Citrus Sinensis ID: 030914
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 169 | ||||||
| 449469010 | 171 | PREDICTED: monothiol glutaredoxin-S15, m | 1.0 | 0.988 | 0.752 | 1e-72 | |
| 225442841 | 170 | PREDICTED: monothiol glutaredoxin-S15, m | 0.988 | 0.982 | 0.754 | 2e-72 | |
| 255553075 | 169 | Monothiol glutaredoxin-4, putative [Rici | 1.0 | 1.0 | 0.739 | 3e-72 | |
| 147814938 | 409 | hypothetical protein VITISV_033251 [Viti | 0.988 | 0.408 | 0.692 | 2e-69 | |
| 388494312 | 163 | unknown [Lotus japonicus] | 0.958 | 0.993 | 0.730 | 1e-64 | |
| 317106758 | 148 | JHL25H03.16 [Jatropha curcas] | 0.863 | 0.986 | 0.767 | 1e-64 | |
| 297834440 | 169 | glutaredoxin family protein [Arabidopsis | 0.982 | 0.982 | 0.696 | 7e-63 | |
| 18400858 | 169 | monothiol glutaredoxin-S15 [Arabidopsis | 0.982 | 0.982 | 0.702 | 8e-63 | |
| 21592763 | 169 | unknown [Arabidopsis thaliana] | 0.982 | 0.982 | 0.696 | 1e-62 | |
| 388519223 | 164 | unknown [Lotus japonicus] | 0.958 | 0.987 | 0.704 | 3e-62 |
| >gi|449469010|ref|XP_004152214.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like [Cucumis sativus] gi|449484186|ref|XP_004156810.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 277 bits (708), Expect = 1e-72, Method: Compositional matrix adjust.
Identities = 128/170 (75%), Positives = 154/170 (90%), Gaps = 1/170 (0%)
Query: 1 MARSLSNLIFKGIASYPSARSSRIVSGSL-YHNGMKYSTDVPNDPDTHEDFRPTSKVDAS 59
MA+SLSNL+FKG+A P+ R+SRIV L Y +GM+YST VPN+PDTH+DF+PT+K++ S
Sbjct: 2 MAKSLSNLLFKGLAGLPATRTSRIVVPGLNYQHGMRYSTTVPNEPDTHDDFKPTNKLENS 61
Query: 60 GLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYNVPISARNILEDPELKS 119
GLSL++VVEQDV++NPVM+YMKGVP+ PQCGFS+LAVRVL YNVP+SARNILED ELKS
Sbjct: 62 GLSLRDVVEQDVRQNPVMIYMKGVPDVPQCGFSALAVRVLKLYNVPLSARNILEDAELKS 121
Query: 120 AVKAFSHWPTFPQIFIKGEFIGGSDIILNMHQSGELKEKLKGIASNQKSD 169
AVK+FSHWPTFPQIFIKGEFIGGSDIILN+HQSGELKEKL IA+NQK++
Sbjct: 122 AVKSFSHWPTFPQIFIKGEFIGGSDIILNLHQSGELKEKLNDIAANQKTE 171
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225442841|ref|XP_002285351.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial isoform 1 [Vitis vinifera] gi|297743395|emb|CBI36262.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255553075|ref|XP_002517580.1| Monothiol glutaredoxin-4, putative [Ricinus communis] gi|223543212|gb|EEF44744.1| Monothiol glutaredoxin-4, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147814938|emb|CAN74745.1| hypothetical protein VITISV_033251 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388494312|gb|AFK35222.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|317106758|dbj|BAJ53252.1| JHL25H03.16 [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|297834440|ref|XP_002885102.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297330942|gb|EFH61361.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18400858|ref|NP_566522.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] gi|79313249|ref|NP_001030704.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] gi|119370633|sp|Q8LBK6.2|GRS15_ARATH RecName: Full=Monothiol glutaredoxin-S15, mitochondrial; Short=AtGrxS15; Flags: Precursor gi|11994338|dbj|BAB02297.1| unnamed protein product [Arabidopsis thaliana] gi|30102572|gb|AAP21204.1| At3g15660 [Arabidopsis thaliana] gi|110743466|dbj|BAE99619.1| hypothetical protein [Arabidopsis thaliana] gi|222424054|dbj|BAH19988.1| AT3G15660 [Arabidopsis thaliana] gi|332642189|gb|AEE75710.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] gi|332642190|gb|AEE75711.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21592763|gb|AAM64712.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|388519223|gb|AFK47673.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 169 | ||||||
| TAIR|locus:2093297 | 169 | GRX4 "glutaredoxin 4" [Arabido | 0.982 | 0.982 | 0.696 | 1e-59 | |
| UNIPROTKB|Q606E0 | 110 | MCA2078 "Glutaredoxin" [Methyl | 0.621 | 0.954 | 0.462 | 1.8e-25 | |
| UNIPROTKB|Q83DV9 | 99 | CBU_0583 "Glutaredoxin" [Coxie | 0.585 | 1.0 | 0.494 | 4.6e-25 | |
| TIGR_CMR|CBU_0583 | 99 | CBU_0583 "glutaredoxin-related | 0.585 | 1.0 | 0.494 | 4.6e-25 | |
| UNIPROTKB|Q5ZK23 | 162 | GLRX5 "Uncharacterized protein | 0.639 | 0.666 | 0.468 | 5.9e-25 | |
| CGD|CAL0004286 | 175 | orf19.2782 [Candida albicans ( | 0.579 | 0.56 | 0.514 | 1.6e-24 | |
| RGD|1308383 | 152 | Glrx5 "glutaredoxin 5" [Rattus | 0.633 | 0.703 | 0.481 | 2e-24 | |
| UNIPROTKB|Q86SX6 | 157 | GLRX5 "Glutaredoxin-related pr | 0.662 | 0.713 | 0.457 | 2.6e-24 | |
| UNIPROTKB|Q2GHG0 | 110 | ECH_0302 "Glutaredoxin" [Ehrli | 0.573 | 0.881 | 0.494 | 2.6e-24 | |
| TIGR_CMR|ECH_0302 | 110 | ECH_0302 "glutaredoxin-related | 0.573 | 0.881 | 0.494 | 2.6e-24 |
| TAIR|locus:2093297 GRX4 "glutaredoxin 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 612 (220.5 bits), Expect = 1.0e-59, P = 1.0e-59
Identities = 117/168 (69%), Positives = 141/168 (83%)
Query: 1 MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGM-KYSTDVPNDPDTHEDFRPTSKVDAS 59
MA SLS+ + KGIA+ + RSSR+ S S+Y NGM ++S+ VP+D DTH+DF+PT KV
Sbjct: 1 MAASLSSRLIKGIANLKAVRSSRLTSASVYQNGMMRFSSTVPSDSDTHDDFKPTQKVPPD 60
Query: 60 GL-SLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYNVPISARNILEDPELK 118
SLK++VE DVK+NPVM+YMKGVPE PQCGFSSLAVRVL YNVPIS+RNILED ELK
Sbjct: 61 STDSLKDIVENDVKDNPVMIYMKGVPESPQCGFSSLAVRVLQQYNVPISSRNILEDQELK 120
Query: 119 SAVKAFSHWPTFPQIFIKGEFIGGSDIILNMHQSGELKEKLKGIASNQ 166
+AVK+FSHWPTFPQIFIKGEFIGGSDIILNMH+ GEL++KLK ++ NQ
Sbjct: 121 NAVKSFSHWPTFPQIFIKGEFIGGSDIILNMHKEGELEQKLKDVSGNQ 168
|
|
| UNIPROTKB|Q606E0 MCA2078 "Glutaredoxin" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q83DV9 CBU_0583 "Glutaredoxin" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0583 CBU_0583 "glutaredoxin-related protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZK23 GLRX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0004286 orf19.2782 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| RGD|1308383 Glrx5 "glutaredoxin 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86SX6 GLRX5 "Glutaredoxin-related protein 5, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2GHG0 ECH_0302 "Glutaredoxin" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0302 ECH_0302 "glutaredoxin-related protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034560001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (170 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00020703001 | • | • | 0.470 | ||||||||
| GSVIVG00034899001 | • | • | 0.458 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 169 | |||
| cd03028 | 90 | cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family | 2e-52 | |
| TIGR00365 | 97 | TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 | 3e-52 | |
| COG0278 | 105 | COG0278, COG0278, Glutaredoxin-related protein [Po | 2e-46 | |
| PRK10824 | 115 | PRK10824, PRK10824, glutaredoxin-4; Provisional | 4e-34 | |
| PTZ00062 | 204 | PTZ00062, PTZ00062, glutaredoxin; Provisional | 1e-27 | |
| cd02066 | 72 | cd02066, GRX_family, Glutaredoxin (GRX) family; co | 6e-27 | |
| pfam00462 | 60 | pfam00462, Glutaredoxin, Glutaredoxin | 2e-20 | |
| cd03031 | 147 | cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, | 6e-11 | |
| cd03419 | 82 | cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) fam | 3e-10 | |
| TIGR02180 | 84 | TIGR02180, GRX_euk, Glutaredoxin | 2e-07 | |
| cd03418 | 75 | cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) fam | 3e-07 | |
| TIGR02181 | 79 | TIGR02181, GRX_bact, Glutaredoxin, GrxC family | 2e-06 | |
| TIGR02189 | 99 | TIGR02189, GlrX-like_plant, Glutaredoxin-like fami | 2e-04 | |
| COG0695 | 80 | COG0695, GrxC, Glutaredoxin and related proteins [ | 6e-04 | |
| PRK10638 | 83 | PRK10638, PRK10638, glutaredoxin 3; Provisional | 9e-04 |
| >gnl|CDD|239326 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
Score = 161 bits (410), Expect = 2e-52
Identities = 44/90 (48%), Positives = 66/90 (73%)
Query: 67 VEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYNVPISARNILEDPELKSAVKAFSH 126
+++ +KENPV+L+MKG PE P+CGFS V++L V +ILED E++ +K +S+
Sbjct: 1 IKKLIKENPVVLFMKGTPEEPRCGFSRKVVQILNQLGVDFGTFDILEDEEVRQGLKEYSN 60
Query: 127 WPTFPQIFIKGEFIGGSDIILNMHQSGELK 156
WPTFPQ+++ GE +GG DI+ MH+SGEL+
Sbjct: 61 WPTFPQLYVNGELVGGCDIVKEMHESGELQ 90
|
The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain followed by one to three GRX-like domains. It is interesting to note that PICOT from plants contain three repeats of the GRX-like domain, metazoan proteins (except for insect) have two repeats, while fungal sequences contain only one copy of the domain. PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Both GRX and TRX domains of PICOT are required for its activity. Characterized non-PICOT members of this family include CXIP1, a CAX-interacting protein in Arabidopsis thaliana, and PfGLP-1, a GRX-like protein from Plasmodium falciparum. Length = 90 |
