Citrus Sinensis ID: 030908

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MQTLQEKASEWSGVDPADAFAIDETNLFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLVAGDELKNHNHQPRCKDETSKPAAE
cccHHHHcccccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHcccccccccccccccccccc
cccHHHHHHHHcccccccccccccccHHHHHcHHHHHHHHHHHHHHHHccccHcHcccccccccHHHHHHHHHHHHHHccccccHHHccccccHccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc
MQTLQekasewsgvdpadafaideTNLFRKLGLQTFINLSTNfytrvyddeEEWFRSIFANSNKEEAIQNQYEFFVQrmggpplysqrkghpaligrhrpfpvtHQAAERWLHHMQIAldstpeidadSKIKMMNFFRHTAFFLVAGdelknhnhqprckdetskpaae
mqtlqekasewsgvdpaDAFAIDETNLFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLVAGDelknhnhqprckdetskpaae
MQTLQEKASEWSGVDPADAFAIDETNLFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLVAGDELKNHNHQPRCKDETSKPAAE
***************PADAFAIDETNLFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLVAGD*********************
**************************LFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLV************************
************GVDPADAFAIDETNLFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLVAGDELKNH****************
************************TNLFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLVAG**********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTLQEKASEWSGVDPADAFAIDETNLFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLVAGDELKNHNHQPRCKDETSKPAAE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
O31607132 Group 2 truncated hemoglo yes no 0.532 0.681 0.376 1e-11
P0A595128 Group 2 truncated hemoglo yes no 0.662 0.875 0.293 4e-08
P0A596128 Group 2 truncated hemoglo yes no 0.662 0.875 0.293 4e-08
Q9CC59128 Group 2 truncated hemoglo yes no 0.662 0.875 0.301 6e-08
>sp|O31607|TRHBO_BACSU Group 2 truncated hemoglobin YjbI OS=Bacillus subtilis (strain 168) GN=yjbI PE=1 SV=1 Back     alignment and function desciption
 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 3/93 (3%)

Query: 28  FRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQ 87
           +  +G +    L   FY RV        + IF  S+  E  + Q +F  Q +GGPPLY++
Sbjct: 9   YEAIGEELLSQLVDTFYERVAS--HPLLKPIFP-SDLTETARKQKQFLTQYLGGPPLYTE 65

Query: 88  RKGHPALIGRHRPFPVTHQAAERWLHHMQIALD 120
             GHP L  RH PFP+T++ A+ WL  M+ A+D
Sbjct: 66  EHGHPMLRARHLPFPITNERADAWLSCMKDAMD 98
Hemoglobin-like protein that exhibits a low peroxidase activity. Its very high oxygen affinity may rule out the possibility that it is involved in oxygen transport.
Bacillus subtilis (strain 168) (taxid: 224308)
>sp|P0A595|TRHBO_MYCTU Group 2 truncated hemoglobin GlbO OS=Mycobacterium tuberculosis GN=glbO PE=1 SV=1 Back     alignment and function description
>sp|P0A596|TRHBO_MYCBO Group 2 truncated hemoglobin GlbO OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glbO PE=3 SV=1 Back     alignment and function description
>sp|Q9CC59|TRHBO_MYCLE Group 2 truncated hemoglobin GlbO OS=Mycobacterium leprae (strain TN) GN=glbO PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
233955417169 truncated hemoglobin [Carica papaya] 1.0 1.0 0.857 7e-82
225430075169 PREDICTED: group 2 truncated hemoglobin 0.994 0.994 0.875 3e-81
124028605165 truncated hemoglobin [Populus tremula x 0.976 1.0 0.872 4e-81
31559437169 2-on-2 hemoglobin [Datisca glomerata] 0.946 0.946 0.856 2e-78
388506100169 unknown [Medicago truncatula] 0.976 0.976 0.837 1e-77
297802742175 hypothetical protein ARALYDRAFT_491439 [ 1.0 0.965 0.805 1e-77
449499310169 PREDICTED: group 2 truncated hemoglobin 0.994 0.994 0.809 2e-77
449442028169 PREDICTED: group 2 truncated hemoglobin 0.994 0.994 0.803 4e-77
18418064175 hemoglobin 3 [Arabidopsis thaliana] gi|5 1.0 0.965 0.8 5e-77
14165163175 2-on-2 hemoglobin [Arabidopsis thaliana] 1.0 0.965 0.8 7e-77
>gi|233955417|gb|ACQ91204.1| truncated hemoglobin [Carica papaya] Back     alignment and taxonomy information
 Score =  307 bits (787), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 145/169 (85%), Positives = 154/169 (91%)

Query: 1   MQTLQEKASEWSGVDPADAFAIDETNLFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFA 60
           MQ+LQ KASEWSGVD ADAFAID+TNLF+KLGL  FINLSTNFY RVYDDEE+WFR IF+
Sbjct: 1   MQSLQHKASEWSGVDTADAFAIDDTNLFQKLGLDAFINLSTNFYNRVYDDEEDWFRLIFS 60

Query: 61  NSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALD 120
           NS KE+AIQNQYEFFVQRMGGPPLYSQRKGHPALI RHRPFPVTHQAAERWLHHMQ ALD
Sbjct: 61  NSKKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIARHRPFPVTHQAAERWLHHMQDALD 120

Query: 121 STPEIDADSKIKMMNFFRHTAFFLVAGDELKNHNHQPRCKDETSKPAAE 169
           +TP+ID+DSKIKMMNFFRHTAFFLVAGDELKN N Q  CK  TSKPAAE
Sbjct: 121 NTPDIDSDSKIKMMNFFRHTAFFLVAGDELKNPNQQVACKHATSKPAAE 169

Source: Carica papaya

Species: Carica papaya

Genus: Carica

Family: Caricaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225430075|ref|XP_002284484.1| PREDICTED: group 2 truncated hemoglobin yjbI [Vitis vinifera] gi|296081919|emb|CBI20924.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|124028605|gb|ABM89110.1| truncated hemoglobin [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|31559437|emb|CAD33536.1| 2-on-2 hemoglobin [Datisca glomerata] Back     alignment and taxonomy information
>gi|388506100|gb|AFK41116.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297802742|ref|XP_002869255.1| hypothetical protein ARALYDRAFT_491439 [Arabidopsis lyrata subsp. lyrata] gi|297315091|gb|EFH45514.1| hypothetical protein ARALYDRAFT_491439 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449499310|ref|XP_004160782.1| PREDICTED: group 2 truncated hemoglobin YjbI-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449442028|ref|XP_004138784.1| PREDICTED: group 2 truncated hemoglobin YjbI-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18418064|ref|NP_567901.1| hemoglobin 3 [Arabidopsis thaliana] gi|51968614|dbj|BAD42999.1| 2-on-2 hemoglobin (GLB3) [Arabidopsis thaliana] gi|51971915|dbj|BAD44622.1| 2-on-2 hemoglobin (GLB3) [Arabidopsis thaliana] gi|62318701|dbj|BAD95217.1| 2-on-2 hemoglobin (GLB3) [Arabidopsis thaliana] gi|89001033|gb|ABD59106.1| At4g32690 [Arabidopsis thaliana] gi|110738756|dbj|BAF01302.1| 2-on-2 hemoglobin [Arabidopsis thaliana] gi|332660704|gb|AEE86104.1| hemoglobin 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|14165163|gb|AAK55409.1|AF376062_1 2-on-2 hemoglobin [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
TAIR|locus:2125662175 GLB3 "hemoglobin 3" [Arabidops 1.0 0.965 0.8 4.1e-72
TIGR_CMR|BA_1209132 BA_1209 "protozoan/cyanobacter 0.544 0.696 0.364 2e-10
UNIPROTKB|Q8EKQ1145 SO_0039 "Globin" [Shewanella o 0.568 0.662 0.336 2.5e-10
TIGR_CMR|SO_0039145 SO_0039 "conserved hypothetica 0.568 0.662 0.336 2.5e-10
UNIPROTKB|P0A595128 glbO "Group 2 truncated hemogl 0.662 0.875 0.293 1.1e-09
UNIPROTKB|Q606Y3131 MCA1878 "Putative uncharacteri 0.686 0.885 0.275 1.3e-06
TIGR_CMR|SPO_1563150 SPO_1563 "protozoan/cyanobacte 0.485 0.546 0.333 0.00018
TAIR|locus:2125662 GLB3 "hemoglobin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 729 (261.7 bits), Expect = 4.1e-72, P = 4.1e-72
 Identities = 140/175 (80%), Positives = 153/175 (87%)

Query:     1 MQTLQEKASEWSGVDPADAFAIDETNLFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFA 60
             MQ+LQ+KAS  SGVD A+AFAIDE+NLF KLGLQTFINLSTNFYTRVYDDEEEWF+SIF+
Sbjct:     1 MQSLQDKASVLSGVDQAEAFAIDESNLFDKLGLQTFINLSTNFYTRVYDDEEEWFQSIFS 60

Query:    61 NSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALD 120
             NSNKE+AIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWL HMQ ALD
Sbjct:    61 NSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALD 120

