mutase; AltName: Full=Methylglyoxalase; AltName: Full=S-D-lactoylglutathione methylglyoxal lyase gi|2909424|emb|CAA12028.1| Glyoxalase I [Cicer arietinum] | Back alignment and taxonomy information |
|---|
| >gi|225436504|ref|XP_002276276.1| PREDICTED: lactoylglutathione lyase isoform 1 [Vitis vinifera] gi|297734925|emb|CBI17159.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 170 | ||||||
| TAIR|locus:2205110 | 235 | AT1G08110 [Arabidopsis thalian | 0.870 | 0.629 | 0.878 | 8.6e-72 | |
| UNIPROTKB|F1N9Q2 | 190 | GLO1 "Uncharacterized protein" | 0.847 | 0.757 | 0.689 | 2.6e-54 | |
| MGI|MGI:95742 | 184 | Glo1 "glyoxalase 1" [Mus muscu | 0.876 | 0.809 | 0.673 | 3.4e-54 | |
| RGD|2702 | 184 | Glo1 "glyoxalase 1" [Rattus no | 0.835 | 0.771 | 0.685 | 5.5e-54 | |
| UNIPROTKB|Q5BL69 | 184 | glo1 "Glyoxalase 1" [Xenopus ( | 0.852 | 0.788 | 0.673 | 3.8e-53 | |
| FB|FBgn0033162 | 176 | CG1707 [Drosophila melanogaste | 0.858 | 0.829 | 0.659 | 4.9e-53 | |
| UNIPROTKB|Q5EI50 | 149 | Q5EI50 "GekBS101P" [Gekko japo | 0.829 | 0.946 | 0.690 | 1.7e-52 | |
| ZFIN|ZDB-GENE-030722-9 | 180 | glo1 "glyoxalase 1" [Danio rer | 0.823 | 0.777 | 0.680 | 5.6e-52 | |
| UNIPROTKB|A4FUZ1 | 184 | GLO1 "GLO1 protein" [Bos tauru | 0.858 | 0.793 | 0.646 | 7.2e-52 | |
| UNIPROTKB|I3LDM7 | 184 | GLO1 "Uncharacterized protein" | 0.835 | 0.771 | 0.664 | 9.2e-52 |
| TAIR|locus:2205110 AT1G08110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 726 (260.6 bits), Expect = 8.6e-72, P = 8.6e-72
Identities = 130/148 (87%), Positives = 139/148 (93%)
Query: 17 TMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFG 76
TMFRIKDPK SLDFYSRVLGMSLLKRLDF EMKFSLYFLGYEDT +AP DP +RTVWTFG
Sbjct: 81 TMFRIKDPKASLDFYSRVLGMSLLKRLDFSEMKFSLYFLGYEDTTTAPTDPTERTVWTFG 140
Query: 77 KPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFERLGVEFAKKP 136
+PATIELTHNWGTESDP+FKGYHNGNSEPRGFGHIG+TVDDV+KACERFE LGVEFAKKP
Sbjct: 141 QPATIELTHNWGTESDPEFKGYHNGNSEPRGFGHIGVTVDDVHKACERFEELGVEFAKKP 200
Query: 137 DGGKLKGVAFIKDPDDYWIEIFDLKTIG 164
+ GK+K +AFIKDPD YWIEIFDLKTIG
Sbjct: 201 NDGKMKNIAFIKDPDGYWIEIFDLKTIG 228
|
|
| UNIPROTKB|F1N9Q2 GLO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95742 Glo1 "glyoxalase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|2702 Glo1 "glyoxalase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5BL69 glo1 "Glyoxalase 1" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033162 CG1707 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5EI50 Q5EI50 "GekBS101P" [Gekko japonicus (taxid:146911)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030722-9 glo1 "glyoxalase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4FUZ1 GLO1 "GLO1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LDM7 GLO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 170 | |||
| PLN02367 | 233 | PLN02367, PLN02367, lactoylglutathione lyase | 1e-110 | |
| PLN03042 | 185 | PLN03042, PLN03042, Lactoylglutathione lyase; Prov | 1e-106 | |
| TIGR00068 | 150 | TIGR00068, glyox_I, lactoylglutathione lyase | 1e-64 | |
| cd07233 | 121 | cd07233, Glyoxalase_I, Glyoxalase I catalyzes the | 3e-62 | |
| PRK10291 | 129 | PRK10291, PRK10291, glyoxalase I; Provisional | 3e-25 | |
| pfam00903 | 120 | pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist | 3e-21 | |
| PLN02300 | 286 | PLN02300, PLN02300, lactoylglutathione lyase | 6e-20 | |
| PLN02300 | 286 | PLN02300, PLN02300, lactoylglutathione lyase | 2e-13 | |
| cd06587 | 110 | cd06587, Glo_EDI_BRP_like, This domain superfamily | 6e-12 | |
| COG0346 | 138 | COG0346, GloA, Lactoylglutathione lyase and relate | 6e-12 | |
| pfam12681 | 109 | pfam12681, Glyoxalase_2, Glyoxalase-like domain | 7e-09 | |
| cd07245 | 114 | cd07245, Glo_EDI_BRP_like_9, This conserved domain | 7e-07 | |
| cd08358 | 127 | cd08358, Glo_EDI_BRP_like_21, This conserved domai | 5e-05 | |
| cd08346 | 126 | cd08346, PcpA_N_like, N-terminal domain of Sphingo | 2e-04 | |
| cd07249 | 128 | cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | 5e-04 | |
| pfam13669 | 110 | pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resi | 8e-04 | |
| cd07253 | 125 | cd07253, Glo_EDI_BRP_like_2, This conserved domain | 0.003 | |
| cd07254 | 120 | cd07254, Glo_EDI_BRP_like_20, This conserved domai | 0.003 |
| >gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase | Back alignment and domain information |
|---|
Score = 314 bits (805), Expect = e-110
Identities = 133/153 (86%), Positives = 141/153 (92%)
Query: 17 TMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFG 76
TM+RIKDPK SLDFYSRVLGMSLLKRLDFPEMKFSLYF+GYEDTASAP DP +RTVWTFG
Sbjct: 79 TMYRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTASAPTDPTERTVWTFG 138
Query: 77 KPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFERLGVEFAKKP 136
+ ATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFE LGVEF KKP
Sbjct: 139 QKATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFEELGVEFVKKP 198
Query: 137 DGGKLKGVAFIKDPDDYWIEIFDLKTIGKIGGS 169
+ GK+KG+AFIKDPD YWIEIFDLKTIG +
Sbjct: 199 NDGKMKGIAFIKDPDGYWIEIFDLKTIGTTTVN 231
|
Length = 233 |
| >gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|176669 cd07245, Glo_EDI_BRP_like_9, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176706 cd08358, Glo_EDI_BRP_like_21, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211356 cd08346, PcpA_N_like, N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >gnl|CDD|222305 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|176676 cd07253, Glo_EDI_BRP_like_2, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176677 cd07254, Glo_EDI_BRP_like_20, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 170 | |||
| PLN02367 | 233 | lactoylglutathione lyase | 100.0 | |
| PLN03042 | 185 | Lactoylglutathione lyase; Provisional | 99.97 | |
| KOG2944 | 170 | consensus Glyoxalase [Carbohydrate transport and m | 99.94 | |
| TIGR00068 | 150 | glyox_I lactoylglutathione lyase. Glyoxylase I is | 99.9 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 99.89 | |
| cd07233 | 121 | Glyoxalase_I Glyoxalase I catalyzes the isomerizat | 99.88 | |
| cd08358 | 127 | Glo_EDI_BRP_like_21 This conserved domain belongs | 99.88 | |
| PRK10291 | 129 | glyoxalase I; Provisional | 99.87 | |
| PRK11478 | 129 | putative lyase; Provisional | 99.87 | |
| TIGR03645 | 162 | glyox_marine lactoylglutathione lyase family prote | 99.87 | |
| cd07241 | 125 | Glo_EDI_BRP_like_3 This conserved domain belongs t | 99.87 | |
| cd08342 | 136 | HPPD_N_like N-terminal domain of 4-hydroxyphenylpy | 99.86 | |
| cd08352 | 125 | Glo_EDI_BRP_like_1 This conserved domain belongs t | 99.86 | |