| >gnl|CDD|188046 TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|223355 COG0278, COG0278, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182759 PRK10824, PRK10824, glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240250 PTZ00062, PTZ00062, glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|239329 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >gnl|CDD|239511 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|233765 TIGR02180, GRX_euk, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|239510 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|233766 TIGR02181, GRX_bact, Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >gnl|CDD|233771 TIGR02189, GlrX-like_plant, Glutaredoxin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182607 PRK10638, PRK10638, glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 169 | |||
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 100.0 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 100.0 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 99.97 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 99.97 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.97 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 99.96 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 99.96 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 99.96 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 99.93 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.91 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 99.9 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 99.9 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 99.87 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 99.86 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 99.86 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 99.85 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 99.85 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 99.84 | |
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 99.84 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.82 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 99.82 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 99.8 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 99.8 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 99.78 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 99.74 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 99.74 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 99.7 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 99.65 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 99.63 | |
| KOG2824 | 281 | consensus Glutaredoxin-related protein [Posttransl | 99.61 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 99.5 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 99.42 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 99.38 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 99.28 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 99.12 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 99.08 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 98.98 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 98.94 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 98.87 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 98.84 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 98.81 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 98.64 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 98.64 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 98.59 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 98.55 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 98.55 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 98.54 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 98.53 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 98.51 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 98.5 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 98.46 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 98.46 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 98.43 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 98.43 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 98.42 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 98.34 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 98.32 | |
| KOG4023 | 108 | consensus Uncharacterized conserved protein [Funct | 98.31 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 98.3 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 98.21 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 98.14 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 98.14 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 98.11 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 98.1 | |
| PHA02125 | 75 | thioredoxin-like protein | 98.1 | |
| KOG3029 | 370 | consensus Glutathione S-transferase-related protei | 98.09 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 98.07 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 98.06 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 98.04 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 98.01 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 97.97 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 97.96 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 97.9 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 97.89 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 97.86 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 97.85 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 97.84 | |
| PHA02278 | 103 | thioredoxin-like protein | 97.82 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 97.82 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 97.8 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 97.79 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 97.72 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 97.71 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 97.71 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 97.69 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 97.65 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 97.63 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 97.62 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 97.61 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 97.56 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 97.55 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 97.55 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 97.55 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 97.52 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 97.52 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 97.51 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 97.49 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 97.48 | |
| PRK10853 | 118 | putative reductase; Provisional | 97.47 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 97.46 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 97.46 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 97.43 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 97.39 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 97.37 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 97.34 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 97.33 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 97.32 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 97.3 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 97.28 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 97.26 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 97.24 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 97.23 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 97.19 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 97.15 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 97.13 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 97.11 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 97.1 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 97.08 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 97.07 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 97.05 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 97.01 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 96.95 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 96.95 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 96.95 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 96.92 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 96.88 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 96.87 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 96.86 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 96.83 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 96.83 | |