Query:   121 STPEIDADSKIKMMNFFRHTAFFLVAGDELKNHNHQPR------CKDETSKPAAE 169
              + +ID DSKIKMM FFRHTAFFLVAG+ELKN N +P+      CK   +KPA E
Sbjct:   121 DSVDIDQDSKIKMMKFFRHTAFFLVAGNELKNQNEKPKHKPQCACKHAANKPAEE 175
GO:0005506 "iron ion binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0015671 "oxygen transport" evidence=IEA;IDA
GO:0019825 "oxygen binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0001666 "response to hypoxia" evidence=IEP
GO:0005344 "oxygen transporter activity" evidence=IDA
GO:0009733 "response to auxin stimulus" evidence=TAS
TIGR_CMR|BA_1209 BA_1209 "protozoan/cyanobacterial globin family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EKQ1 SO_0039 "Globin" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0039 SO_0039 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|P0A595 glbO "Group 2 truncated hemoglobin GlbO" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q606Y3 MCA1878 "Putative uncharacterized protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1563 SPO_1563 "protozoan/cyanobacterial globin family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032518001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (169 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00030498001
SubName- Full=Putative uncharacterized protein (Chromosome chr1 scaffold_5, whole genome shotgu [...] (173 aa)
•     • 0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
pfam01152120 pfam01152, Bac_globin, Bacterial-like globin 1e-44
cd00454116 cd00454, Trunc_globin, Truncated hemoglobins (trHb 1e-27
COG2346133 COG2346, COG2346, Truncated hemoglobins [General f 2e-15
>gnl|CDD|216333 pfam01152, Bac_globin, Bacterial-like globin Back     alignment and domain information 
 Score =  142 bits (360), Expect = 1e-44
 Identities = 48/122 (39%), Positives = 62/122 (50%), Gaps = 5/122 (4%)

Query: 26  NLFRKLGLQ-TFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPL 84
            L+ KLG +     L   FY RV  D E      F+ ++ E     QYEF  Q +GGPP 
Sbjct: 1   TLYEKLGGEAAVRALVDRFYKRVDADPE--VARAFSGTDMEGQRNKQYEFLAQALGGPPH 58

Query: 85  YSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDST--PEIDADSKIKMMNFFRHTAF 142
           YS R+GHP L  RH PFP+T+   + WL H+  AL  T    I  +  +K+M F  HTA 
Sbjct: 59  YSGRRGHPRLRERHAPFPITNAEFDAWLRHLADALADTGVHAILREEILKVMEFLAHTAL 118

Query: 143 FL 144
             
Sbjct: 119 NK 120

This family of heme binding proteins are found mainly in bacteria. However they can also be found in some protozoa and plants as well. Length = 120
>gnl|CDD|238256 cd00454, Trunc_globin, Truncated hemoglobins (trHbs) are a family of oxygen-binding heme proteins found in cyanobacteria, eubacteria, unicellular eukaryotes, and plants Back     alignment and domain information
>gnl|CDD|225223 COG2346, COG2346, Truncated hemoglobins [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
PF01152120 Bac_globin: Bacterial-like globin; InterPro: IPR00 100.0
COG2346133 Truncated hemoglobins [General function prediction 100.0
cd00454116 Trunc_globin Truncated hemoglobins (trHbs) are a f 100.0
cd01067117 globin_like superfamily containing globins and tru 99.27
cd01068147 sensor_globin Globin domain present in Globin-Coup 98.56
PF11563158 Protoglobin: Protoglobin; PDB: 2VEE_G 3QZZ_A 3R0G_ 97.71
cd01040140 globin Globins are heme proteins, which bind and t 97.33
COG1017150 Hmp Hemoglobin-like flavoprotein [Energy productio 96.95
PRK13289 399 bifunctional nitric oxide dioxygenase/dihydropteri 96.8
PF00042110 Globin: Globin plant globin signature erythrocruor 91.06
KOG3378 385 consensus Globins and related hemoproteins [Energy 83.94
>PF01152 Bac_globin: Bacterial-like globin; InterPro: IPR001486 Globins are haem-containing proteins involved in binding and/or transporting oxygen Back     alignment and domain information 
Probab=100.00  E-value=2.4e-36  Score=223.52  Aligned_cols=119  Identities=29%  Similarity=0.525  Sum_probs=113.0

Q ss_pred             cHHHHcC-HHHHHHHHHHHHHHHhcChhhhhhcccCCCCHHHHHHHHHHHHHHHhCCCCccCCCCCCCcccCCCCCCCCC
Q 030908           26 NLFRKLG-LQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVT  104 (169)
Q Consensus        26 sLYe~iG-~~~I~~LV~~FY~rv~~D~~~~l~~~F~~~d~~~~~~~l~~Fl~~~lGGP~~Y~g~~G~p~m~~~H~~l~It  104 (169)
                      |||++|| +++|++||+.||+||.+||.  |+++|.+.|++.++.++++|||+++|||+.|+++.|+|.|+.+|++++||
T Consensus         1 slye~lGG~~~I~~lv~~fY~rv~~d~~--l~~~F~~~d~~~~~~~~~~fl~~~~GGp~~Y~~~~G~p~m~~~H~~l~it   78 (120)
T PF01152_consen    1 SLYERLGGEEGIRALVDAFYDRVLADPR--LKPFFEGIDLEKHKEKQAEFLSQLLGGPPLYTGRDGHPMMREAHAHLGIT   78 (120)
T ss_dssp             CHHHHCTHHHHHHHHHHHHHHHHHT-TT--TGGGGTTSCHHHHHHHHHHHHHHHTTSSSHHHHHHSSH-HHHHHTTS-BB
T ss_pred             CHHHHhcCHHHHHHHHHHHHHHHHcCHH--HHhhcCCCCHHHHHHHHHHHHHHHhCCCCCCcccCCCchHHHHHhCCCCC
Confidence            7999999 99999999999999999999  99999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHHHHHHHHHcc
Q 030908          105 HQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLVAG  147 (169)
Q Consensus       105 ~~~fd~Wl~~~~~aLd~~~~~~~~~~~~l~~~~~~~a~~iv~~  147 (169)
                      ++||++|++||.+||+++ +++++.++++++.++.++..|+|.
T Consensus        79 ~~~f~~~~~~~~~al~~~-~v~~~~~~~~~~~~~~~~~~i~n~  120 (120)
T PF01152_consen   79 EEHFDRWLELLKQALDEL-GVPEELIDELLARLESLRDDIVNK  120 (120)
T ss_dssp             HHHHHHHHHHHHHHHHHT-TCTHHHHHHHHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHHHHHHHh-CCCHHHHHHHHHHHHHHHHHhcCC
Confidence            999999999999999999 699999999999999999999984

