Citrus Sinensis ID: 031032

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MTMDWQSAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSSGMKRAKTGR
ccccccccccccccccEEEEEEEEccccccccccEEEEEccccccHHHHHHHHHccEEEEEcccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
ccccccccccccccccEEEEEEEEEEccccccccEEEEEcccccccHHHHHHHcccEEEEEEccccccHHHHHHHcccccccHcccccEEEEEEEccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
mtmdwqsapaspssytVKRILRleipvdtypnfnfvgrllgprgnslkRVEATTgcrvyirgkgsikdpdkedklrgrpgyehlndplhilieadlpanIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSnfredspgpsgsvspfnssgmkraktgr
mtmdwqsapaspssytvKRILRLEIPVDTYPNFNfvgrllgprgnslkrveattgcrvyirgkgsikdpdkedkLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEEllkpvdesqDYIKRQQLRELAMLNSnfredspgpsgsvspfnssgmkraktgr
MTMDWQSAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSSGMKRAKTGR
**************YTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGK*****************YEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPV************************************************
************SSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKG********************NDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRE**********************************
*************SYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFR*************************
************SSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNF**************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMDWQSAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSSGMKRAKTGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
Q8GYR4283 KH domain-containing prot yes no 1.0 0.590 0.868 8e-83
Q9ZVI3286 KH domain-containing prot no no 0.988 0.576 0.893 2e-81
Q75GR5281 KH domain-containing prot yes no 0.988 0.587 0.807 1e-76
Q0WLR1308 KH domain-containing prot no no 0.970 0.525 0.672 1e-61
Q9FKT4315 KH domain-containing prot no no 0.970 0.514 0.666 1e-60
Q8GWR3298 KH domain-containing prot no no 0.946 0.530 0.592 2e-52
Q6IRN2 342 Protein quaking-B OS=Xeno N/A no 0.730 0.356 0.491 6e-32
Q6P104319 Protein quaking-B OS=Dani yes no 0.730 0.382 0.491 7e-32
Q5W9D5 341 Protein quaking OS=Sus sc yes no 0.730 0.357 0.491 8e-32
Q9QYS9 341 Protein quaking OS=Mus mu yes no 0.730 0.357 0.491 8e-32
>sp|Q8GYR4|QKIL4_ARATH KH domain-containing protein At3g08620 OS=Arabidopsis thaliana GN=At3g08620 PE=2 SV=1 Back     alignment and function desciption
 Score =  305 bits (782), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 145/167 (86%), Positives = 159/167 (95%)

Query: 1   MTMDWQSAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYI 60
           M M+WQ APASPSSY VKRILRL++PVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYI
Sbjct: 117 MAMEWQGAPASPSSYPVKRILRLDLPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYI 176

Query: 61  RGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVD 120
           RGKGSIKDP+KE+KL+G+PGYEHLN+ LHILIEADLP +IVDI+LRQAQEIIEEL+KPVD
Sbjct: 177 RGKGSIKDPEKEEKLKGKPGYEHLNEQLHILIEADLPIDIVDIKLRQAQEIIEELVKPVD 236

Query: 121 ESQDYIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSSGMKRAKTGR 167
           ESQDYIKRQQLRELA+LNSN RE+SPGPSGSVSPFNS+ MKR KTGR
Sbjct: 237 ESQDYIKRQQLRELALLNSNLRENSPGPSGSVSPFNSNAMKRPKTGR 283

Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZVI3|QKIL3_ARATH KH domain-containing protein At2g38610 OS=Arabidopsis thaliana GN=At2g38610 PE=1 SV=1 Back     alignment and function description
>sp|Q75GR5|SPIN1_ORYSJ KH domain-containing protein SPIN1 OS=Oryza sativa subsp. japonica GN=SPIN1 PE=1 SV=1 Back     alignment and function description
>sp|Q0WLR1|QKIL1_ARATH KH domain-containing protein At4g26480 OS=Arabidopsis thaliana GN=At4g26480 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKT4|QKIL2_ARATH KH domain-containing protein At5g56140 OS=Arabidopsis thaliana GN=At5g56140 PE=2 SV=1 Back     alignment and function description
>sp|Q8GWR3|QKIL5_ARATH KH domain-containing protein At1g09660 OS=Arabidopsis thaliana GN=At1g09660 PE=2 SV=1 Back     alignment and function description
>sp|Q6IRN2|QKIB_XENLA Protein quaking-B OS=Xenopus laevis GN=qki-b PE=1 SV=1 Back     alignment and function description
>sp|Q6P104|QKIB_DANRE Protein quaking-B OS=Danio rerio GN=qkib PE=2 SV=1 Back     alignment and function description
>sp|Q5W9D5|QKI_PIG Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1 Back     alignment and function description
>sp|Q9QYS9|QKI_MOUSE Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
224069102 281 predicted protein [Populus trichocarpa] 1.0 0.594 0.970 2e-90
356532119 281 PREDICTED: KH domain-containing protein 1.0 0.594 0.964 3e-90
356568258 281 PREDICTED: KH domain-containing protein 1.0 0.594 0.964 3e-90
224140633 281 predicted protein [Populus trichocarpa] 1.0 0.594 0.958 8e-90
225439096 281 PREDICTED: KH domain-containing protein 1.0 0.594 0.958 9e-90
255647494 281 unknown [Glycine max] 1.0 0.594 0.958 1e-89
255582022 680 conserved hypothetical protein [Ricinus 0.988 0.242 0.963 2e-89
356560101 281 PREDICTED: KH domain-containing protein 1.0 0.594 0.940 3e-88
449449831 281 PREDICTED: KH domain-containing protein 1.0 0.594 0.946 3e-88
357512747 292 KH domain-containing protein [Medicago t 1.0 0.571 0.934 9e-88
>gi|224069102|ref|XP_002326275.1| predicted protein [Populus trichocarpa] gi|222833468|gb|EEE71945.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  336 bits (861), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 162/167 (97%), Positives = 166/167 (99%)

Query: 1   MTMDWQSAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYI 60
           MTMDWQ APASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYI
Sbjct: 115 MTMDWQGAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYI 174

Query: 61  RGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVD 120
           RGKGSIKDPDKE+KLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVD
Sbjct: 175 RGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVD 234

Query: 121 ESQDYIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSSGMKRAKTGR 167
           ESQD+IKRQQLRELAMLNSNFRE+SPGPSGSVSPFN+SGMKRAKTGR
Sbjct: 235 ESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTSGMKRAKTGR 281