| PF14595 | 129 | Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. | 96.77 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 96.76 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 96.76 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 96.74 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 96.74 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 96.72 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 96.64 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 96.63 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 96.6 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 96.6 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 96.59 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 96.56 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 96.54 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 96.52 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 96.52 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 96.48 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 96.44 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 96.42 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 96.38 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 96.37 | |
| PLN02473 | 214 | glutathione S-transferase | 96.37 | |
| KOG4244 | 281 | consensus Failed axon connections (fax) protein/gl | 96.28 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 96.27 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 96.23 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 96.21 | |
| KOG0406 | 231 | consensus Glutathione S-transferase [Posttranslati | 96.19 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 96.05 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 96.03 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 95.99 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 95.97 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 95.87 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 95.79 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 95.75 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 95.71 | |
| KOG1422 | 221 | consensus Intracellular Cl- channel CLIC, contains | 95.67 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 95.64 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 95.62 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 95.62 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 95.59 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 95.47 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 95.46 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 95.34 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 95.27 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 95.23 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 95.19 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 95.16 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 95.14 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 95.13 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 95.12 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 95.12 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 95.11 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 95.07 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 95.05 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 95.0 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 94.86 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 94.78 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 94.59 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 94.58 | |
| COG3019 | 149 | Predicted metal-binding protein [General function | 94.49 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 94.41 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 94.41 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 94.37 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 94.35 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 94.35 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 94.26 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 94.23 | |
| PLN02395 | 215 | glutathione S-transferase | 94.22 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 94.19 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 94.16 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 94.15 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 94.14 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 94.09 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 94.08 | |
| PRK10853 | 118 | putative reductase; Provisional | 94.06 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 94.06 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 94.03 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 94.02 | |
| PF11009 | 105 | DUF2847: Protein of unknown function (DUF2847); In | 93.94 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 93.89 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 93.86 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 93.46 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 93.34 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 93.26 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 93.19 | |
| PF06953 | 123 | ArsD: Arsenical resistance operon trans-acting rep | 92.99 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 92.86 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 92.71 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 92.71 | |
| smart00594 | 122 | UAS UAS domain. | 92.44 | |
| KOG3425 | 128 | consensus Uncharacterized conserved protein [Funct | 92.37 | |
| PF07315 | 93 | DUF1462: Protein of unknown function (DUF1462); In | 92.33 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 92.28 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 92.13 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 92.11 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 92.03 | |
| PF06764 | 202 | DUF1223: Protein of unknown function (DUF1223); In | 91.69 | |
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 91.69 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 91.62 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 91.51 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 91.48 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 91.42 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 90.95 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 90.56 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 90.24 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 90.0 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 89.93 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 89.45 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 89.41 | |
| PRK11657 | 251 | dsbG disulfide isomerase/thiol-disulfide oxidase; | 89.38 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 89.14 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 88.81 | |
| KOG0867 | 226 | consensus Glutathione S-transferase [Posttranslati | 88.78 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 88.62 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 88.49 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 88.24 | |
| PF06110 | 119 | DUF953: Eukaryotic protein of unknown function (DU | 88.2 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 88.03 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 87.92 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 87.91 | |
| KOG4277 | 468 | consensus Uncharacterized conserved protein, conta | 87.85 | |
| KOG1695 | 206 | consensus Glutathione S-transferase [Posttranslati | 87.75 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 87.73 | |
| COG5494 | 265 | Predicted thioredoxin/glutaredoxin [Posttranslatio | 87.63 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 87.54 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 87.44 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 87.13 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 86.79 | |
| KOG2501 | 157 | consensus Thioredoxin, nucleoredoxin and related p | 86.78 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 86.72 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 86.69 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 86.54 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 85.78 | |
| COG0526 | 127 | TrxA Thiol-disulfide isomerase and thioredoxins [P | 85.16 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 84.45 | |
| PF03190 | 163 | Thioredox_DsbH: Protein of unknown function, DUF25 | 84.04 | |
| COG4837 | 106 | Uncharacterized protein conserved in bacteria [Fun | 84.03 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 83.6 | |
| PRK09437 | 154 | bcp thioredoxin-dependent thiol peroxidase; Review | 83.55 | |
| PHA03075 | 123 | glutaredoxin-like protein; Provisional | 83.32 | |
| cd03022 | 192 | DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-car | 81.54 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 81.35 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 80.92 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 80.9 | |
| PF04134 | 114 | DUF393: Protein of unknown function, DUF393; Inter | 80.84 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 80.01 |
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-36 Score=209.06 Aligned_cols=101 Identities=50% Similarity=0.994 Sum_probs=98.2
Q ss_pred cHHHHHHHHhhcCCeEEEeecCCCCCCCccHHHHHHHHhcCC-CCeEEEEcCCCHHHHHHHHHhcCCCCCcEEEeCCeEe