They belong to a very large and well studied family that is widely distributed in many organisms []. Globins have evolved from a common ancestor and can be divided into three groups: single-domain globins, and two types of chimeric globins, flavohaemoglobins and globin-coupled sensors. Bacteria have all three types of globins, while archaea lack flavohaemoglobins, and eukaryotes lack globin-coupled sensors []. Several functionally different haemoglobins can coexist in the same species. The major types of globins include: Haemoglobin (Hb): trimer of two alpha and two beta chains, although embryonic and foetal forms can substitute the alpha or beta chain for ones with higher oxygen affinity, such as gamma, delta, epsilon or zeta chains. Hb transports oxygen from lungs to other tissues in vertebrates []. Hb proteins are also present in unicellular organisms where they act as enzymes or sensors []. Myoglobin (Mb): monomeric protein responsible for oxygen storage in vertebrate muscle []. Neuroglobin: a myoglobin-like haemprotein expressed in vertebrate brain and retina, where it is involved in neuroprotection from damage due to hypoxia or ischemia []. Neuroglobin belongs to a branch of the globin family that diverged early in evolution. Cytoglobin: an oxygen sensor expressed in multiple tissues. Related to neuroglobin []. Erythrocruorin: highly cooperative extracellular respiratory proteins found in annelids and arthropods that are assembled from as many as 180 subunit into hexagonal bilayers []. Leghaemoglobin (legHb or symbiotic Hb): occurs in the root nodules of leguminous plants, where it facilitates the diffusion of oxygen to symbiotic bacteriods in order to promote nitrogen fixation. Non-symbiotic haemoglobin (NsHb): occurs in non-leguminous plants, and can be over-expressed in stressed plants []. Flavohaemoglobins (FHb): chimeric, with an N-terminal globin domain and a C-terminal ferredoxin reductase-like NAD/FAD-binding domain. FHb provides protection against nitric oxide via its C-terminal domain, which transfers electrons to haem in the globin []. Globin-coupled sensors: chimeric, with an N-terminal myoglobin-like domain and a C-terminal domain that resembles the cytoplasmic signalling domain of bacterial chemoreceptors. They bind oxygen, and act to initiate an aerotactic response or regulate gene expression [, ]. Protoglobin: a single domain globin found in archaea that is related to the N-terminal domain of globin-coupled sensors []. Truncated 2/2 globin: lack the first helix, giving them a 2-over-2 instead of the canonical 3-over-3 alpha-helical sandwich fold. Can be divided into three main groups (I, II and II) based on structural features []. This entry represents a group of haemoglobin-like proteins found in eubacteria, cyanobacteria, protozoa, algae and plants, but not in animals or yeast. These proteins have a truncated 2-over-2 rather than the canonical 3-over-3 alpha-helical sandwich fold []. This entry includes: HbN (or GlbN): a truncated haemoglobin-like protein that binds oxygen cooperatively with a very high affinity and a slow dissociation rate, which may exclude it from oxygen transport. It appears to be involved in bacterial nitric oxide detoxification and in nitrosative stress []. Cyanoglobin (or GlbN): a truncated haemoprotein found in cyanobacteria that has high oxygen affinity, and which appears to serve as part of a terminal oxidase, rather than as a respiratory pigment []. HbO (or GlbO): a truncated haemoglobin-like protein with a lower oxygen affinity than HbN. HbO associates with the bacterial cell membrane, where it significantly increases oxygen uptake over membranes lacking this protein. HbO appears to interact with a terminal oxidase, and could participate in an oxygen/electron-transfer process that facilitates oxygen transfer during aerobic metabolism []. Glb3: a nuclear-encoded truncated haemoglobin from plants that appears more closely related to HbO than HbN. Glb3 from Arabidopsis thaliana (Mouse-ear cress) exhibits an unusual concentration-independent binding of oxygen and carbon dioxide []. ; GO: 0019825 oxygen binding, 0015671 oxygen transport; PDB: 2BKM_B 1UVY_A 1DLW_A 2XYK_B 2IG3_A 2GKM_B 1S61_A 1S56_B 1RTE_B 2GLN_A ....
>COG2346 Truncated hemoglobins [General function prediction only] Back     alignment and domain information
>cd00454 Trunc_globin Truncated hemoglobins (trHbs) are a family of oxygen-binding heme proteins found in cyanobacteria, eubacteria, unicellular eukaryotes, and plants Back     alignment and domain information
>cd01067 globin_like superfamily containing globins and truncated hemoglobins Back     alignment and domain information
>cd01068 sensor_globin Globin domain present in Globin-Coupled-Sensors (GCS) Back     alignment and domain information
>PF11563 Protoglobin: Protoglobin; PDB: 2VEE_G 3QZZ_A 3R0G_A 3QZX_A 2VEB_A 1OR6_A 1OR4_B 2W31_B Back     alignment and domain information
>cd01040 globin Globins are heme proteins, which bind and transport oxygen Back     alignment and domain information
>COG1017 Hmp Hemoglobin-like flavoprotein [Energy production and conversion] Back     alignment and domain information
>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional Back     alignment and domain information
>PF00042 Globin: Globin plant globin signature erythrocruorin family signature alpha hemoglobin signature myoglobin signature thalassemia Back     alignment and domain information
>KOG3378 consensus Globins and related hemoproteins [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
1ux8_A132 X-Ray Structure Of Truncated Oxygen-Avid Haemoglobi 1e-12
2bkm_A128 Crystal Structure Of The Truncated Hemoglobin From 2e-10
2bmm_A123 X-Ray Structure Of A Novel Thermostable Hemoglobin 7e-10
1ngk_A128 Crystallographic Structure Of Mycobacterium Tubercu 4e-09
2qrw_A128 Crystal Stucture Of Mycobacterium Tuberculosis Trhb 6e-08
2xyk_A133 Group Ii 2-On-2 Hemoglobin From The Plant Pathogen 8e-05
>pdb|1UX8|A Chain A, X-Ray Structure Of Truncated Oxygen-Avid Haemoglobin From Bacillus Subtilis Length = 132 Back     alignment and structure 
Iteration: 1

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 3/93 (3%)
Query: 28  FRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQ 87
           +  +G +    L   FY RV        + IF  S+  E  + Q +F  Q +GGPPLY++
Sbjct: 9   YEAIGEELLSQLVDTFYERVAS--HPLLKPIFP-SDLTETARKQKQFLTQYLGGPPLYTE 65
Query: 88  RKGHPALIGRHRPFPVTHQAAERWLHHMQIALD 120
             GHP L  RH PFP+T++ A+ WL  M+ A+D
Sbjct: 66  EHGHPMLRARHLPFPITNERADAWLSCMKDAMD 98
>pdb|2BKM|A Chain A, Crystal Structure Of The Truncated Hemoglobin From Geobacillus Stearothermophilus Length = 128 Back     alignment and structure
>pdb|2BMM|A Chain A, X-Ray Structure Of A Novel Thermostable Hemoglobin From The Actinobacterium Thermobifida Fusca Length = 123 Back     alignment and structure
>pdb|1NGK|A Chain A, Crystallographic Structure Of Mycobacterium Tuberculosis Hemoglobin O Length = 128 Back     alignment and structure
>pdb|2QRW|A Chain A, Crystal Stucture Of Mycobacterium Tuberculosis Trhbo Wg8f Mutant Length = 128 Back     alignment and structure
>pdb|2XYK|A Chain A, Group Ii 2-On-2 Hemoglobin From The Plant Pathogen Agrobacterium Tumefaciens Length = 133 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
2qrw_A128 Hemoglobin-like protein HBO; truncated hemoglobin 9e-29
2xyk_A133 2-ON-2 hemoglobin; oxygen storage-transport comple 3e-26
2bmm_A123 Thermostable hemoglobin from thermobifida fusca; b 1e-25
1ux8_A132 YJBI protein; oxygen storage/transport, truncated 2e-23
2bkm_A128 Truncated hemoglobin from geobacillus stearothermo 9e-22
3aq9_A121 Group 1 truncated hemoglobin; 2/2 fold hemoglobin, 1e-21
2gkm_A136 TRHBN, hemoglobin-like protein HBN, flavohemoglobi 3e-21
1dlw_A116 Hemoglobin; oxygen storage/transport complex; HET: 2e-20
1dly_A164 Hemoglobin; oxygen storage/transport complex; HET: 3e-19
1s69_A124 Cyanoglobin, hemoglobin, HB; on 2 helical fold, he 3e-19
2ksc_A123 Cyanoglobin; hemeprotein, 2/2 hemoglobin, GLBN, TR 2e-18
2ig3_A127 Group III truncated haemoglobin; truncated hemoglo 1e-06
>2qrw_A Hemoglobin-like protein HBO; truncated hemoglobin fold, alpha helix, heme, hydroxylation, iron, membrane, metal-binding; HET: HEM; 1.93A {Mycobacterium tuberculosis} PDB: 1ngk_A* Length = 128 Back     alignment and structure
 Score =  102 bits (255), Expect = 9e-29
 Identities = 33/124 (26%), Positives = 62/124 (50%), Gaps = 5/124 (4%)

Query: 25  TNLFRKLG-LQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPP 83
            + +  +G  +TF  + + FY +V +DE    R ++   +   A +    F  Q  GGP 
Sbjct: 3   KSFYDAVGGAKTFDAIVSRFYAQVAEDEV--LRRVYPEDDLAGAEERLRMFLEQYWGGPR 60

Query: 84  LYSQRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDS--TPEIDADSKIKMMNFFRHTA 141
            YS+++GHP L  RH PF ++    + +L  M  A+ S  +  +D + + +++++    A
Sbjct: 61  TYSEQRGHPRLRMRHAPFRISLIERDAFLRCMHTAVASIDSETLDDEHRRELLDYLEMAA 120