| TIGR03081 | 128 | metmalonyl_epim methylmalonyl-CoA epimerase. Membe | 99.84 | |
| cd07243 | 143 | 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg | 99.83 | |
| PLN02300 | 286 | lactoylglutathione lyase | 99.83 | |
| cd07257 | 153 | THT_oxygenase_C The C-terminal domain of 2,4,5-Tri | 99.82 | |
| cd07263 | 119 | Glo_EDI_BRP_like_16 This conserved domain belongs | 99.81 | |
| cd07247 | 114 | SgaA_N_like N-terminal domain of Streptomyces gris | 99.8 | |
| cd08351 | 123 | ChaP_like ChaP, an enzyme involved in the biosynth | 99.8 | |
| cd09011 | 120 | Glo_EDI_BRP_like_23 This conserved domain belongs | 99.8 | |
| cd07237 | 154 | BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro | 99.8 | |
| cd07245 | 114 | Glo_EDI_BRP_like_9 This conserved domain belongs t | 99.8 | |
| cd08346 | 126 | PcpA_N_like N-terminal domain of Sphingobium chlor | 99.8 | |
| PRK04101 | 139 | fosfomycin resistance protein FosB; Provisional | 99.79 | |
| cd07265 | 122 | 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg | 99.79 | |
| cd07256 | 161 | HPCD_C_class_II C-terminal domain of 3,4-dihydroxy | 99.79 | |
| cd08364 | 131 | FosX FosX, a fosfomycin resistance protein, cataly | 99.79 | |
| cd08347 | 157 | PcpA_C_like C-terminal domain of Sphingobium chlor | 99.79 | |
| cd08355 | 122 | Glo_EDI_BRP_like_14 This conserved domain belongs | 99.79 | |
| cd07264 | 125 | Glo_EDI_BRP_like_15 This conserved domain belongs | 99.78 | |
| cd07255 | 125 | Glo_EDI_BRP_like_12 This conserved domain belongs | 99.78 | |
| cd08360 | 134 | MhqB_like_C C-terminal domain of Burkholderia sp. | 99.78 | |
| cd08363 | 131 | FosB FosB, a fosfomycin resistance protein, cataly | 99.78 | |
| cd07249 | 128 | MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als | 99.78 | |
| PRK06724 | 128 | hypothetical protein; Provisional | 99.78 | |
| cd08343 | 131 | ED_TypeI_classII_C C-terminal domain of type I, cl | 99.78 | |
| cd07253 | 125 | Glo_EDI_BRP_like_2 This conserved domain belongs t | 99.78 | |
| cd09013 | 121 | BphC-JF8_N_like N-terminal, non-catalytic, domain | 99.77 | |
| cd09014 | 166 | BphC-JF8_C_like C-terminal, catalytic, domain of B | 99.77 | |
| cd07242 | 128 | Glo_EDI_BRP_like_6 This conserved domain belongs t | 99.77 | |
| cd08359 | 119 | Glo_EDI_BRP_like_22 This conserved domain belongs | 99.77 | |
| cd07252 | 120 | BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro | 99.77 | |
| cd07238 | 112 | Glo_EDI_BRP_like_5 This conserved domain belongs t | 99.76 | |
| cd07239 | 144 | BphC5-RK37_C_like C-terminal, catalytic, domain of | 99.76 | |
| cd07246 | 122 | Glo_EDI_BRP_like_8 This conserved domain belongs t | 99.76 | |
| cd08348 | 134 | BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro | 99.76 | |
| PF00903 | 128 | Glyoxalase: Glyoxalase/Bleomycin resistance protei | 99.76 | |
| cd08354 | 122 | Glo_EDI_BRP_like_13 This conserved domain belongs | 99.75 | |
| cd07240 | 117 | ED_TypeI_classII_N N-terminal domain of type I, cl | 99.75 | |
| cd09012 | 124 | Glo_EDI_BRP_like_24 This conserved domain belongs | 99.75 | |
| cd08361 | 124 | PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma | 99.75 | |
| cd07244 | 121 | FosA FosA, a Fosfomycin resistance protein, cataly | 99.75 | |
| cd07267 | 113 | THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr | 99.74 | |
| PLN02300 | 286 | lactoylglutathione lyase | 99.74 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.73 | |
| cd08362 | 120 | BphC5-RrK37_N_like N-terminal, non-catalytic, doma | 99.73 | |
| cd08345 | 113 | Fosfomycin_RP Fosfomycin resistant protein; inhibi | 99.73 | |
| PF12681 | 108 | Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B | 99.73 | |
| cd07235 | 122 | MRD Mitomycin C resistance protein (MRD). Mitomyci | 99.72 | |
| cd08349 | 112 | BLMA_like Bleomycin binding protein (BLMA) and sim | 99.72 | |
| cd07266 | 121 | HPCD_N_class_II N-terminal domain of 3,4-dihydroxy | 99.72 | |
| cd07261 | 114 | Glo_EDI_BRP_like_11 This conserved domain belongs | 99.72 | |
| cd07262 | 123 | Glo_EDI_BRP_like_19 This conserved domain belongs | 99.71 | |
| cd07258 | 141 | PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma | 99.71 | |
| cd08350 | 120 | BLMT_like BLMT, a bleomycin resistance protein enc | 99.71 | |
| cd08344 | 112 | MhqB_like_N N-terminal domain of MhqB, a type I ex | 99.71 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 99.7 | |
| cd08357 | 125 | Glo_EDI_BRP_like_18 This conserved domain belongs | 99.7 | |
| cd07254 | 120 | Glo_EDI_BRP_like_20 This conserved domain belongs | 99.7 | |
| cd06587 | 112 | Glo_EDI_BRP_like This domain superfamily is found | 99.69 | |
| cd08356 | 113 | Glo_EDI_BRP_like_17 This conserved domain belongs | 99.66 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.65 | |
| cd07251 | 121 | Glo_EDI_BRP_like_10 This conserved domain belongs | 99.65 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.65 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 99.64 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 99.63 | |
| COG3324 | 127 | Predicted enzyme related to lactoylglutathione lya | 99.6 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.6 | |
| cd07250 | 191 | HPPD_C_like C-terminal domain of 4-hydroxyphenylpy | 99.53 | |
| KOG2943 | 299 | consensus Predicted glyoxalase [Carbohydrate trans | 99.53 | |
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 99.5 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 99.33 | |
| COG0346 | 138 | GloA Lactoylglutathione lyase and related lyases [ | 99.31 | |
| COG3565 | 138 | Predicted dioxygenase of extradiol dioxygenase fam | 99.28 | |
| COG2764 | 136 | PhnB Uncharacterized protein conserved in bacteria | 99.25 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 99.24 | |
| cd06588 | 128 | PhnB_like Escherichia coli PhnB and similar protei | 99.24 | |
| COG3607 | 133 | Predicted lactoylglutathione lyase [General functi | 99.24 | |
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 99.23 | |
| KOG2943 | 299 | consensus Predicted glyoxalase [Carbohydrate trans | 99.21 | |
| PRK01037 | 357 | trmD tRNA (guanine-N(1)-)-methyltransferase/unknow | 98.9 | |
| PF13468 | 175 | Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. | 98.64 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 98.58 | |
| PRK10148 | 147 | hypothetical protein; Provisional | 98.48 | |
| PF14506 | 125 | CppA_N: CppA N-terminal; PDB: 3E0R_D. | 98.46 | |
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 98.34 | |
| KOG0638 | 381 | consensus 4-hydroxyphenylpyruvate dioxygenase [Ami | 98.32 | |
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 98.24 | |