Q 030914 62 SLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYN-VPISARNILEDPELKSAVKAFSHWPTFPQIFIKGEFI 140 (169)
Q Consensus 62 ~~~~~i~~~~~~~~Vvly~k~~~~~~~C~~c~~a~~~L~~~~-v~~~~~di~~~~~~~~~l~~~~g~~t~P~vfi~g~~i 140 (169)
...++|++.++.|+|+|||||||+.|.|+|+.++.++|..+| ++|..+||+.|+++|+.|+++++|||+||+||||+||
T Consensus 3 ~i~~~I~~~i~~n~VvLFMKGtp~~P~CGFS~~~vqiL~~~g~v~~~~vnVL~d~eiR~~lk~~s~WPT~PQLyi~GEfv 82 (105)
T COG0278 3 EILDRIQKQIKENPVVLFMKGTPEFPQCGFSAQAVQILSACGVVDFAYVDVLQDPEIRQGLKEYSNWPTFPQLYVNGEFV 82 (105)
T ss_pred hHHHHHHHHhhcCceEEEecCCCCCCCCCccHHHHHHHHHcCCcceeEEeeccCHHHHhccHhhcCCCCCceeeECCEEe
Confidence 467899999999999999999999999999999999999999 8999999999999999999999999999999999999
Q ss_pred eccHHHHHHHhcccHHHHHhcc
Q 030914 141 GGSDIILNMHQSGELKEKLKGI 162 (169)
Q Consensus 141 GG~d~l~~~~~~g~L~~~L~~~ 162 (169)
||+|++.+|+++|+|+++|+.+
T Consensus 83 GG~DIv~Em~q~GELq~~l~~~ 104 (105)
T COG0278 83 GGCDIVREMYQSGELQTLLKEA 104 (105)
T ss_pred ccHHHHHHHHHcchHHHHHHhc
Confidence 9999999999999999999865
|
|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >KOG4023 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG3019 Predicted metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >PF06953 ArsD: Arsenical resistance operon trans-acting repressor ArsD; InterPro: IPR010712 This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >KOG3425 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07315 DUF1462: Protein of unknown function (DUF1462); InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PF06764 DUF1223: Protein of unknown function (DUF1223); InterPro: IPR010634 This family consists of several hypothetical proteins of around 250 residues in length, which are found in both plants and bacteria | Back alignment and domain information |
|---|
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >COG5494 Predicted thioredoxin/glutaredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >COG4837 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed | Back alignment and domain information |
|---|
| >PHA03075 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 169 | ||||
| 2wul_A | 118 | Crystal Structure Of The Human Glutaredoxin 5 With | 3e-25 | ||
| 1yka_A | 115 | Solution Structure Of Grx4, A Monothiol Glutaredoxi | 3e-25 | ||
| 2wci_A | 135 | Structure Of E. Coli Monothiol Glutaredoxin Grx4 Ho | 4e-25 | ||
| 3gx8_A | 121 | Structural And Biochemical Characterization Of Yeas | 1e-24 | ||
| 2lku_A | 109 | Solution Structure Of Reduced Poplar Apo Grxs14 Len | 5e-24 | ||
| 3ipz_A | 109 | Crystal Structure Of Arabidopsis Monothiol Glutared | 2e-23 | ||
| 3zyw_A | 111 | Crystal Structure Of The First Glutaredoxin Domain | 2e-19 | ||
| 2yan_A | 105 | Crystal Structure Of The Second Glutaredoxin Domain | 2e-18 | ||
| 1wik_A | 109 | Solution Structure Of The Picot Homology 2 Domain O | 1e-17 | ||
| 3fz9_A | 112 | Crystal Structure Of Poplar Glutaredoxin S12 In Com | 6e-05 | ||
| 2e7p_A | 116 | Crystal Structure Of The Holo Form Of Glutaredoxin | 9e-05 | ||
| 1b4q_A | 105 | Solution Structure Of Human Thioltransferase Comple | 1e-04 | ||
| 1z7p_A | 117 | Solution Structure Of Reduced Glutaredoxin C1 From | 2e-04 | ||
| 1jhb_A | 106 | Human Glutaredoxin In Fully Reduced Form, Nmr, 20 S | 4e-04 | ||
| 2khp_A | 92 | Solution Structure Of Glutaredoxin From Brucella Me | 6e-04 | ||
| 2ht9_A | 146 | The Structure Of Dimeric Human Glutaredoxin 2 Lengt | 7e-04 |
| >pdb|2WUL|A Chain A, Crystal Structure Of The Human Glutaredoxin 5 With Bound Glutathione In An Fes Cluster Length = 118 | Back alignment and structure |
|
| >pdb|1YKA|A Chain A, Solution Structure Of Grx4, A Monothiol Glutaredoxin From E. Coli Length = 115 | Back alignment and structure |
| >pdb|2WCI|A Chain A, Structure Of E. Coli Monothiol Glutaredoxin Grx4 Homodimer Length = 135 | Back alignment and structure |
| >pdb|3GX8|A Chain A, Structural And Biochemical Characterization Of Yeast Monothiol Glutaredoxin Grx5 Length = 121 | Back alignment and structure |
| >pdb|2LKU|A Chain A, Solution Structure Of Reduced Poplar Apo Grxs14 Length = 109 | Back alignment and structure |
| >pdb|3IPZ|A Chain A, Crystal Structure Of Arabidopsis Monothiol Glutaredoxin Atgr Length = 109 | Back alignment and structure |
| >pdb|3ZYW|A Chain A, Crystal Structure Of The First Glutaredoxin Domain Of Human Glutaredoxin 3 (Glrx3) Length = 111 | Back alignment and structure |
| >pdb|2YAN|A Chain A, Crystal Structure Of The Second Glutaredoxin Domain Of Human Txnl2 Length = 105 | Back alignment and structure |
| >pdb|1WIK|A Chain A, Solution Structure Of The Picot Homology 2 Domain Of The Mouse Pkc-Interacting Cousin Of Thioredoxin Protein Length = 109 | Back alignment and structure |
| >pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione Length = 112 | Back alignment and structure |
| >pdb|2E7P|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 116 | Back alignment and structure |
| >pdb|1B4Q|A Chain A, Solution Structure Of Human Thioltransferase Complex With Glutathione Length = 105 | Back alignment and structure |
| >pdb|1Z7P|A Chain A, Solution Structure Of Reduced Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 117 | Back alignment and structure |
| >pdb|1JHB|A Chain A, Human Glutaredoxin In Fully Reduced Form, Nmr, 20 Structures Length = 106 | Back alignment and structure |
| >pdb|2KHP|A Chain A, Solution Structure Of Glutaredoxin From Brucella Melitensis Length = 92 | Back alignment and structure |
| >pdb|2HT9|A Chain A, The Structure Of Dimeric Human Glutaredoxin 2 Length = 146 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 169 | |||
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 3e-54 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 1e-53 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 1e-53 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 2e-53 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 3e-53 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 9e-53 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 3e-51 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 1e-31 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 6e-23 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 1e-22 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 4e-22 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 2e-18 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 2e-18 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 2e-17 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 2e-17 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 3e-17 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 1e-16 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 2e-16 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 2e-16 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 5e-16 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 3e-14 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 3e-12 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 3e-11 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 7e-09 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 2e-08 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 2e-08 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 3e-08 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 3e-08 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 1e-07 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 1e-06 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 3e-06 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 6e-05 |
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Length = 135 | Back alignment and structure |
|---|
Score = 167 bits (424), Expect = 3e-54
Identities = 45/127 (35%), Positives = 80/127 (62%), Gaps = 2/127 (1%)
Query: 45 DTHEDFRPTSKVDASGL--SLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAY 102
H + V + E +++ + ENP++LYMKG P+ P CGFS+ AV+ L A
Sbjct: 4 SHHHHHHSSGLVPRGSHMSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAAC 63
Query: 103 NVPISARNILEDPELKSAVKAFSHWPTFPQIFIKGEFIGGSDIILNMHQSGELKEKLKGI 162
+ +IL++P++++ + +++WPTFPQ+++ GE +GG DI++ M+Q GEL++ +K
Sbjct: 64 GERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKET 123
Query: 163 ASNQKSD 169
A+ KS+
Sbjct: 124 AAKYKSE 130
|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} Length = 109 | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Length = 109 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Length = 121 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Length = 105 | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Length = 118 | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Length = 129 | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Length = 114 | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Length = 146 | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Length = 127 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Length = 113 | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Length = 362 | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Length = 75 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Length = 85 | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Length = 87 | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Length = 241 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 169 | |||