Query: 142 FFLV 145
             LV
Sbjct: 121 HSLV 124
>2xyk_A 2-ON-2 hemoglobin; oxygen storage-transport complex; HET: HEM; 2.10A {Agrobacterium tumefaciens} Length = 133 Back     alignment and structure
>2bmm_A Thermostable hemoglobin from thermobifida fusca; bacterial hemoglobin, thermostable protein, oxygen storage/transport; HET: HEM; 2.48A {Thermobifida fusca} Length = 123 Back     alignment and structure
>1ux8_A YJBI protein; oxygen storage/transport, truncated hemoglobin, oxygen transport; HET: HEM; 2.15A {Bacillus subtilis} SCOP: a.1.1.1 Length = 132 Back     alignment and structure
>2bkm_A Truncated hemoglobin from geobacillus stearothermophilus; hypothetical protein, oxygen transport, transport, oxygen storage; HET: HEM; 1.5A {Geobacillus stearothermophilus} Length = 128 Back     alignment and structure
>3aq9_A Group 1 truncated hemoglobin; 2/2 fold hemoglobin, nitric oxide detoxification, oxygen BIN; HET: HEM; 1.74A {Tetrahymena pyriformis} PDB: 3aq5_A* 3aq6_A* 3aq8_A* 3aq7_A* Length = 121 Back     alignment and structure
>2gkm_A TRHBN, hemoglobin-like protein HBN, flavohemoglobin; truncated hemoglobin, mutant, oxygen storage/transport complex; HET: HEM; 1.73A {Mycobacterium tuberculosis} PDB: 1idr_A* 1rte_A* 1s56_A* 1s61_A* 2gl3_A* 2gln_A* 2gkn_A* Length = 136 Back     alignment and structure
>1dlw_A Hemoglobin; oxygen storage/transport complex; HET: HEM; 1.54A {Paramecium caudatum} SCOP: a.1.1.1 PDB: 1uvy_A* Length = 116 Back     alignment and structure
>1dly_A Hemoglobin; oxygen storage/transport complex; HET: HEM; 1.80A {Chlamydomonas eugametos} SCOP: a.1.1.1 PDB: 1uvx_A* Length = 164 Back     alignment and structure
>1s69_A Cyanoglobin, hemoglobin, HB; on 2 helical fold, heme, iron, cyanoba oxygen binding, hexacoordinate, truncated, oxygen storage-T complex; HET: FLC HEM; 1.68A {Synechocystis SP} SCOP: a.1.1.1 PDB: 1s6a_A* 1mwb_A* 1rtx_A* 2hz1_A* 2hz3_A* 2hz2_A* Length = 124 Back     alignment and structure
>2ksc_A Cyanoglobin; hemeprotein, 2/2 hemoglobin, GLBN, TRHBN, unknown function; HET: HEB; NMR {Synechococcus SP} Length = 123 Back     alignment and structure
>2ig3_A Group III truncated haemoglobin; truncated hemoglobin, 2-ON-2 globin, oxygen storage-transpor; HET: HEM; 2.15A {Campylobacter jejuni} Length = 127 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
2xyk_A133 2-ON-2 hemoglobin; oxygen storage-transport comple 100.0
2bmm_A123 Thermostable hemoglobin from thermobifida fusca; b 100.0
2bkm_A128 Truncated hemoglobin from geobacillus stearothermo 100.0
2qrw_A128 Hemoglobin-like protein HBO; truncated hemoglobin 100.0
1ux8_A132 YJBI protein; oxygen storage/transport, truncated 100.0
3aq9_A121 Group 1 truncated hemoglobin; 2/2 fold hemoglobin, 100.0
1dlw_A116 Hemoglobin; oxygen storage/transport complex; HET: 100.0
2gkm_A136 TRHBN, hemoglobin-like protein HBN, flavohemoglobi 100.0
2ksc_A123 Cyanoglobin; hemeprotein, 2/2 hemoglobin, GLBN, TR 100.0
1dly_A164 Hemoglobin; oxygen storage/transport complex; HET: 100.0
1s69_A124 Cyanoglobin, hemoglobin, HB; on 2 helical fold, he 99.97
2ig3_A127 Group III truncated haemoglobin; truncated hemoglo 99.97
1tu9_A134 Hypothetical protein PA3967; structural genomics, 99.07
2wy4_A140 Single domain haemoglobin; heme, transport, oxygen 98.83
2w31_A162 Globin; oxygen transport, hexacoordination; HET: H 98.8
1or4_A178 Heme-based aerotactic transducer hemat; globin fol 98.74
1bin_A143 Leghemoglobin A; heme, nitrogen fixation, multigen 98.63
2vhb_A146 Hemoglobin; heme, respiratory protein, oxygen tran 98.53
2w72_C141 Human hemoglobin A; iron, heme, glycation, transpo 98.48
1jf3_A147 Monomer hemoglobin component III; oxygen storage/t 98.45
3ubc_A131 Hemoglobin-like flavoprotein; oxygen-bound, autoxi 98.16
2oif_A162 Horvu GLB1, non-legume hemoglobin; hexacoordinate 98.1
1gdj_A153 Leghemoglobin (deoxy); oxygen transport; HET: HEM; 98.1
1gvh_A 396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 98.09
1hlm_A159 Hemoglobin (cyano Met); oxygen transport; HET: HEM 98.05
1cqx_A 403 Flavohemoprotein; globin fold, six-stranded antipa 97.95
2xki_A110 Neural hemoglobin; oxygen storage, metal-binding; 97.84
1h97_A147 Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitu 97.76
3pt8_B152 Hemoglobin III; oxygen carrier, oxygen transport; 97.64
2r80_A141 Hemoglobin subunit alpha-A; oxygen tranport/storag 97.61
1mba_A147 Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysi 97.54
4b4y_A154 Neuroglobin; transport protein, nervous system evo 97.45
1jeb_A142 Hemoglobin zeta chain; oxygen transport, oxygen st 97.41
1wmu_A141 Hemoglobin D alpha chain; hemoglobin D, reptilia, 97.41
3pt8_A152 Hemoglobin II; oxygen carrier, oxygen transport; H 97.4
2vyw_A148 Hemoglobin; trematode, oxygen binding; HET: HEM; 1 97.33
1x46_A150 Globin chain, hemoglobin component VII; diptera, m 97.3
1q1f_A151 Neuroglobin; globin fold, heme protein, oxygen sto 97.25
1cg5_A141 Protein (hemoglobin); oxygen transport; HET: HEM; 97.23
2wtg_A159 Globin-like protein; metal-binding, oxygen transpo 97.17
3bom_A143 Hemoglobin subunit alpha-4; FISH hemoglobin, struc 97.17
1ith_A141 Hemoglobin (cyano Met); oxygen transport; HET: HEM 97.16
2w72_B146 Human hemoglobin A; iron, heme, glycation, transpo 97.15
2c0k_A151 Hemoglobin; oxygen transport, heme, iron, metal-bi 97.12
3d1k_A142 Hemoglobin subunit alpha-1; antarctic FISH hemoglo 97.12
1b0b_A142 Hemoglobin; hemoprotein, sulfide carrier, globins, 97.08
2nrl_A147 Myoglobin; transport protein; HET: HEM; 0.91A {Thu 96.92
1xq5_A143 Hemoglobin alpha-1 chain; FISH hemoglobin, rapid o 96.91
1x9f_B145 Erythrocruorin, globin II, extracellular, globin A 96.91
2bk9_A153 CG9734-PA; oxygen transport, drosophila melanogast 96.86
2r80_B146 Hemoglobin subunit beta; oxygen tranport/storage, 96.83
1hlb_A158 Hemoglobin (deoxy); oxygen transport; HET: HEM; 2. 96.83
4g1v_A 399 Flavohemoglobin; three domains: globin fold, antip 96.83
2dc3_A193 Cytoglobin; myoglobin, heme, oxygen transport, oxy 96.82
1gcv_B136 Hemoglobin; oxygen storage/transport complex; HET: 96.79
1out_A143 Hemoglobin I; heme, oxygen transport, respiratory 96.78
1spg_A144 Hemoglobin; carbon monoxide, R-state, teleost FISH 96.76
1x9f_D140 Globin C, hemoglobin chain D1, globin III, extrace 96.72
1cg5_B141 Protein (hemoglobin); oxygen transport; HET: HEM; 96.71
3mkb_A140 Hemoglobin subunit alpha; oxygen affinity, shortfi 96.69
3g46_A146 Globin-1; oxygen transport, allostery, oxygen affi 96.68
1c7c_A 283 Protein (deoxyhemoglobin (alpha chain)); heme, oxy 96.68
1sct_B151 Hemoglobin II (carbonmonoxy) (beta chain); oxygen 96.68
1a6m_A151 Myoglobin; heme protein, model compounds, oxygen s 96.64
1c7c_A283 Protein (deoxyhemoglobin (alpha chain)); heme, oxy 96.55
1yhu_A145 Hemoglobin A1 chain; globin fold, oxygen storage-t 96.54
2zs0_C147 Extracellular giant hemoglobin major globin subun; 96.48
1sct_A150 Hemoglobin II (carbonmonoxy) (alpha chain); oxygen 96.47
4hrt_B152 Hemoglobin B chain; oxygen transport, globin fold, 96.34
1ash_A150 Hemoglobin (OXY); oxygen storage; HET: HEM; 2.15A 96.26
1yhu_D149 Hemoglobin B2 chain; globin fold, oxygen storage-t 96.24
3bom_B147 Hemoglobin subunit beta-4; FISH hemoglobin, struct 96.23
2veb_A195 Protoglobin; hemoprotein structure, protein matrix 96.21
2zs0_B142 Extracellular giant hemoglobin major globin subun; 96.12
1yhu_B144 Giant hemoglobins B chain; globin fold, oxygen sto 96.07
3d1k_B146 Hemoglobin subunit beta-1/2; antarctic FISH hemogl 96.06
1out_B146 Hemoglobin I; heme, oxygen transport, respiratory 96.04
1lhs_A153 Myoglobin; oxygen storage; HET: HEM; 2.00A {Carett 96.02
1v4x_B146 Hemoglobin beta chain; oxygen transport, heme, res 96.0
3mkb_B136 Hemoglobin subunit beta; oxygen affinity, shortfin 95.97
2aa1_B146 Hemoglobin beta-C chain; ROOT effect, cooperativit 95.93
1x9f_A151 Globin IV, extracellular; crystal, dodecamer, allo 95.81
1yhu_C148 Hemoglobin B1A chain; globin fold, oxygen storage- 95.65
1x9f_C153 Erythrocruorin, globin III, extracellular, globin 95.55
2lhb_A149 Hemoglobin V (cyano Met); oxygen transport; HET: H 95.54
3lb2_A137 Dehaloperoxidase A; globin, oxidoreductase; HET: H 95.47
2zs0_A140 Extracellular giant hemoglobin major globin subun; 95.17
4hrt_A150 Globin-2 A chain; oxygen transport, globin fold, o 95.16
1eca_A136 Erythrocruorin (AQUO Met); oxygen transport; HET: 94.77
1x3k_A152 Hemoglobin component V; diptera, midge larva, oxyg 94.75
1it2_A146 Hemoglobin; hagfish, deoxy form, oxygen storage/tr 94.6
2zs0_D145 Extracellular giant hemoglobin major globin subun; 92.33
3mvc_A161 Globin protein 6; oxygen sensor, heme-binding prot 88.24
>2xyk_A 2-ON-2 hemoglobin; oxygen storage-transport complex; HET: HEM; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
Probab=100.00  E-value=8.7e-40  Score=246.48  Aligned_cols=123  Identities=24%  Similarity=0.443  Sum_probs=118.1