| PF14696 | 139 | Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H | 98.09 | |
| PF06983 | 116 | 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans | 97.23 | |
| KOG0638 | 381 | consensus 4-hydroxyphenylpyruvate dioxygenase [Ami | 97.23 | |
| PF15067 | 236 | FAM124: FAM124 family | 96.71 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 96.49 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 96.47 | |
| PF14507 | 101 | CppA_C: CppA C-terminal; PDB: 3E0R_D. | 96.2 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 95.02 | |
| KOG2944 | 170 | consensus Glyoxalase [Carbohydrate transport and m | 94.47 | |
| cd08352 | 125 | Glo_EDI_BRP_like_1 This conserved domain belongs t | 93.57 | |
| TIGR03645 | 162 | glyox_marine lactoylglutathione lyase family prote | 93.41 | |
| cd08346 | 126 | PcpA_N_like N-terminal domain of Sphingobium chlor | 92.91 | |
| PLN02367 | 233 | lactoylglutathione lyase | 92.54 | |
| cd07242 | 128 | Glo_EDI_BRP_like_6 This conserved domain belongs t | 92.02 | |
| cd08342 | 136 | HPPD_N_like N-terminal domain of 4-hydroxyphenylpy | 91.4 | |
| cd07249 | 128 | MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als | 91.2 | |
| PRK11478 | 129 | putative lyase; Provisional | 91.18 | |
| cd07245 | 114 | Glo_EDI_BRP_like_9 This conserved domain belongs t | 90.96 | |
| PF13670 | 83 | PepSY_2: Peptidase propeptide and YPEB domain This | 90.57 | |
| PF06185 | 185 | YecM: YecM protein; InterPro: IPR010393 This famil | 90.56 | |
| PF13468 | 175 | Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. | 90.0 | |
| cd06587 | 112 | Glo_EDI_BRP_like This domain superfamily is found | 89.93 | |
| cd08347 | 157 | PcpA_C_like C-terminal domain of Sphingobium chlor | 89.82 | |
| PRK10291 | 129 | glyoxalase I; Provisional | 89.69 | |
| cd07263 | 119 | Glo_EDI_BRP_like_16 This conserved domain belongs | 89.57 | |
| PLN03042 | 185 | Lactoylglutathione lyase; Provisional | 89.4 | |
| cd07241 | 125 | Glo_EDI_BRP_like_3 This conserved domain belongs t | 89.16 | |
| cd07233 | 121 | Glyoxalase_I Glyoxalase I catalyzes the isomerizat | 88.71 | |
| cd07237 | 154 | BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro | 87.97 | |
| PF12681 | 108 | Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B | 87.83 | |
| cd07235 | 122 | MRD Mitomycin C resistance protein (MRD). Mitomyci | 87.73 | |
| TIGR03081 | 128 | metmalonyl_epim methylmalonyl-CoA epimerase. Membe | 87.08 | |
| cd07250 | 191 | HPPD_C_like C-terminal domain of 4-hydroxyphenylpy | 85.68 | |
| PF00903 | 128 | Glyoxalase: Glyoxalase/Bleomycin resistance protei | 85.36 | |
| cd07268 | 149 | Glo_EDI_BRP_like_4 This conserved domain belongs t | 85.28 | |
| cd07255 | 125 | Glo_EDI_BRP_like_12 This conserved domain belongs | 85.0 | |
| cd08348 | 134 | BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro | 84.91 | |
| cd07253 | 125 | Glo_EDI_BRP_like_2 This conserved domain belongs t | 83.45 | |
| cd08360 | 134 | MhqB_like_C C-terminal domain of Burkholderia sp. | 83.43 | |
| cd08344 | 112 | MhqB_like_N N-terminal domain of MhqB, a type I ex | 83.27 | |
| PRK11700 | 187 | hypothetical protein; Provisional | 82.97 | |
| cd08359 | 119 | Glo_EDI_BRP_like_22 This conserved domain belongs | 82.53 | |
| TIGR00068 | 150 | glyox_I lactoylglutathione lyase. Glyoxylase I is | 81.93 | |
| PF02208 | 47 | Sorb: Sorbin homologous domain; InterPro: IPR00312 | 81.81 | |
| cd07252 | 120 | BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro | 80.49 | |
| cd08364 | 131 | FosX FosX, a fosfomycin resistance protein, cataly | 80.07 |
| >PLN02367 lactoylglutathione lyase | Back alignment and domain information |
|---|
Probab=100.00 E-value=5e-31 Score=193.48 Aligned_cols=166 Identities=81% Similarity=1.353 Sum_probs=136.5
Q ss_pred CCCCCCCceeeeEEEEEeCChHHHHHHHHHhcCCEEeEeeecCCcceEEEeeeccCCCCCCCCcccceeeecCCCcEEEE
Q 030857 4 PTDTSCNKRFPHFTMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIEL 83 (170)
Q Consensus 4 ~~~~~~~~~~l~hv~i~v~d~~~s~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lel 83 (170)
++++.|.++.++|++|.|+|+++|++||+++|||++..+..+++.++.++|++.++....+.+...+.+|...++..|||
T Consensus 66 ~~~~~t~~~~~~HtmlRVkDle~Sl~FYt~vLGm~ll~r~d~pe~~f~lyFL~~~~~~~~p~d~~~r~~~~~~~~~~LEL 145 (233)
T PLN02367 66 SPDEATKGYIMQQTMYRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTASAPTDPTERTVWTFGQKATIEL 145 (233)
T ss_pred CCCCCCCCcEEEEEEEEeCCHHHHHHHHHHhcCCEEeEEEecCCCcEEEEEeecCCccccccccccceeeccCCCCEEEE
Confidence 57889999999999999999999999999999999999988888889999998654332233333466787777789999
Q ss_pred EeccCCCCCCCCCCCCCCCCCCCCceEEEEEeCCHHHHHHHHHhcCCeEeecCCCCccceEEEEECCCCCEEEEEecCcc
Q 030857 84 THNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTI 163 (170)
Q Consensus 84 ~~~~~~~~~~~~~~~~~~~~~~~g~~hl~f~v~di~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~DPdG~~iel~~~~~~ 163 (170)
+++++.+..+....+..++..+.|++||||.|+|+++++++|++.|+++...|..+.+.+.+|++|||||+|||+|...+
T Consensus 146 t~n~g~e~~~~~~~y~~gn~~p~G~~HIaf~VdDVdaa~erL~a~Gv~~v~~P~~g~~~riaFIkDPDGn~IEL~e~~~~ 225 (233)
T PLN02367 146 THNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFEELGVEFVKKPNDGKMKGIAFIKDPDGYWIEIFDLKTI 225 (233)
T ss_pred ecCCCCCccccchhcccCCCCCCCceEEEEEcCCHHHHHHHHHHCCCEEEeCCccCCceEEEEEECCCCCEEEEEecccc
Confidence 98877654343334666666667999999999999999999999999999888776666688999999999999998876
Q ss_pred cccCCC
Q 030857 164 GKIGGS 169 (170)
Q Consensus 164 ~~~~~~ 169 (170)
....++
T Consensus 226 ~~~~~~ 231 (233)
T PLN02367 226 GTTTVN 231 (233)
T ss_pred cccccc
Confidence 655443
|
|
| >PLN03042 Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00068 glyox_I lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PRK10291 glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >PRK11478 putative lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR03645 glyox_marine lactoylglutathione lyase family protein | Back alignment and domain information |
|---|
| >cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway | Back alignment and domain information |
|---|
| >cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains | Back alignment and domain information |
|---|
| >cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins | Back alignment and domain information |
|---|
| >cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >PRK04101 fosfomycin resistance protein FosB; Provisional | Back alignment and domain information |
|---|
| >cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 | Back alignment and domain information |
|---|
| >cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08360 MhqB_like_C C-terminal domain of Burkholderia sp | Back alignment and domain information |
|---|