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 100.0 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 100.0 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 100.0 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 99.98 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 99.98 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 99.96 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 99.95 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 99.95 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 99.95 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 99.94 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 99.94 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 99.92 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 99.92 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 99.92 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 99.91 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 99.91 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 99.9 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 99.9 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 99.89 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 99.87 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 99.87 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 99.86 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 99.85 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.84 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.83 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 99.82 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.81 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.75 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 99.74 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 99.71 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 99.65 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 99.64 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 99.63 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 99.63 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 99.58 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 99.55 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 99.34 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 99.31 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 99.29 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 99.26 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 99.2 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 99.03 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 98.91 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 98.9 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 98.85 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 98.7 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 98.6 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 98.53 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 98.52 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 98.51 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 98.47 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 98.47 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 98.46 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 98.45 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 98.43 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 98.4 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 98.39 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 98.39 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 98.39 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 98.27 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 98.2 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 98.15 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 98.14 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 98.07 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 98.07 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 98.07 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 98.05 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 98.03 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 98.03 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 98.02 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 98.0 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 98.0 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 97.96 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 97.95 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 97.94 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 97.93 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 97.92 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 97.92 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 97.92 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 97.91 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 97.88 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 97.87 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 97.87 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 97.86 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 97.86 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 97.86 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 97.85 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 97.84 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 97.84 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 97.83 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 97.83 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 97.82 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 97.82 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 97.82 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 97.78 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 97.78 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 97.77 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 97.77 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 97.76 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 97.76 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 97.76 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 97.74 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 97.74 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 97.74 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 97.74 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 97.72 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 97.72 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 97.72 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 97.72 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 97.72 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 97.71 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 97.69 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 97.69 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 97.69 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 97.68 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 97.67 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 97.67 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 97.67 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 97.67 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 97.67 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 97.66 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 97.64 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 97.64 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 97.64 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 97.64 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 97.64 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 97.63 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 97.63 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 97.63 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 97.63 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 97.62 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 97.62 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 97.62 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 97.62 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 97.62 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 97.62 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 97.61 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 97.61 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 97.59 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 97.58 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 97.58 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 97.58 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 97.57 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 