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356532119|ref|XP_003534621.1| PREDICTED: KH domain-containing protein At2g38610-like [Glycine max] Back     alignment and taxonomy information
>gi|356568258|ref|XP_003552330.1| PREDICTED: KH domain-containing protein At2g38610-like [Glycine max] Back     alignment and taxonomy information
>gi|224140633|ref|XP_002323686.1| predicted protein [Populus trichocarpa] gi|222868316|gb|EEF05447.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225439096|ref|XP_002268790.1| PREDICTED: KH domain-containing protein At2g38610 [Vitis vinifera] gi|296085835|emb|CBI31159.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255647494|gb|ACU24211.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255582022|ref|XP_002531808.1| conserved hypothetical protein [Ricinus communis] gi|223528542|gb|EEF30565.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356560101|ref|XP_003548334.1| PREDICTED: KH domain-containing protein At2g38610-like [Glycine max] Back     alignment and taxonomy information
>gi|449449831|ref|XP_004142668.1| PREDICTED: KH domain-containing protein At2g38610-like [Cucumis sativus] gi|449510973|ref|XP_004163826.1| PREDICTED: KH domain-containing protein At2g38610-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357512747|ref|XP_003626662.1| KH domain-containing protein [Medicago truncatula] gi|355520684|gb|AET01138.1| KH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
TAIR|locus:2077818283 AT3G08620 "AT3G08620" [Arabido 1.0 0.590 0.868 1.5e-76
TAIR|locus:2064097286 AT2G38610 "AT2G38610" [Arabido 0.988 0.576 0.893 1.3e-75
UNIPROTKB|Q75GR5281 SPIN1 "KH domain-containing pr 0.988 0.587 0.807 6.1e-71
TAIR|locus:2161845315 AT5G56140 "AT5G56140" [Arabido 0.970 0.514 0.666 1.6e-56
TAIR|locus:2024326298 AT1G09660 "AT1G09660" [Arabido 0.946 0.530 0.592 1.5e-49
ZFIN|ZDB-GENE-081028-54 345 qkib "QKI, KH domain containin 0.868 0.420 0.452 4.2e-31
ZFIN|ZDB-GENE-040426-1462319 qki2 "QKI, KH domain containin 0.868 0.454 0.445 4.2e-31
UNIPROTKB|F1N7N1 315 QKI "Protein quaking" [Bos tau 0.730 0.387 0.491 6.9e-31
UNIPROTKB|Q5W9D7 341 QKI "Protein quaking" [Bos tau 0.730 0.357 0.491 6.9e-31
UNIPROTKB|F1PLY2 310 QKI "Protein quaking" [Canis l 0.730 0.393 0.491 6.9e-31
TAIR|locus:2077818 AT3G08620 "AT3G08620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 771 (276.5 bits), Expect = 1.5e-76, P = 1.5e-76
 Identities = 145/167 (86%), Positives = 159/167 (95%)

Query:     1 MTMDWQSAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYI 60
             M M+WQ APASPSSY VKRILRL++PVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYI
Sbjct:   117 MAMEWQGAPASPSSYPVKRILRLDLPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYI 176

Query:    61 RGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVD 120
             RGKGSIKDP+KE+KL+G+PGYEHLN+ LHILIEADLP +IVDI+LRQAQEIIEEL+KPVD
Sbjct:   177 RGKGSIKDPEKEEKLKGKPGYEHLNEQLHILIEADLPIDIVDIKLRQAQEIIEELVKPVD 236

Query:   121 ESQDYIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSSGMKRAKTGR 167
             ESQDYIKRQQLRELA+LNSN RE+SPGPSGSVSPFNS+ MKR KTGR
Sbjct:   237 ESQDYIKRQQLRELALLNSNLRENSPGPSGSVSPFNSNAMKRPKTGR 283
GO:0003676 "nucleic acid binding" evidence=ISS
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0010048 "vernalization response" evidence=RCA
TAIR|locus:2064097 AT2G38610 "AT2G38610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q75GR5 SPIN1 "KH domain-containing protein SPIN1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2161845 AT5G56140 "AT5G56140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024326 AT1G09660 "AT1G09660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081028-54 qkib "QKI, KH domain containing, RNA binding b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1462 qki2 "QKI, KH domain containing, RNA binding 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N7N1 QKI "Protein quaking" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5W9D7 QKI "Protein quaking" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLY2 QKI "Protein quaking" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q75GR5SPIN1_ORYSJNo assigned EC number0.80720.98800.5871yesno
Q8GYR4QKIL4_ARATHNo assigned EC number0.86821.00.5901yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
cd02395120 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K ho 2e-51
COG5176269 COG5176, MSL5, Splicing factor (branch point bindi 4e-23
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 1e-04
smart0032268 smart00322, KH, K homology RNA-binding domain 1e-04
>gnl|CDD|239088 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information 
 Score =  159 bits (405), Expect = 2e-51
 Identities = 67/122 (54%), Positives = 90/122 (73%), Gaps = 5/122 (4%)