Q ss_pred             CcccHHHHcC-HHHHHHHHHHHHHHHhcCh---hhhhhcccCCCCHHHHHHHHHHHHHHHhCCCCccCCCCCCCcccCCC
Q 030908           23 DETNLFRKLG-LQTFINLSTNFYTRVYDDE---EEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRH   98 (169)
Q Consensus        23 ~~~sLYe~iG-~~~I~~LV~~FY~rv~~D~---~~~l~~~F~~~d~~~~~~~l~~Fl~~~lGGP~~Y~g~~G~p~m~~~H   98 (169)
                      ..+|+|++|| +++|++||+.||++|.+||   .  |+++|+ .||+.|++++++|||+++|||+.|++++|||+|+.+|
T Consensus         4 ~~~tlye~iGG~~~i~~lV~~FY~~v~~Dp~~~~--l~~~F~-~d~~~~~~~l~~Fl~~~lGGp~~Y~~~~g~p~m~~~H   80 (133)
T 2xyk_A            4 ETVTLYEAIGGDATVRALTRRFYELMDTLPEAAR--CRAIHP-ADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRH   80 (133)
T ss_dssp             SSBCHHHHHTHHHHHHHHHHHHHHHHHHCGGGHH--HHHHSC-SSTHHHHHHHHHHHHHHTTSCCHHHHHHCSCCHHHHH
T ss_pred             CCCCHHHHhcCHHHHHHHHHHHHHHHHhCccccH--HHHhcc-CCHHHHHHHHHHHHHHHcCcCcccccCCCCcCHHHhh
Confidence            3469999999 9999999999999999999   8  999999 7899999999999999999999999999999999999