97.57 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 97.57 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 97.57 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 97.55 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 97.54 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 97.54 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 97.53 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 97.53 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 97.53 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 97.53 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 97.52 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 97.52 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 97.52 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 97.52 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 97.52 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 97.51 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 97.51 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 97.5 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 97.49 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 97.49 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 97.49 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 97.49 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 97.48 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 97.48 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 97.48 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 97.47 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 97.45 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 97.45 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 97.45 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 97.43 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 97.41 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 97.41 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 97.41 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 97.41 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 97.4 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 97.4 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 97.4 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 97.39 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 97.39 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 97.38 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 97.37 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 97.37 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 97.37 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 97.37 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 97.37 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 97.37 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 97.33 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 97.32 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 97.32 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 97.3 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 97.3 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 97.3 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 97.29 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 97.26 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 97.25 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 97.22 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 97.2 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 97.2 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 97.18 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 97.17 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 97.16 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 97.15 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 97.13 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 97.13 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 97.13 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 96.21 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 97.12 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 97.05 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 97.04 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 97.03 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 97.03 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 96.99 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 96.98 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 96.98 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 96.98 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 96.93 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 96.93 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 96.92 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 96.91 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 96.88 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 96.87 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 96.87 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 96.86 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 96.86 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 96.84 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 96.82 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 96.79 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 95.81 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 96.77 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 96.75 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 96.71 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 96.71 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 96.67 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 96.63 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 96.62 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 96.61 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 96.59 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 96.58 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 96.57 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 96.55 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 96.54 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 96.54 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 96.53 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 96.53 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 96.51 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 96.49 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 96.47 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 96.47 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 96.46 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 96.45 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 96.41 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 96.41 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 96.4 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 96.38 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 96.35 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 96.35 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 96.35 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 96.31 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 96.31 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 96.28 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 96.27 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 96.26 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 96.2 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 96.19 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 96.19 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 96.16 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 96.15 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 96.13 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 96.11 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 96.09 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 96.07 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 96.05 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 96.04 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 95.96 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 95.89 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 95.87 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 95.76 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 95.75 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 95.74 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 95.69 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 95.67 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 95.67 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 95.64 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 95.61 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 95.59 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 95.57 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 95.52 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 95.46 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 95.45 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 95.35 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 