| >cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin | Back alignment and domain information |
|---|
| >cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >PRK06724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain | Back alignment and domain information |
|---|
| >cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins | Back alignment and domain information |
|---|
| >cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 | Back alignment and domain information |
|---|
| >PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein | Back alignment and domain information |
|---|
| >cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain | Back alignment and domain information |
|---|
| >cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive | Back alignment and domain information |
|---|
| >cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase | Back alignment and domain information |
|---|
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins | Back alignment and domain information |
|---|
| >cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin | Back alignment and domain information |
|---|
| >PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A | Back alignment and domain information |
|---|
| >cd07235 MRD Mitomycin C resistance protein (MRD) | Back alignment and domain information |
|---|
| >cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm | Back alignment and domain information |
|---|
| >cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins | Back alignment and domain information |
|---|
| >cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] | Back alignment and domain information |
|---|
| >COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E | Back alignment and domain information |
|---|
| >COG3607 Predicted lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK10148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A | Back alignment and domain information |
|---|
| >PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A | Back alignment and domain information |
|---|
| >KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF15067 FAM124: FAM124 family | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03645 glyox_marine lactoylglutathione lyase family protein | Back alignment and domain information |
|---|
| >cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >PLN02367 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >PRK11478 putative lyase; Provisional | Back alignment and domain information |
|---|
| >cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF13670 PepSY_2: Peptidase propeptide and YPEB domain This Prosite motif covers only the active site | Back alignment and domain information |
|---|
| >PF06185 YecM: YecM protein; InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function | Back alignment and domain information |
|---|
| >PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B | Back alignment and domain information |
|---|
| >cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >PRK10291 glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PLN03042 Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A | Back alignment and domain information |
|---|
| >cd07235 MRD Mitomycin C resistance protein (MRD) | Back alignment and domain information |
|---|
| >TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein | Back alignment and domain information |
|---|
| >cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08360 MhqB_like_C C-terminal domain of Burkholderia sp | Back alignment and domain information |
|---|
| >cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins | Back alignment and domain information |
|---|
| >PRK11700 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR00068 glyox_I lactoylglutathione lyase | Back alignment and domain information |
|---|
| >PF02208 Sorb: Sorbin homologous domain; InterPro: IPR003127 Sorbin is an active peptide present in the digestive tract, where it has pro-absorptive and anti-secretory effects in different parts of the intestine, including the ability to decrease VIP (vasoactive intestinal peptide) and cholera toxin-induced secretion | Back alignment and domain information |
|---|
| >cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 170 | ||||
| 2za0_A | 184 | Crystal Structure Of Mouse Glyoxalase I Complexed W | 2e-57 | ||
| 1fro_A | 183 | Human Glyoxalase I With Benzyl-Glutathione Inhibito | 1e-53 | ||
| 3vw9_A | 187 | Human Glyoxalase I With An N-Hydroxypyridone Inhibi | 1e-53 | ||
| 1bh5_A | 183 | Human Glyoxalase I Q33e, E172q Double Mutant Length | 2e-53 | ||
| 1f9z_A | 135 | Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I | 2e-19 | ||
| 2c21_A | 144 | Specificity Of The Trypanothione-Dependednt Leishma | 4e-13 |
| >pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 | Back alignment and structure |
|
| >pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 | Back alignment and structure |
| >pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 | Back alignment and structure |
| >pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 | Back alignment and structure |
| >pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 | Back alignment and structure |
| >pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 170 | |||
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 4e-65 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 9e-53 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 4e-50 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 2e-37 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 5e-26 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 1e-23 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 2e-23 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 1e-21 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 8e-20 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 2e-18 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 2e-16 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 1e-15 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 5e-15 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 1e-11 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 2e-11 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 2e-11 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 2e-11 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 2e-11 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 4e-10 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 7e-10 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 8e-10 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 