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHHHHHHHHHccHh
Q 030908           99 RPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLVAGDE  149 (169)
Q Consensus        99 ~~l~It~~~fd~Wl~~~~~aLd~~~~~~~~~~~~l~~~~~~~a~~iv~~~~  149 (169)
                      .+++|+++||++||.||.+||+++ +++++.+++++++++++|.+|+|+++
T Consensus        81 ~~~~I~~~~fd~Wl~~~~~al~e~-~~~~~~~~~l~~~~~~~a~~m~n~~~  130 (133)
T 2xyk_A           81 FVAPIGPAERDEWLLCFRRAMDET-IENAKLREIIWAPVERLAFHMQNQEA  130 (133)
T ss_dssp             TTSCCCHHHHHHHHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHCCCC-
T ss_pred             cCCCcCHHHHHHHHHHHHHHHHHc-CCCHHHHHHHHHHHHHHHHHHhcCCc
Confidence            999999999999999999999999 69999999999999999999999954
>2bmm_A Thermostable hemoglobin from thermobifida fusca; bacterial hemoglobin, thermostable protein, oxygen storage/transport; HET: HEM; 2.48A {Thermobifida fusca} Back     alignment and structure
>2bkm_A Truncated hemoglobin from geobacillus stearothermophilus; hypothetical protein, oxygen transport, transport, oxygen storage; HET: HEM; 1.5A {Geobacillus stearothermophilus} Back     alignment and structure
>2qrw_A Hemoglobin-like protein HBO; truncated hemoglobin fold, alpha helix, heme, hydroxylation, iron, membrane, metal-binding; HET: HEM; 1.93A {Mycobacterium tuberculosis} PDB: 1ngk_A* Back     alignment and structure
>1ux8_A YJBI protein; oxygen storage/transport, truncated hemoglobin, oxygen transport; HET: HEM; 2.15A {Bacillus subtilis} SCOP: a.1.1.1 Back     alignment and structure
>3aq9_A Group 1 truncated hemoglobin; 2/2 fold hemoglobin, nitric oxide detoxification, oxygen BIN; HET: HEM; 1.74A {Tetrahymena pyriformis} PDB: 3aq5_A* 3aq6_A* 3aq8_A* 3aq7_A* Back     alignment and structure
>1dlw_A Hemoglobin; oxygen storage/transport complex; HET: HEM; 1.54A {Paramecium caudatum} SCOP: a.1.1.1 PDB: 1uvy_A* Back     alignment and structure
>2gkm_A TRHBN, hemoglobin-like protein HBN, flavohemoglobin; truncated hemoglobin, mutant, oxygen storage/transport complex; HET: HEM; 1.73A {Mycobacterium tuberculosis} PDB: 1idr_A* 1rte_A* 1s56_A* 1s61_A* 2gl3_A* 2gln_A* 2gkn_A* Back     alignment and structure
>2ksc_A Cyanoglobin; hemeprotein, 2/2 hemoglobin, GLBN, TRHBN, unknown function; HET: HEB; NMR {Synechococcus SP} Back     alignment and structure
>1dly_A Hemoglobin; oxygen storage/transport complex; HET: HEM; 1.80A {Chlamydomonas eugametos} SCOP: a.1.1.1 PDB: 1uvx_A* Back     alignment and structure
>1s69_A Cyanoglobin, hemoglobin, HB; on 2 helical fold, heme, iron, cyanoba oxygen binding, hexacoordinate, truncated, oxygen storage-T complex; HET: FLC HEM; 1.68A {Synechocystis SP} SCOP: a.1.1.1 PDB: 1s6a_A* 1mwb_A* 1rtx_A* 2hz1_A* 2hz3_A* 2hz2_A* Back     alignment and structure
>2ig3_A Group III truncated haemoglobin; truncated hemoglobin, 2-ON-2 globin, oxygen storage-transpor; HET: HEM; 2.15A {Campylobacter jejuni} Back     alignment and structure
>1tu9_A Hypothetical protein PA3967; structural genomics, heme, hemoglobin, pseudomonas aeruginos PSI, protein structure initiative; HET: HEM; 1.20A {Pseudomonas aeruginosa} SCOP: a.1.1.2 Back     alignment and structure
>2wy4_A Single domain haemoglobin; heme, transport, oxygen transport; HET: HEM; 1.35A {Campylobacter jejuni} Back     alignment and structure
>2w31_A Globin; oxygen transport, hexacoordination; HET: HEM; 1.50A {Geobacter sulfurreducens} Back     alignment and structure
>1or4_A Heme-based aerotactic transducer hemat; globin fold, signaling protein; HET: HEM; 2.15A {Bacillus subtilis} SCOP: a.1.1.2 PDB: 1or6_A* Back     alignment and structure
>1bin_A Leghemoglobin A; heme, nitrogen fixation, multigene family, oxygen transport; HET: HEM; 2.20A {Glycine max} SCOP: a.1.1.2 PDB: 1fsl_A* Back     alignment and structure
>2vhb_A Hemoglobin; heme, respiratory protein, oxygen transport; HET: HEM; 1.76A {Vitreoscilla stercoraria} SCOP: a.1.1.2 PDB: 1vhb_A* 3vhb_A* 4vhb_A* Back     alignment and structure
>2w72_C Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7s_A* 1qi8_A* 1j7y_A* 1o1i_A* 2w72_A* 1bzz_A* 1c7b_A* 1j7w_A* 1o1k_A* 1o1o_A* 1y0c_A* 1ydz_A* 3ia3_B* 1ird_A* 1a00_A* 1a0u_A* 1a0z_A* 1a3n_A* 1a9w_A* 1b86_A* ... Back     alignment and structure
>1jf3_A Monomer hemoglobin component III; oxygen storage/transport complex; HET: HEM; 1.40A {Glycera dibranchiata} SCOP: a.1.1.2 PDB: 1jl7_A* 1jf4_A* 1jl6_A* 1vre_A* 1vrf_A* 1hbg_A* 2hbg_A* Back     alignment and structure
>3ubc_A Hemoglobin-like flavoprotein; oxygen-bound, autoxidation, nanotemplate, langmuir-blodgett, films, oxygen transport; HET: HEM; 1.65A {Methylacidiphilum infernorum V4} PDB: 3ubv_A* 3s1i_A* 3s1j_A* Back     alignment and structure
>2oif_A Horvu GLB1, non-legume hemoglobin; hexacoordinate hemoglobin, barley, ligand binding, non- symbiotic, symbiotic, evolution; HET: HEM; 1.80A {Hordeum vulgare} PDB: 2r50_A* 1d8u_A* 2gnv_A* 2gnw_A* 3qqq_A* 3qqr_A* Back     alignment and structure
>1gdj_A Leghemoglobin (deoxy); oxygen transport; HET: HEM; 1.70A {Lupinus luteus} SCOP: a.1.1.2 PDB: 1gdi_A* 1gdk_A* 1gdl_A* 1lh1_A* 1lh2_A* 1lh3_A* 1lh5_A* 1lh6_A* 1lh7_A* 2gdm_A* 2lh1_A* 2lh2_A* 2lh3_A* 2lh5_A* 2lh6_A* 2lh7_A* Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Back     alignment and structure
>1hlm_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.90A {Caudina arenicola} SCOP: a.1.1.2 Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Back     alignment and structure
>2xki_A Neural hemoglobin; oxygen storage, metal-binding; HET: HEM SO4; 1.30A {Cerebratulus lacteus} PDB: 1kr7_A* 1v07_A* 2xkg_A* 2xkh_A* 2vyz_A* 2vyy_A* Back     alignment and structure
>1h97_A Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitum} SCOP: a.1.1.2 PDB: 1kfr_A* Back     alignment and structure
>3pt8_B Hemoglobin III; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} PDB: 3pt7_B* Back     alignment and structure
>2r80_A Hemoglobin subunit alpha-A; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3mju_A* 3dhr_A* 3mjp_A* 1faw_A* 3eok_A* 3k8b_A* 2qmb_A* 3fs4_A* 3a59_A* 1a4f_A* 1hv4_A* 2zfb_A* 1c40_A* 3at5_A* 3at6_A* Back     alignment and structure
>1mba_A Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysia limacina} SCOP: a.1.1.2 PDB: 2fal_A* 3mba_A* 4mba_A* 5mba_A* 2fam_A* 1dm1_A* Back     alignment and structure
>4b4y_A Neuroglobin; transport protein, nervous system evolution, globin evolutio cnidarian, metazoan; HET: HEM; 2.30A {Symsagittifera roscoffensis} Back     alignment and structure
>1jeb_A Hemoglobin zeta chain; oxygen transport, oxygen storage/transport complex; HET: HEM; 2.10A {Homo sapiens} SCOP: a.1.1.2 Back     alignment and structure
>1wmu_A Hemoglobin D alpha chain; hemoglobin D, reptilia, the aldabra giant tortoise, geochelone gigantea, oxygen storage/transport complex; HET: HEM; 1.65A {Dipsochelys dussumieri} SCOP: a.1.1.2 PDB: 1v75_A* 2z6n_A* 1hbr_A* Back     alignment and structure
>3pt8_A Hemoglobin II; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} SCOP: a.1.1.0 PDB: 3pi1_A* 2olp_A* 3pi3_A* 3pi4_A* 3pt7_A* 3pi2_A* Back     alignment and structure
>2vyw_A Hemoglobin; trematode, oxygen binding; HET: HEM; 1.8A {Fasciola hepatica} Back     alignment and structure
>1x46_A Globin chain, hemoglobin component VII; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.50A {Tokunagayusurika akamusi} Back     alignment and structure
>1q1f_A Neuroglobin; globin fold, heme protein, oxygen storage/transport complex; HET: HEM; 1.50A {Mus musculus} SCOP: a.1.1.2 PDB: 1w92_A* 3gk9_A* 2vry_A* 3gkt_A* 3gln_A* 1oj6_A* Back     alignment and structure
>1cg5_A Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_A* Back     alignment and structure
>2wtg_A Globin-like protein; metal-binding, oxygen transport; HET: HEM; 1.50A {Caenorhabditis elegans} PDB: 2wth_A* Back     alignment and structure
>3bom_A Hemoglobin subunit alpha-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_A* Back     alignment and structure
>1ith_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.50A {Urechis caupo} SCOP: a.1.1.2 Back     alignment and structure
>2w72_B Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7w_B* 1qi8_B* 1j7y_B* 1dxu_B* 1a0u_B* 1a0z_B* 1gli_B* 1j7s_B* 1o1l_B* 1o1n_B* 1y0t_B* 1y0w_B* 1o1o_B* 1ye2_B* 1y35_B* 1y22_B* 1ye0_B* 1dxt_B* 1y5f_B* 1ird_B* ... Back     alignment and structure
>2c0k_A Hemoglobin; oxygen transport, heme, iron, metal-binding; HET: HEM; 2.6A {Gasterophilus intestinalis} Back     alignment and structure
>3d1k_A Hemoglobin subunit alpha-1; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 2aa1_A* 1t1n_A* 1la6_A* 3nfe_A* 3ng6_A* 2h8f_A* 1pbx_A* 1s5x_A* 1s5y_A* 1hbh_A* 2h8d_A* 2peg_A* 3gkv_A* 3gqg_A* 1v4x_A* 1v4u_A* 1v4w_A* Back     alignment and structure