95.32 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 95.31 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 95.21 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 95.08 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 94.07 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 94.99 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 94.99 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 94.98 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 94.93 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 94.93 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 94.78 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 94.72 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 94.71 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 94.67 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 94.65 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 94.64 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 94.62 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 94.57 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 94.53 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 94.45 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 94.41 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 94.31 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 94.22 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 94.09 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 94.06 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 94.01 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 93.91 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 93.9 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 93.9 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 92.61 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 93.48 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 93.45 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 93.13 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 93.1 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 93.05 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 92.79 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 92.78 | |
| 1xg8_A | 111 | Hypothetical protein SA0798; structural genomics, | 92.74 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 92.71 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 92.66 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 92.64 | |
| 3ktb_A | 106 | Arsenical resistance operon trans-acting represso; | 92.62 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 92.3 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 92.27 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 91.97 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 91.96 | |
| 3kgk_A | 110 | Arsenical resistance operon trans-acting represso; | 91.83 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 91.79 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 91.62 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 91.01 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 90.7 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 90.52 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 90.44 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 90.18 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 90.03 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 89.92 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 89.71 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 88.77 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 88.46 | |
| 1tp9_A | 162 | Peroxiredoxin, PRX D (type II); oligomer, thioredo | 87.82 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 87.46 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 87.37 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 87.28 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 86.88 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 86.72 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 86.5 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 86.29 | |
| 2g2q_A | 124 | Glutaredoxin-2; thioredoxin-fold, oxidoreductase, | 85.99 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 85.63 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 85.59 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 84.97 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 84.77 | |
| 2wfc_A | 167 | Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan | 84.67 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 84.34 | |
| 2pwj_A | 171 | Mitochondrial peroxiredoxin; alpha and beta protei | 84.23 | |
| 3hz8_A | 193 | Thiol:disulfide interchange protein DSBA; thiol-ox | 83.97 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 83.86 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 83.47 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 83.31 | |
| 1un2_A | 197 | DSBA, thiol-disulfide interchange protein; disulfi | 83.27 | |
| 3mng_A | 173 | Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, | 83.11 | |
| 3tdg_A | 273 | DSBG, putative uncharacterized protein; thioredoxi | 83.08 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 82.95 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 82.03 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 81.36 | |
| 3uma_A | 184 | Hypothetical peroxiredoxin protein; nysgrc, PSI bi | 81.35 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 81.06 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 80.99 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 80.88 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 80.68 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 80.57 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 80.04 |
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-36 Score=218.79 Aligned_cols=107 Identities=44% Similarity=0.856 Sum_probs=101.1
Q ss_pred ccHHHHHHHHhhcCCeEEEeecCCCCCCCccHHHHHHHHhcCCC-CeEEEEcCCCHHHHHHHHHhcCCCCCcEEEeCCeE
Q 030914 61 LSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYNV-PISARNILEDPELKSAVKAFSHWPTFPQIFIKGEF 139 (169)
Q Consensus 61 ~~~~~~i~~~~~~~~Vvly~k~~~~~~~C~~c~~a~~~L~~~~v-~~~~~di~~~~~~~~~l~~~~g~~t~P~vfi~g~~ 139 (169)
...+++|++++++|+||||+||||+.|+||||.+|+++|+++|+ +|+++||+.++++|++|++++||+|||||||||+|
T Consensus 7 ~~~~e~i~~~i~~~~VvvF~Kgt~~~P~C~fc~~ak~lL~~~gv~~~~~~~v~~~~~~r~~l~~~sg~~TvPqIFI~g~~ 86 (118)
T 2wul_A 7 GGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEF 86 (118)
T ss_dssp --CHHHHHHHHHHSSEEEEESBCSSSBSSHHHHHHHHHHHHTTCCSCEEEETTSCHHHHHHHHHHHTCCSSCEEEETTEE
T ss_pred cchHHHHHHHHhcCCEEEEEcCCCCCCCCHHHHHHHHHHHHhCCcCeEeecccCCHHHHHHHHHhccCCCCCeEeECCEE
Confidence 34578999999999999999999999999999999999999999 69999999999999999999999999999999999
Q ss_pred eeccHHHHHHHhcccHHHHHhcccccCC
Q 030914 140 IGGSDIILNMHQSGELKEKLKGIASNQK 167 (169)
Q Consensus 140 iGG~d~l~~~~~~g~L~~~L~~~~~~~~ 167 (169)
|||+|++.+|+++|+|.++|+++|...+
T Consensus 87 IGG~Ddl~~l~~~GeL~~lL~~~Gi~~a 114 (118)
T 2wul_A 87 VGGCDILLQMHQNGDLVEELKKLGIHSA 114 (118)
T ss_dssp EECHHHHHHHHHHTHHHHHHHHTTCCCT
T ss_pred ECCHHHHHHHHHCCCHHHHHHHcCCccc
Confidence 9999999999999999999999887554
|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1xg8_A Hypothetical protein SA0798; structural genomics, protein structure initative, MCSG, PSI, protein structure initiative; 2.10A {Staphylococcus aureus subsp} SCOP: c.47.1.17 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3kgk_A Arsenical resistance operon trans-acting represso; alpha+beta, chaperone, DNA-binding, RE transcription, transcription regulation; 1.40A {Escherichia coli} PDB: 3mwh_A | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >2g2q_A Glutaredoxin-2; thioredoxin-fold, oxidoreductase, poxvirus; 2.50A {Vaccinia virus} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} | Back alignment and structure |
|---|
| >3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A | Back alignment and structure |
|---|
| >3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 169 | ||||
| d1wika_ | 109 | c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M | 8e-32 | |
| d1ktea_ | 105 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 4e-22 | |
| d1fova_ | 82 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 5e-22 | |
| d1t1va_ | 93 | c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax | 2e-15 | |
| d1nm3a1 | 74 | c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb | 1e-14 | |
| d1abaa_ | 87 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 1e-13 | |
| d1r7ha_ | 74 | c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Cory | 6e-12 | |
| d1egoa_ | 85 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 1e-11 | |
| d1h75a_ | 76 | c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch | 5e-11 |
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin-like protein 2 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 108 bits (270), Expect = 8e-32
Identities = 38/102 (37%), Positives = 62/102 (60%)