2e-09 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 5e-09 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 1e-08 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 1e-08 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 1e-08 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 2e-08 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 2e-08 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 3e-08 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 6e-08 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 1e-07 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 2e-07 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 2e-07 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 3e-07 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 7e-07 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 7e-07 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 9e-07 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 1e-06 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 2e-06 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 2e-06 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 2e-06 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 3e-06 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 3e-06 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 7e-06 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 1e-05 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 3e-05 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 7e-05 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 9e-05 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 1e-04 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 8e-04 |
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 | Back alignment and structure |
|---|
Score = 196 bits (499), Expect = 4e-65
Identities = 102/163 (62%), Positives = 121/163 (74%), Gaps = 2/163 (1%)
Query: 4 PTDTSCNKRFPHFTMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASA 63
P ++ + TM RIKDPK SLDFY+RVLG++LL++LDFP MKFSLYFL YED
Sbjct: 23 PDPSTKDFLLQQ-TMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDI 81
Query: 64 PADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACE 123
P D ++T WTF + AT+ELTHNWGTE D YHNGNS+PRGFGHIGI V DVY AC+
Sbjct: 82 PKDKSEKTAWTFSRKATLELTHNWGTEDDETQS-YHNGNSDPRGFGHIGIAVPDVYSACK 140
Query: 124 RFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIGKI 166
RFE LGV+F KKPD GK+KG+AFI+DPD YWIEI + I I
Sbjct: 141 RFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIATI 183
|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Length = 252 | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 170 | |||
| 3vw9_A | 187 | Lactoylglutathione lyase; glyoxalase, lyase-lyase | 99.95 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 99.92 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.92 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 99.9 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 99.9 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 99.9 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 99.89 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 99.89 | |
| 4hc5_A | 133 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.88 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 99.88 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 99.87 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 99.87 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 99.86 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 99.86 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 99.86 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.86 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 99.86 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 99.85 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 99.85 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 99.85 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 99.84 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 99.84 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 99.83 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 99.83 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 99.83 | |
| 1xrk_A | 124 | Bleomycin resistance protein; arm exchange, ligand | 99.82 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 99.82 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 99.82 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 99.82 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 99.82 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 99.82 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 99.81 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 99.81 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 99.81 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 99.81 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 99.81 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 99.81 | |
| 4gym_A | 149 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.81 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 99.81 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.81 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 99.81 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 99.8 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 99.8 | |
| 1ecs_A | 126 | Bleomycin resistance protein; arm-exchange, antibi | 99.79 | |
| 1qto_A | 122 | Bleomycin-binding protein; arm-exchange, antibioti | 99.79 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 99.79 | |
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 99.79 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 99.78 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 99.78 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.77 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 99.77 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 99.76 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 99.75 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 99.74 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.74 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.73 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 99.73 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 99.72 | |
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 99.72 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.71 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 99.71 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 99.71 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.71 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 99.7 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 99.7 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.7 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.69 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.69 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.69 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 99.69 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.68 | |