Query: 22  RLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGY 81
           ++ IPV  YP +NFVG +LGPRGN+LK++E  TG ++ IRGKGS+KD  KE++LRG P Y
Sbjct: 3   KVYIPVKQYPKYNFVGLILGPRGNTLKQLEKETGAKISIRGKGSMKDGKKEEELRG-PKY 61

Query: 82  EHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKP-VDESQDYIKRQQLRELAMLNSN 140
            HLN+PLH+LI A+ P    +  L +A E IEELLKP ++   D +KR+QLRELA+LN  
Sbjct: 62  AHLNEPLHVLITAETPP---EEALAKAVEAIEELLKPAIEGGNDELKREQLRELALLNGT 118

Query: 141 FR 142
           +R
Sbjct: 119 YR 120

Splicing factor 1 (SF1) specifically recognizes the intron branch point sequence (BPS) UACUAAC in the pre-mRNA transcripts during spliceosome assembly. We show that the KH-QUA2 region of SF1 defines an enlarged KH (hnRNP K) fold which is necessary and sufficient for BPS binding. KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 120
>gnl|CDD|227503 COG5176, MSL5, Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
KOG1588259 consensus RNA-binding protein Sam68 and related KH 100.0
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 100.0
KOG0119 554 consensus Splicing factor 1/branch point binding p 100.0
COG5176269 MSL5 Splicing factor (branch point binding protein 99.95
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.39
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 99.11
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 98.93
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 98.93
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.92
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.91
smart0032269 KH K homology RNA-binding domain. 98.79
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 98.78
PRK13763180 putative RNA-processing protein; Provisional 98.74
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 98.74
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 98.67
KOG1960 531 consensus Predicted RNA-binding protein, contains 98.59
PF1301443 KH_3: KH domain 98.57
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 98.54
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 98.51
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 98.45
PRK13763180 putative RNA-processing protein; Provisional 98.4
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 98.18
COG1094194 Predicted RNA-binding protein (contains KH domains 98.0
KOG1676 600 consensus K-homology type RNA binding proteins [RN 97.84
KOG1676 600 consensus K-homology type RNA binding proteins [RN 97.69
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 97.61
KOG1067760 consensus Predicted RNA-binding polyribonucleotide 97.44
KOG2191 402 consensus RNA-binding protein NOVA1/PASILLA and re 97.02
KOG2874356 consensus rRNA processing protein [Translation, ri 96.97
PRK00106 535 hypothetical protein; Provisional 96.9
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 96.87
PRK12704 520 phosphodiesterase; Provisional 96.81
KOG2191 402 consensus RNA-binding protein NOVA1/PASILLA and re 96.68
KOG2190 485 consensus PolyC-binding proteins alphaCP-1 and rel 96.65
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 96.4
KOG2814 345 consensus Transcription coactivator complex, P50 c 96.28
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.1
COG1094194 Predicted RNA-binding protein (contains KH domains 95.52
PRK12705 508 hypothetical protein; Provisional 94.62
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 94.58
KOG1960 531 consensus Predicted RNA-binding protein, contains 94.07
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 93.52
KOG2190485 consensus PolyC-binding proteins alphaCP-1 and rel 93.47
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 92.66
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 90.07
PRK08406140 transcription elongation factor NusA-like protein; 89.26
KOG2192 390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 89.02
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 86.83
KOG2113 394 consensus Predicted RNA binding protein, contains 84.61
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 83.47
COG1855604 ATPase (PilT family) [General function prediction 82.97
PRK08406140 transcription elongation factor NusA-like protein; 82.15
COG0195190 NusA Transcription elongation factor [Transcriptio 82.11
PRK12327362 nusA transcription elongation factor NusA; Provisi 81.4
TIGR01953341 NusA transcription termination factor NusA. This m 80.72
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 80.6
PRK12329449 nusA transcription elongation factor NusA; Provisi 80.53
PRK0282177 hypothetical protein; Provisional 80.28
PRK0046875 hypothetical protein; Provisional 80.13
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=5.7e-50  Score=336.87  Aligned_cols=155  Identities=55%  Similarity=0.895  Sum_probs=145.9