Query: 60 GLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYNVPISARNILEDPELKS 119
G S ++ + VML+MKG + +CGFS + +L + V +ILED E++
Sbjct: 1 GSSGSSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQ 60
Query: 120 AVKAFSHWPTFPQIFIKGEFIGGSDIILNMHQSGELKEKLKG 161
+K FS+WPT+PQ++++G+ +GG DI+ + +GEL LKG
Sbjct: 61 GLKTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKG 102
|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Length = 87 | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 74 | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 169 | |||
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 100.0 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 99.95 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.95 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.89 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 99.87 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 99.83 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.82 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 99.82 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 99.82 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 99.15 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 99.1 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 99.0 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 98.96 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 98.9 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 98.5 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 98.48 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 98.48 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 98.48 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 98.45 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.4 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 98.4 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 98.36 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 98.33 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 98.29 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 98.19 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 98.19 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 98.14 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 98.14 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 98.09 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 98.09 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 98.09 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 98.08 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 98.03 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 98.02 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 98.02 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 98.01 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 97.79 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 97.79 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 97.72 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 97.67 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 97.57 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 97.56 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 97.55 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 97.52 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 97.42 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 97.4 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 97.39 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 97.38 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 97.31 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 97.28 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 97.27 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 97.22 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 97.1 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 97.06 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 97.03 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 96.85 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 96.84 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 96.7 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 96.53 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 96.49 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 96.48 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 96.45 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 96.32 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 96.31 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 96.26 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 96.2 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 96.01 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 95.94 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 95.88 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 95.76 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 95.51 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.46 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 95.46 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 95.27 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 94.98 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 94.83 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 94.78 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 94.71 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 94.54 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 94.52 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 94.49 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 94.36 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 94.25 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 94.23 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 94.14 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 93.86 | |
| d1xg8a_ | 111 | Hypothetical protein SA0798 {Staphylococcus aureus | 93.83 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 93.66 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 93.48 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 93.34 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 92.67 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 92.56 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 92.54 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 92.37 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 92.3 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 92.07 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 92.07 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 91.59 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 91.42 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 91.3 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 90.27 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 90.08 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 90.0 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 89.84 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 89.32 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 89.13 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 89.08 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 88.93 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 88.51 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 88.21 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 86.86 | |
| d2axoa1 | 225 | Hypothetical protein Atu2684 {Agrobacterium tumefa | 85.62 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 83.24 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 82.89 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 82.15 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 81.86 |
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin-like protein 2 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=1.3e-34 Score=204.17 Aligned_cols=104 Identities=35% Similarity=0.683 Sum_probs=99.4
Q ss_pred HHHHHHHHhhcCCeEEEeecCCCCCCCccHHHHHHHHhcCCCCeEEEEcCCCHHHHHHHHHhcCCCCCcEEEeCCeEeec
Q 030914 63 LKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYNVPISARNILEDPELKSAVKAFSHWPTFPQIFIKGEFIGG 142 (169)
Q Consensus 63 ~~~~i~~~~~~~~Vvly~k~~~~~~~C~~c~~a~~~L~~~~v~~~~~di~~~~~~~~~l~~~~g~~t~P~vfi~g~~iGG 142 (169)
....|+.++++++||||+||||+.|+||||.+|+++|++++++|+++||+.+++.++++.+++||+|+|||||+|++|||
T Consensus 4 ~~~~i~~~i~~~~VvvF~Kgt~~~p~Cp~c~~ak~lL~~~~i~~~~~~v~~~~~~~~~l~~~t~~~TvPqIFi~g~~IGG 83 (109)
T d1wika_ 4 GSSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGG 83 (109)
T ss_dssp SCCCHHHHHTTSSEEEEESSTTTCCCSSTHHHHHHHHHHTCSCEEEEESSSCHHHHHHHHHHHSCCSSCEEECSSSEEEC
T ss_pred HHHHHHHHHhcCCEEEEeCCCCCCCCChHHHHHHHHHHhcCCCceEEEecccHHHHHHHHHhcCCCCCCeEEECCEEEcC
Confidence 45678999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cHHHHHHHhcccHHHHHhcccccC
Q 030914 143 SDIILNMHQSGELKEKLKGIASNQ 166 (169)
Q Consensus 143 ~d~l~~~~~~g~L~~~L~~~~~~~ 166 (169)
+|++++|+++|+|.++|++.+++.
T Consensus 84 ~ddl~~l~~~G~L~~lL~~~~~~~ 107 (109)
T d1wika_ 84 LDIVKELKDNGELLPILKGESGPS 107 (109)
T ss_dssp HHHHHHHHHHTCSHHHHHTCCSCS
T ss_pred HHHHHHHHHCCCHHHHHHhcCCCC
Confidence 999999999999999999887653
|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|