>1b0b_A Hemoglobin; hemoprotein, sulfide carrier, globins, oxygen transport, oxygen storage/transport complex; HET: HEM; 1.43A {Lucina pectinata} SCOP: a.1.1.2 PDB: 1ebt_A* 1flp_A* 1moh_A* Back     alignment and structure
>2nrl_A Myoglobin; transport protein; HET: HEM; 0.91A {Thunnus atlanticus} PDB: 2nx0_A* 3qm5_A* 3qm6_A* 3qm7_A* 3qm8_A* 3qm9_A* 3qma_A* 1myt_A* 2nrm_A* Back     alignment and structure
>1xq5_A Hemoglobin alpha-1 chain; FISH hemoglobin, rapid oxidation, structural genomics, protein structure initiative, PSI, CESG; HET: HEM; 1.90A {Perca flavescens} SCOP: a.1.1.2 PDB: 3bj1_A* 3bj2_A* 3bj3_A* 3bcq_A* Back     alignment and structure
>1x9f_B Erythrocruorin, globin II, extracellular, globin AIII, globin B; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_B* Back     alignment and structure
>2bk9_A CG9734-PA; oxygen transport, drosophila melanogaster hemoglobin, heme hexacoordination, insect hemoglobin, protein cavities; HET: HEM CXS; 1.2A {Drosophila melanogaster} PDB: 2g3h_A* Back     alignment and structure
>2r80_B Hemoglobin subunit beta; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3dhr_B* 3mju_B* 1faw_B* 3k8b_B* 2qmb_B* 3eok_B* 1a4f_B* 1c40_B* 1hv4_B* 2zfb_B* 3mjp_B* 1hbr_B* 3fs4_B* 3a59_B* 1wmu_B* 1v75_B* 2z6n_B* 3at5_B* 3at6_B* Back     alignment and structure
>1hlb_A Hemoglobin (deoxy); oxygen transport; HET: HEM; 2.50A {Caudina arenicola} SCOP: a.1.1.2 Back     alignment and structure
>4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* Back     alignment and structure
>2dc3_A Cytoglobin; myoglobin, heme, oxygen transport, oxygen storage, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.68A {Homo sapiens} PDB: 1v5h_A* 3ag0_A* 1urv_A* 1umo_A* 1ury_A* 1ut0_A* 1ux9_A* Back     alignment and structure
>1gcv_B Hemoglobin; oxygen storage/transport complex; HET: HEM; 2.00A {Mustelus griseus} SCOP: a.1.1.2 PDB: 1gcw_B* Back     alignment and structure
>1out_A Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_A* Back     alignment and structure
>1spg_A Hemoglobin; carbon monoxide, R-state, teleost FISH effect, oxygen transport; HET: HEM; 1.95A {Leiostomus xanthurus} SCOP: a.1.1.2 Back     alignment and structure
>1x9f_D Globin C, hemoglobin chain D1, globin III, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_D* Back     alignment and structure
>1cg5_B Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_B* Back     alignment and structure
>3mkb_A Hemoglobin subunit alpha; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} SCOP: a.1.1.2 PDB: 1gcv_A* 1gcw_A* Back     alignment and structure
>3g46_A Globin-1; oxygen transport, allostery, oxygen affinity, cytoplasm, heme, iron, metal-binding, oxygen storage/transport, oxygen binding; HET: HEM; 0.91A {Scapharca inaequivalvis} SCOP: a.1.1.2 PDB: 1nxf_A* 3g4q_A* 3g4r_A* 3g4u_A* 3g4v_A* 3g4w_A* 3g4y_A* 3g52_A* 3g53_A* 3uhg_A* 3uhs_A* 3uhk_A* 3uhi_A* 3uhn_A* 3ugy_A* 2auo_A* 2aup_A* 3uhr_A* 3uh5_A* 3uh3_A* ... Back     alignment and structure
>1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* Back     alignment and structure
>1sct_B Hemoglobin II (carbonmonoxy) (beta chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 Back     alignment and structure
>1a6m_A Myoglobin; heme protein, model compounds, oxygen storage, ligand binding geometry, conformational substates, oxygen transpor; HET: HEM; 1.00A {Physeter catodon} SCOP: a.1.1.2 PDB: 1a6k_A* 1a6n_A* 2jho_A* 1ufp_A* 2eb9_A* 2eb8_A* 2w6w_A* 2ekt_A* 105m_A* 104m_A* 1ajh_A* 1ajg_A* 1bvc_A* 1bvd_A* 1bz6_A* 1bzr_A* 1cq2_A* 1duk_A* 1ebc_A* 1hjt_A* ... Back     alignment and structure
>1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* Back     alignment and structure
>1yhu_A Hemoglobin A1 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Back     alignment and structure
>2zs0_C Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_C* 2d2m_C* 2zfo_C* 2zs1_C* Back     alignment and structure
>1sct_A Hemoglobin II (carbonmonoxy) (alpha chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 Back     alignment and structure
>4hrt_B Hemoglobin B chain; oxygen transport, globin fold, oxygen; HET: HEM; 1.46A {Scapharca inaequivalvis} PDB: 1sct_B* Back     alignment and structure
>1ash_A Hemoglobin (OXY); oxygen storage; HET: HEM; 2.15A {Ascaris suum} SCOP: a.1.1.2 Back     alignment and structure
>1yhu_D Hemoglobin B2 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Back     alignment and structure
>3bom_B Hemoglobin subunit beta-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_B* 3bcq_B* 1spg_B* Back     alignment and structure
>2veb_A Protoglobin; hemoprotein structure, protein matrix tunnels, methanogenesis, archaea protein, transport protein; HET: HEM; 1.30A {Methanosarcina acetivorans} PDB: 2vee_A* 3r0g_A* 3qzz_A* 3qzx_A* Back     alignment and structure
>2zs0_B Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_B* 2d2m_B* 2zfo_B* 2zs1_B* Back     alignment and structure
>1yhu_B Giant hemoglobins B chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Back     alignment and structure
>3d1k_B Hemoglobin subunit beta-1/2; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 1t1n_B* 1la6_B* 3nfe_B* 3ng6_B* 2h8f_B* 1pbx_B* 1s5x_B* 1s5y_B* 1hbh_B* 2h8d_B* 2peg_B* 3gkv_B* 3gqg_B* Back     alignment and structure
>1out_B Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_B* Back     alignment and structure
>1lhs_A Myoglobin; oxygen storage; HET: HEM; 2.00A {Caretta caretta} SCOP: a.1.1.2 PDB: 1lht_A* Back     alignment and structure
>1v4x_B Hemoglobin beta chain; oxygen transport, heme, respiratory protein, erythrocyte, ROOT effect, SWIM bladder, oxygen storage/transport complex; HET: HEM; 1.60A {Thunnus thynnus} SCOP: a.1.1.2 PDB: 1v4u_B* 1v4w_B* Back     alignment and structure
>3mkb_B Hemoglobin subunit beta; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} SCOP: a.1.1.2 Back     alignment and structure
>2aa1_B Hemoglobin beta-C chain; ROOT effect, cooperativity, antarctic FISH, oxygen storage/transport complex; HET: HEM; 1.80A {Trematomus newnesi} SCOP: a.1.1.2 PDB: 1xq5_B* 3bj1_B* 3bj2_B* 3bj3_B* Back     alignment and structure
>1x9f_A Globin IV, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_A* Back     alignment and structure
>1yhu_C Hemoglobin B1A chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Back     alignment and structure
>1x9f_C Erythrocruorin, globin III, extracellular, globin C; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_C* Back     alignment and structure
>2lhb_A Hemoglobin V (cyano Met); oxygen transport; HET: HEM; 2.00A {Petromyzon marinus} SCOP: a.1.1.2 PDB: 3lhb_A* 1f5o_A* 1f5p_A* 1uc3_A* Back     alignment and structure
>3lb2_A Dehaloperoxidase A; globin, oxidoreductase; HET: HEM; 1.06A {Amphitrite ornata} SCOP: a.1.1.2 PDB: 1ewa_A* 1ew6_A* 2qfk_A* 3kun_A* 3lb1_A* 3dr9_A* 3lb3_A* 3lb4_A* 3mou_A* 3ord_A* 3mym_A* 3k3u_A* 3o7n_A* 3kuo_A* 2qfn_A* 3myn_A* 3oj1_A* 3ok5_A* 3ixf_A* Back     alignment and structure
>2zs0_A Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_A* 2d2m_A* 2zfo_A* 2zs1_A* Back     alignment and structure
>4hrt_A Globin-2 A chain; oxygen transport, globin fold, oxygen; HET: HEM; 1.46A {Scapharca inaequivalvis} PDB: 1sct_A* Back     alignment and structure
>1eca_A Erythrocruorin (AQUO Met); oxygen transport; HET: HEM; 1.40A {Chironomus thummi thummi} SCOP: a.1.1.2 PDB: 1ecd_A* 1ecn_A* 1eco_A* Back     alignment and structure
>1x3k_A Hemoglobin component V; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.64A {Tokunagayusurika akamusi} PDB: 2zwj_A* 3a5a_A* 3a5b_A* 3a5g_A* 3a9m_A* 3arj_A* 3ark_A* 3arl_A* Back     alignment and structure
>1it2_A Hemoglobin; hagfish, deoxy form, oxygen storage/transport complex; HET: HEM; 1.60A {Eptatretus burgeri} SCOP: a.1.1.2 PDB: 1it3_A* Back     alignment and structure
>2zs0_D Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2zfo_D* 2zs1_D* 2d2m_D* 2d2n_D* Back     alignment and structure
>3mvc_A Globin protein 6; oxygen sensor, heme-binding protein, C. elegans, OXY transport, electron transport; HET: HEM; 1.40A {Caenorhabditis elegans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d1ux8a_119 a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacil 1e-19
d1ngka_126 a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycob 2e-19
d1s69a_123 a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyano 3e-16
d1idra_127 a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycob 3e-14
d1dlya_121 a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Green 3e-14
d1dlwa_116 a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cilia 2e-13
>d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure

class: All alpha proteins
fold: Globin-like
superfamily: Globin-like
family: Truncated hemoglobin
domain: Protozoan/bacterial hemoglobin
species: Bacillus subtilis [TaxId: 1423]

 Score = 77.3 bits (190), Expect = 1e-19
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 4/119 (3%)

Query: 27  LFRKLGLQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYS 86
            +  +G +    L   FY RV        + IF + +  E  + Q +F  Q +GGPPLY+
Sbjct: 3   PYEAIGEELLSQLVDTFYERVASHP--LLKPIFPS-DLTETARKQKQFLTQYLGGPPLYT 59

Query: 87  QRKGHPALIGRHRPFPVTHQAAERWLHHMQIALDSTPEIDADSKIKMMNFFRHTAFFLV 145
           +  GHP L  RH PFP+T++ A+ WL  M+ A+D    ++ + +  +      TA  +V
Sbjct: 60  EEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHV-GLEGEIREFLFGRLELTARHMV 117
>d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]} Length = 126 Back     information, alignment and structure
>d1s69a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Length = 123 Back     information, alignment and structure
>d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]} Length = 127 Back     information, alignment and structure
>d1dlya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Green alga (Chlamydomonas eugametos) [TaxId: 3054]} Length = 121 Back     information, alignment and structure
>d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]} Length = 116 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1ngka_126 Protozoan/bacterial hemoglobin {Mycobacterium tube 100.0
d1idra_127 Protozoan/bacterial hemoglobin {Mycobacterium tube 100.0
d1ux8a_119 Protozoan/bacterial hemoglobin {Bacillus subtilis 100.0
d1dlwa_116 Protozoan/bacterial hemoglobin {Ciliate (Parameciu 100.0
d1dlya_121 Protozoan/bacterial hemoglobin {Green alga (Chlamy 100.0
d1s69a_123 Protozoan/bacterial hemoglobin {Cyanobacteria (Syn 100.0
d1tu9a_131 Hypothetical protein PA3967 {Pseudomonas aeruginos 98.69
d1or4a_169 Heme-based aerotactic transducer HemAT, sensor dom 97.82
d1gvha1146 Flavohemoglobin, N-terminal domain {Escherichia co 97.66
d1fsla_143 Leghemoglobin {Soybean (Glycine max), isoform A [T 97.02
d1kr7a_110 Nerve tissue mini-hemoglobin (neural globin) {Milk 96.94
d1a4fa_141 Hemoglobin, alpha-chain {Bar-headed goose (Anser i 96.76
d1cqxa1150 Flavohemoglobin, N-terminal domain {Alcaligenes eu 96.75
d2gdma_153 Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxI 96.71
d1mbaa_146 Myoglobin {Slug sea hare (Aplysia limacina) [TaxId 96.52
d1xq5a_142 Hemoglobin, alpha-chain {Yellow perch (Perca flave 96.35
d2dn3a1140 Hemoglobin, alpha-chain {Human (Homo sapiens) [Tax 96.31
d1vhba_144 Bacterial dimeric hemoglobin {Vitreoscilla stercor 96.2
d1jeba_141 Hemoglobin, alpha-chain {Human (Homo sapiens), zet 95.98
d1wmua_141 Hemoglobin, alpha-chain {Aldabra giant tortoise (G 95.85
d1d8ua_165 Non-symbiotic plant hemoglobin {Rice (Oryza sativa 95.84
d2qfka1137 Dehaloperoxidase {Amphitrite ornata [TaxId: 129555 95.71
d1spga_143 Hemoglobin, alpha-chain {Fish (Leiostomus xanthuru 95.63
d1myta_146 Myoglobin {Yellowfin tuna (Thunnus albacares) [Tax 95.62
d1h97a_147 Trematode hemoglobin/myoglobin {Paramphistomum epi 95.54
d1hlba_157 Hemoglobin, different isoforms {Caudina arenicola, 95.48
d1outa_142 Hemoglobin, alpha-chain {Trout (Oncorhynchus mykis 95.43
d1jl7a_147 Glycera globin {Marine bloodworm (Glycera dibranch 95.41
d1itha_141 Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 95.25
d1gcva_140 Hemoglobin, alpha-chain {Houndshark (Mustelus gris 95.13
d1gcvb_136 Hemoglobin, beta-chain {Houndshark (Mustelus grise 95.0
d1asha_147 Ascaris hemoglobin, domain 1 {Pig roundworm (Ascar 94.96
d1hlma_158 Hemoglobin, different isoforms {Caudina arenicola, 94.88
d3d1ka1142 Hemoglobin, alpha-chain {Antarctic fish (Trematomu 94.79
d1cg5a_141 Hemoglobin, alpha-chain {Cartilaginous fish akaei 94.75
d1x9fb_145 Extracellular dodecameric hemoglobin (erythrocruor 94.34
d1q1fa_148 Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} 94.3
d1x9fa_147 Extracellular dodecameric hemoglobin (erythrocruor 94.03
d3sdha_145 Hemoglobin I {Ark clam (Scapharca inaequivalvis) [ 93.86
d1lhta_153 Myoglobin {Loggerhead sea turtle (Caretta caretta) 93.75
d1ecda_136 Erythrocruorin {Midge (Chironomus thummi thummi), 93.61
d1x9fc_149 Extracellular dodecameric hemoglobin (erythrocruor 93.42
d2aa1b1146 Hemoglobin, beta-chain {Antarctic fish (Trematomus 93.35
d1a6ma_151 Myoglobin {Sperm whale (Physeter catodon) [TaxId: 92.79
d1outb_146 Hemoglobin, beta-chain {Trout (Oncorhynchus mykiss 92.67
d1b0ba_142 Hemoglobin I {Clam (Lucina pectinata) [TaxId: 2916 92.56
d1x9fd_140 Extracellular dodecameric hemoglobin (erythrocruor 92.5
d1wmub_146 Hemoglobin, beta-chain {Aldabra giant tortoise (Ge 92.49
d1cg5b_141 Hemoglobin, beta-chain {Cartilaginous fish akaei ( 92.16
d1scta_149 Hemoglobin I {Ark clam (Scapharca inaequivalvis) [ 91.91
d1urva_154 Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} 91.61
d3d1kb1146 Hemoglobin, beta-chain {Antarctic fish (Trematomus 90.71
d1sctb_150 Hemoglobin I {Ark clam (Scapharca inaequivalvis) [ 90.27
d1v4wb_146 Hemoglobin, beta-chain {Bluefin tuna (Thunnus thyn 87.95
d1spgb_147 Hemoglobin, beta-chain {Fish (Leiostomus xanthurus 87.35
d2dn3b1145 Hemoglobin, beta-chain {Human (Homo sapiens) [TaxI 83.93
d2lhba_149 Lamprey globin {Sea lamprey (Petromyzon marinus) [ 80.16
>d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Globin-like
superfamily: Globin-like
family: Truncated hemoglobin
domain: Protozoan/bacterial hemoglobin
species: Mycobacterium tuberculosis, HbO [TaxId: 1773]

Probab=100.00  E-value=1.6e-37  Score=229.01  Aligned_cols=122  Identities=28%  Similarity=0.571  Sum_probs=117.3

Q ss_pred             ccHHHHcC-HHHHHHHHHHHHHHHhcChhhhhhcccCCCCHHHHHHHHHHHHHHHhCCCCccCCCCCCCcccCCCCCCCC
Q 030908           25 TNLFRKLG-LQTFINLSTNFYTRVYDDEEEWFRSIFANSNKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPV  103 (169)
Q Consensus        25 ~sLYe~iG-~~~I~~LV~~FY~rv~~D~~~~l~~~F~~~d~~~~~~~l~~Fl~~~lGGP~~Y~g~~G~p~m~~~H~~l~I  103 (169)
                      +||||+|| +++|++||++||++|.+||.  |+++|...|++.++.+++.||++|+|||+.|+++||+++|+.+|.+++|
T Consensus         1 ~slye~iGGe~~I~~lV~~FY~~v~~D~~--l~~~F~~~d~~~~~~~~~~f~~~~~gGp~~~~~~y~g~~m~~~H~~~~I   78 (126)
T d1ngka_           1 KSFYDAVGGAKTFDAIVSRFYAQVAEDEV--LRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRI   78 (126)
T ss_dssp             CCHHHHTTTHHHHHHHHHHHHHHHHHCHH--HHHHSCSSCTHHHHHHHHHHHHHHTTSCSHHHHHHCSCCHHHHHTTSCC
T ss_pred             CCHHHHccCHHHHHHHHHHHHHHHHhChh--HHhhcCCCCHHHHHHHHHHHHHHHhhccccccccccCccHHHhccCCCC
Confidence            58999999 99999999999999999999  9999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHhhCC--CCCHHHHHHHHHHHHHHHHHHHccH
Q 030908          104 THQAAERWLHHMQIALDSTP--EIDADSKIKMMNFFRHTAFFLVAGD  148 (169)
Q Consensus       104 t~~~fd~Wl~~~~~aLd~~~--~~~~~~~~~l~~~~~~~a~~iv~~~  148 (169)
                      +++||++||+||.+||++++  +++++.+++++++++.+|.+|||++
T Consensus        79 ~~~~fd~wl~~~~~al~~~~~~~~~~~~~~~l~~~~~~~a~~mvN~p  125 (126)
T d1ngka_          79 SLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSP  125 (126)
T ss_dssp             CHHHHHHHHHHHHHHHHTSCTTTSCHHHHHHHHHHHHHHHHHTCCCC
T ss_pred             CHHHHHHHHHHHHHHHHHHhccCCCHHHHHHHHHHHHHHHHHhcCCC
Confidence            99999999999999999862  3799999999999999999999985
>d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]} Back     information, alignment and structure
>d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]} Back     information, alignment and structure
>d1dlya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Green alga (Chlamydomonas eugametos) [TaxId: 3054]} Back     information, alignment and structure
>d1s69a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gvha1 a.1.1.2 (A:1-146) Flavohemoglobin, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fsla_ a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]} Back     information, alignment and structure
>d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]} Back     information, alignment and structure
>d1a4fa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]} Back     information, alignment and structure
>d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]} Back     information, alignment and structure
>d1xq5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Yellow perch (Perca flavescens) [TaxId: 8167]} Back     information, alignment and structure
>d2dn3a1 a.1.1.2 (A:2-141) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]} Back     information, alignment and structure
>d1jeba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wmua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} Back     information, alignment and structure
>d1d8ua_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]} Back     information, alignment and structure
>d1spga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} Back     information, alignment and structure
>d1myta_ a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus albacares) [TaxId: 8236]} Back     information, alignment and structure
>d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]} Back     information, alignment and structure
>d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} Back     information, alignment and structure
>d1outa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} Back     information, alignment and structure
>d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]} Back     information, alignment and structure
>d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]} Back     information, alignment and structure
>d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} Back     information, alignment and structure
>d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} Back     information, alignment and structure
>d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1hlma_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} Back     information, alignment and structure
>d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Back     information, alignment and structure
>d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} Back     information, alignment and structure
>d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Back     information, alignment and structure
>d1lhta_ a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Caretta caretta) [TaxId: 8467]} Back     information, alignment and structure
>d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]} Back     information, alignment and structure
>d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2aa1b1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Back     information, alignment and structure
>d1a6ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} Back     information, alignment and structure
>d1outb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} Back     information, alignment and structure
>d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 29163]} Back     information, alignment and structure
>d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1wmub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} Back     information, alignment and structure
>d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} Back     information, alignment and structure
>d1scta_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Back     information, alignment and structure
>d1urva_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Back     information, alignment and structure
>d1sctb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Back     information, alignment and structure
>d1v4wb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]} Back     information, alignment and structure
>d1spgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} Back     information, alignment and structure
>d2dn3b1 a.1.1.2 (B:2-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2lhba_ a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} Back     information, alignment and structure