Q ss_pred             CCCCcccceEEEEecCCCCCCCCceeeEEeCCCcchHHHHHHHhCCeEEEecccCCCCCCcccccCCCCCCCCCCCCcEE
Q 031032           11 SPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHI   90 (167)
Q Consensus        11 ~~~g~~~~~~~ki~IPv~~~P~~NfiG~IIGP~G~tiK~Iq~eTG~kI~IrG~GS~k~~~~~~~~~~~p~~~~~~epLHV   90 (167)
                      .++++.++.+.||+||+++||+||||||||||+|+|+|+||++|||||.|||+||+||..+|++++++|+|+|+++||||
T Consensus        84 ~~~~~~vk~~~Kv~vPv~~yP~fNFVGRILGPrGnSlkrLe~eTgCki~IrGrgSmrD~~KEE~lR~~p~yeHL~epLHV  163 (259)
T KOG1588|consen   84 VYSGKPVKLTEKVLVPVKEYPKFNFVGRILGPRGNSLKRLEEETGCKIMIRGRGSMRDKAKEEELRGDPGYEHLNEPLHV  163 (259)
T ss_pred             CccCCceeEEEEEEeccCCCCCCccccccccCCcchHHHHHHHHCCeEEEecCCcccchHHHHHhhcCcchHHhCCCcEE
Confidence            68899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecCCcchHHHHHHHHHHHHHhccCCCCcchHHHHHHHHHHHHHhcCc-cCCCCCCCCC---CCCCCCcccccccccC
Q 031032           91 LIEADLPANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSN-FREDSPGPSG---SVSPFNSSGMKRAKTG  166 (167)
Q Consensus        91 ~Isa~~~~~~a~~~l~~A~~~Ie~LL~~~~~~~d~~k~~QL~elA~lnGt-~r~~~~~~~~---~~~~~~~~~~~~~~~~  166 (167)
                      +|++.+++++|+.+|.+|++.|++||.|.+++.|  |++||+|||++||| +++.+..++|   ..+||++.+++|++||
T Consensus       164 lIe~~~p~~ea~~rl~~AleeI~klL~P~~e~~d--k~~QL~ELa~lngt~~~~~~~~~~g~~~~~~~~~~~~~~r~~~~  241 (259)
T KOG1588|consen  164 LIETEAPPAEAYARLAYALEEIKKLLVPDHEDED--KREQLRELAILNGTYLRSESRKPSGGNGRGVPGNSAGGKRGKTG  241 (259)
T ss_pred             EEEEeCCHHHHHHHHHHHHHHHHHhcCCCCCCch--HHHHHHHHhhcCCccccccccccCCCCCcCCCCCCCCcccccCC
Confidence            9999999999999999999999999999988777  99999999999999 5555544555   7899999999999987


Q ss_pred             C
Q 031032          167 R  167 (167)
Q Consensus       167 ~  167 (167)
                      .
T Consensus       242 ~  242 (259)
T KOG1588|consen  242 P  242 (259)
T ss_pred             C
Confidence            3

>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>KOG1960 consensus Predicted RNA-binding protein, contains KH domains [RNA processing and modification] Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1960 consensus Predicted RNA-binding protein, contains KH domains [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2bl5_A140 Solution Structure Of The Kh-Qua2 Region Of The Xen 3e-32
1k1g_A131 Structural Basis For Recognition Of The Intron Bran 5e-18
>pdb|2BL5|A Chain A, Solution Structure Of The Kh-Qua2 Region Of The Xenopus Star-Gsg Quaking Protein Length = 140 Back     alignment and structure 
Iteration: 1