| 1xy7_A | 166 | Unknown protein; structural genomics, protein stru | 99.67 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.67 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.66 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.66 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.66 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.66 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 99.66 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.66 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 99.65 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.64 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.64 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.6 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.6 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.6 | |
| 1u6l_A | 149 | Hypothetical protein; structural genomics, PSI, pr | 99.58 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.58 | |
| 1u7i_A | 136 | Hypothetical protein; structural genomics, PA1358, | 99.55 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.53 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.52 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 99.5 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.48 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.47 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.42 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.42 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.42 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.37 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 99.36 | |
| 3l20_A | 172 | Putative uncharacterized protein; hypothetical pro | 99.34 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 99.33 | |
| 1tsj_A | 139 | Conserved hypothetical protein; structural genomic | 99.32 | |
| 3oms_A | 138 | PHNB protein; structural genomics, PSI-2, protein | 99.32 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.21 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 99.16 | |
| 1u69_A | 163 | Hypothetical protein; structural genomics, MSCG, p | 98.45 | |
| 3opy_B | 941 | 6-phosphofructo-1-kinase beta-subunit; ATP binding | 98.12 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 97.99 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 96.68 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 96.48 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 94.9 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 94.73 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 94.28 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 93.66 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 93.63 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 93.13 | |
| 3opy_A | 989 | 6-phosphofructo-1-kinase alpha-subunit; ATP bindin | 93.11 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 92.84 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 92.82 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 92.72 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 92.25 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 91.67 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 91.45 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 90.39 | |
| 4hc5_A | 133 | Glyoxalase/bleomycin resistance protein/dioxygena; | 89.97 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 89.47 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 89.33 | |
| 1k4n_A | 192 | Protein EC4020, protein YECM; structural genomics, | 89.18 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 88.92 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 87.71 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 87.69 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 87.48 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 87.27 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 87.16 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 87.09 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 87.02 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 86.55 | |
| 3vw9_A | 187 | Lactoylglutathione lyase; glyoxalase, lyase-lyase | 86.04 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 85.79 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 85.47 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 84.99 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 84.44 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 84.33 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 84.23 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 83.63 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 83.49 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 83.25 | |
| 3iuz_A | 340 | Putative glyoxalase superfamily protein; struct ge | 83.13 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 80.77 |
| >3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* | Back alignment and structure |
|---|
Probab=99.95 E-value=4e-27 Score=168.60 Aligned_cols=164 Identities=58% Similarity=1.079 Sum_probs=122.5
Q ss_pred CCCCCCCCceeeeEEEEEeCChHHHHHHHHHhcCCEEeEeeecCCcceEEEeeeccCCCCCCCCcccceeeecCCCcEEE
Q 030857 3 LPTDTSCNKRFPHFTMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIE 82 (170)
Q Consensus 3 ~~~~~~~~~~~l~hv~i~v~d~~~s~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~le 82 (170)
..+++.+..++++|++|.|+|++++++||+++|||++..+...++..+.+++++.++....+.......+|...+...++
T Consensus 24 ~~~~~~~~~~~l~Hv~l~v~D~~~a~~FY~~~LG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~ 103 (187)
T 3vw9_A 24 SDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE 103 (187)
T ss_dssp CCCCGGGTTCEEEEEEEECSCHHHHHHHHHHTTCCEEEEEEEETTTTEEEEEEESCCGGGSCSSHHHHHHHHTTCSSEEE
T ss_pred cCCCCccceeEEEEEEEEeCCHHHHHHHHHHhcCcEEeeccccCCCceeEEEecCCCcccccccccchhhhcccCCceEE
Confidence 45667778899999999999999999999999999999887766667888888765432111122223344444457899
Q ss_pred EEeccCCCCCCCCCCCCCCCCCCCCceEEEEEeCCHHHHHHHHHhcCCeEeecCCCCccceEEEEECCCCCEEEEEecCc
Q 030857 83 LTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKT 162 (170)
Q Consensus 83 l~~~~~~~~~~~~~~~~~~~~~~~g~~hl~f~v~di~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~DPdG~~iel~~~~~ 162 (170)
|+.......... .++..++..+.++.|++|.|+|+++++++|+++|+++...+..+.+++.+||+|||||.|||++...
T Consensus 104 l~~~~~~~~~~~-~~~~~g~~~~~g~~hl~f~v~dv~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~DPdG~~iel~~~~~ 182 (187)
T 3vw9_A 104 LTHNWGTEDDET-QSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNK 182 (187)
T ss_dssp EEEETTGGGCTT-CCCCCSSSSSCBEEEEEEECSCHHHHHHHHHHTTCCEEECTTSSSSTTCEEEECTTCCEEEEECGGG
T ss_pred EEEecCCCCCCc-cccccCCCCCCceeEEEEEECCHHHHHHHHHHCCCeEeeCCccCCcceEEEEECCCCCEEEEEEccc
Confidence 876544322111 1133344445688999999999999999999999999988876666667899999999999999987
Q ss_pred ccccC
Q 030857 163 IGKIG 167 (170)
Q Consensus 163 ~~~~~ 167 (170)
.+.++
T Consensus 183 ~~~~~ 187 (187)
T 3vw9_A 183 MATLM 187 (187)
T ss_dssp SGGGC
T ss_pred cccCC
Confidence 77654
|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} | Back alignment and structure |
|---|
| >4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A | Back alignment and structure |
|---|
| >1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* | Back alignment and structure |
|---|
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} | Back alignment and structure |
|---|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* | Back alignment and structure |
|---|
| >4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A | Back alignment and structure |
|---|
| >1k4n_A Protein EC4020, protein YECM; structural genomics, A NEW fold of protein, PSI, protein structure initiative; 1.60A {Escherichia coli} SCOP: d.32.1.5 | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3iuz_A Putative glyoxalase superfamily protein; struct genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: MLY P6G PGE; 1.90A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 170 | ||||
| d1qipa_ | 176 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 4e-34 | |
| d1sqda1 | 167 | d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg | 5e-15 | |
| d1f9za_ | 135 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 1e-14 | |
| d2c21a1 | 139 | d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion | 3e-13 | |
| d1twua_ | 137 | d.32.1.8 (A:) Hypothetical protein YycE {Bacillus | 1e-12 | |
| d1ss4a_ | 149 | d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillu | 1e-10 | |
| d1sp8a1 | 172 | d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg | 4e-10 | |
| d1jc4a_ | 145 | d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion | 6e-10 | |
| d1t47a1 | 163 | d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg | 2e-08 | |
| d1zswa1 | 144 | d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B | 7e-07 | |
| d1r9ca_ | 130 | d.32.1.2 (A:) Fosfomycin resistance protein FosX { | 2e-06 | |
| d2i7ra1 | 115 | d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str | 2e-05 | |
| d1cjxa1 | 150 | d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxyge | 2e-05 | |
| d1nkia_ | 134 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 3e-05 | |
| d1npba_ | 140 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 1e-04 | |
| d1mpya2 | 162 | d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met | 1e-04 | |
| d1cjxa2 | 203 | d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxy | 1e-04 | |
| d2pjsa1 | 111 | d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 | 0.002 | |
| d1mpya1 | 145 | d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metap | 0.002 |
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: Glyoxalase I (lactoylglutathione lyase) domain: Glyoxalase I (lactoylglutathione lyase) species: Human (Homo sapiens) [TaxId: 9606]
Score = 116 bits (290), Expect = 4e-34
Identities = 93/166 (56%), Positives = 116/166 (69%), Gaps = 2/166 (1%)
Query: 1 MKLPTDTSCNKRFPHFTMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDT 60
++ + TM R+KDPK SLDFY+RVLGM+L+++ DFP MKFSLYFL YED
Sbjct: 12 CSDADPSTKDFLLQQ-TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK 70
Query: 61 ASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYK 120
P + ++ W + AT+ELTHNWGTE D YHNGNS+PRGFGHIGI V DVY
Sbjct: 71 NDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQS-YHNGNSDPRGFGHIGIAVPDVYS 129
Query: 121 ACERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIGKI 166
AC+RFE LGV+F KKPD GK+KG+AFI+DPD YWIEI + + +
Sbjct: 130 ACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATL 175
|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 | Back information, alignment and structure |
|---|
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 | Back information, alignment and structure |
|---|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Length = 149 | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 | Back information, alignment and structure |
|---|
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 150 | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 203 | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 145 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 170 | |||
| d1qipa_ | 176 | Glyoxalase I (lactoylglutathione lyase) {Human (Ho | 99.95 | |
| d1ss4a_ | 149 | Hypothetical protein BC1747 {Bacillus cereus (stra | 99.9 | |
| d1f9za_ | 135 | Glyoxalase I (lactoylglutathione lyase) {Escherich | 99.89 | |
| d1jc4a_ | 145 | Methylmalonyl-CoA epimerase {Propionibacterium she | 99.88 | |
| d2i7ra1 | 115 | Hypotheical protein SP0731 {Streptococcus pneumoni | 99.87 | |
| d1twua_ | 137 | Hypothetical protein YycE {Bacillus subtilis [TaxI | 99.86 | |
| d1zswa1 | 144 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.85 | |
| d1mpya2 | 162 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.85 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 99.84 | |
| d1zswa2 | 170 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.84 | |
| d1r9ca_ | 130 | Fosfomycin resistance protein FosX {Mesorhizobium | 99.83 | |
| d2c21a1 | 139 | Glyoxalase I (lactoylglutathione lyase) {Leishmani | 99.82 | |
| d1npba_ | 140 | Fosfomycin resistance protein A (FosA) {Serratia m | 99.8 | |
| d1lgta1 | 131 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.8 | |
| d1f1ua1 | 146 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.8 | |
| d2pjsa1 | 111 | Uncharacterized protein Atu1953 {Agrobacterium tum | 99.79 | |
| d1klla_ | 128 | Mitomycin resistance protein D, MRD {Streptomyces | 99.79 | |
| d1nkia_ | 134 | Fosfomycin resistance protein A (FosA) {Pseudomona | 99.79 | |
| d1kw3b1 | 132 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.78 | |
| d1sqia1 | 149 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 99.78 | |
| d1t47a1 | 163 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 99.77 | |
| d1mpya1 | 145 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.77 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 99.77 | |
| d1f1ua2 | 176 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.76 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 99.74 | |
| d1kw3b2 | 156 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.73 | |
| d1ecsa_ | 120 | Bleomycin resistance protein, BRP {Klebsiella pneu | 99.71 | |
| d1jifa_ | 122 | Bleomycin resistance protein, BRP {Streptomyces ve | 99.67 | |
| d1xrka_ | 120 | Bleomycin resistance protein, BRP {Streptoalloteic | 99.65 | |
| d1xy7a_ | 135 | Hypothetical protein At5g48480 {Thale cress (Arabi | 99.62 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.52 | |
| d1sp8a2 | 224 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 99.43 | |
| d1cjxa2 | 203 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.35 | |
| d1t47a2 | 199 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 99.33 | |
| d1sqia2 | 210 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 99.31 | |
| d1u6la_ | 137 | Hypothetical protein PA1353 {Pseudomonas aeruginos | 99.25 | |
| d1sqda2 | 230 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 99.23 | |
| d1u7ia_ | 134 | Hypothetical protein PA1358 {Pseudomonas aeruginos | 98.9 | |
| d1tsja_ | 129 | Hypothetical protein MW1090 {Staphylococcus aureus | 98.46 | |
| d1u69a_ | 156 | Hypothetical protein PA2721 {Pseudomonas aeruginos | 97.19 | |
| d1ss4a_ | 149 | Hypothetical protein BC1747 {Bacillus cereus (stra | 96.06 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 95.69 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 93.37 | |
| d1t47a1 | 163 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 92.71 | |
| d1sqia1 | 149 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 92.3 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 91.73 | |
| d1k4na_ | 190 | Hypothetical protein YecM (EC4020) {Escherichia co | 90.51 | |
| d1lgta1 | 131 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 89.76 | |
| d1jc4a_ | 145 | Methylmalonyl-CoA epimerase {Propionibacterium she | 89.2 | |
| d1zswa1 | 144 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 87.05 | |
| d1qipa_ | 176 | Glyoxalase I (lactoylglutathione lyase) {Human (Ho | 86.87 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 86.51 | |
| d1f1ua2 | 176 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 83.89 | |
| d1r9ca_ | 130 | Fosfomycin resistance protein FosX {Mesorhizobium | 83.47 | |
| d1kw3b1 | 132 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 82.73 | |
| d1kw3b2 | 156 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 82.63 | |
| d1npba_ | 140 | Fosfomycin resistance protein A (FosA) {Serratia m | 81.64 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 80.68 | |
| d1zswa2 | 170 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 80.49 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 80.01 |
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: Glyoxalase I (lactoylglutathione lyase) domain: Glyoxalase I (lactoylglutathione lyase) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=1e-26 Score=163.60 Aligned_cols=162 Identities=59% Similarity=1.090 Sum_probs=112.1
Q ss_pred CCCCCCceeeeEEEEEeCChHHHHHHHHHhcCCEEeEeeecCCcceEEEeeeccCCCCCCCCcccceeeecCCCcEEEEE
Q 030857 5 TDTSCNKRFPHFTMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELT 84 (170)
Q Consensus 5 ~~~~~~~~~l~hv~i~v~d~~~s~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lel~ 84 (170)
|++.+..++++|++|.|+|+++|++||+++|||++......+...+...+...+..............+.........+.
T Consensus 15 ~~~~~~~~~l~Hi~l~V~Dl~~si~FY~~vLG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 94 (176)
T d1qipa_ 15 ADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELT 94 (176)
T ss_dssp CCGGGTTCEEEEEEEECSCHHHHHHHHHHTTCCEEEEEEEETTTTEEEEEEESCCGGGSCSSHHHHHHHHTTSSSEEEEE
T ss_pred CCCCccceEEeEEEEEeCCHHHHHHHHHHhhCCeEeeeecccCCceEEEEeecCCccccccccccccccccccccceeEE
Confidence 56677889999999999999999999999999999988777777777777665433211111111111112222333332
Q ss_pred eccCCCCCCCCCCCCCCCCCCCCceEEEEEeCCHHHHHHHHHhcCCeEeecCCCCccceEEEEECCCCCEEEEEecCccc
Q 030857 85 HNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIG 164 (170)
Q Consensus 85 ~~~~~~~~~~~~~~~~~~~~~~g~~hl~f~v~di~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~DPdG~~iel~~~~~~~ 164 (170)
........... ..........++.|+||.++|+++++++|+++|+++...|..+...+++||+|||||.|||+|+.+..
T Consensus 95 ~~~~~~~~~~~-~~~~~~~~~~g~~h~~~~~~d~~~~~~~l~~~Gv~~~~~p~~g~~~~~~f~~DPdG~~IElvq~~~~~ 173 (176)
T d1qipa_ 95 HNWGTEDDETQ-SYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMA 173 (176)
T ss_dssp EETTGGGCTTC-CCBCSSSSSCBEEEEEEECSCHHHHHHHHHHTTCEEEECTTSSSSTTCEEEECTTCCEEEEECTTTGG
T ss_pred EeeccccccCc-CccCCCCCccceeEEEeeHHHHHHHHHHHHHCCCEEeeCCccCCceEEEEEECCCCCEEEEEeCCCCC
Confidence 22221111100 01122223458899999999999999999999999999987766666789999999999999999877
Q ss_pred ccC
Q 030857 165 KIG 167 (170)
Q Consensus 165 ~~~ 167 (170)
+++
T Consensus 174 ~~~ 176 (176)
T d1qipa_ 174 TLM 176 (176)
T ss_dssp GCC
T ss_pred ccC
Confidence 664
|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} | Back information, alignment and structure |
|---|
| >d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|