 Score =  134 bits (336), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 92/122 (75%)
Query: 22  RLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGY 81
           +L +PV  YP+FNFVGR+LGPRG + K++EA TGC++ +RGKGS++D  KE++ RG+P +
Sbjct: 5   KLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNW 64
Query: 82  EHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNF 141
           EHLN+ LH+LI  +   N  +++L++A E +++LL P  E +D +K+ +L ELA+LN  +
Sbjct: 65  EHLNEDLHVLITVEDAQNRAELKLKRAVEEVKKLLVPAAEGEDSLKKMKLMELAILNGTY 124
Query: 142 RE 143
           R+
Sbjct: 125 RD 126
>pdb|1K1G|A Chain A, Structural Basis For Recognition Of The Intron Branch Site Rna By Splicing Factor 1 Length = 131 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 2e-58
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 5e-49
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 2e-29
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 100.0
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 100.0
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 99.96
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.42
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.3
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.29
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.28
1we8_A104 Tudor and KH domain containing protein; structural 99.26
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.26
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.24
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.19
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.18
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.18
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.17
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.17
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.17
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.15
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.14
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.13
2cpq_A91 FragIle X mental retardation syndrome related prot 99.12
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.12
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.08
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.08
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 99.03
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.0
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.84
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.83
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 98.81
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.79
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.77
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.74
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.73
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 98.72
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.67
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.65
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.65
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.64
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 98.3
1tua_A191 Hypothetical protein APE0754; structural genomics, 98.29
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 98.21
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 98.05
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 97.9
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 97.79
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 97.55
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 97.25
1tua_A191 Hypothetical protein APE0754; structural genomics, 96.68
3n89_A376 Defective in GERM LINE development protein 3, ISO; 95.77
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 95.47
2z0s_A235 Probable exosome complex RNA-binding protein 1; al 90.82
2cxc_A144 NUSA; transcription termination, RNA binding prote 86.02
2ba0_A229 Archeal exosome RNA binding protein RRP4; RNAse PH 82.29
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
Probab=100.00  E-value=4.9e-49  Score=305.78  Aligned_cols=129  Identities=45%  Similarity=0.851  Sum_probs=124.6

Q ss_pred             eEEEEecCCCCCCCCceeeEEeCCCcchHHHHHHHhCCeEEEecccCCCCCCcccccCCCCCCCCCCCCcEEEEEecCCc
Q 031032           19 RILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPA   98 (167)
Q Consensus        19 ~~~ki~IPv~~~P~~NfiG~IIGP~G~tiK~Iq~eTG~kI~IrG~GS~k~~~~~~~~~~~p~~~~~~epLHV~Isa~~~~   98 (167)
                      ..+||+||+++||+|||||+||||+|+|+|+||++|||||.|||+||+++.+++++++|+|+|+|++|||||+|++.+++
T Consensus         2 ~~~Ki~IP~~~~P~~NfiG~IiGPrG~t~K~ie~eTg~kI~IrGkGS~kd~~~e~~~~g~~~~~~~~epLHV~Isa~~~~   81 (140)
T 2bl5_A            2 LQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQ   81 (140)
T ss_dssp             EEEEEECCTTTCSSSCHHHHHTTTTHHHHHHHHHHHSEEEEEESTTSSCCHHHHHTSTTSHHHHTTTSCCEEEEEECSCC
T ss_pred             ceeEEEcCcccCCCCCeeeEEECCCcchHHHHHHHHCCeEEEecCCCcccccccccccCCCCccccCCCcEEEEEecCch
Confidence            47899999999999999999999999999999999999999999999999999888999999999999999999999999


Q ss_pred             chHHHHHHHHHHHHHhccCCCCcchHHHHHHHHHHHHHhcCccCCCCCC
Q 031032           99 NIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREDSPG  147 (167)
Q Consensus        99 ~~a~~~l~~A~~~Ie~LL~~~~~~~d~~k~~QL~elA~lnGt~r~~~~~  147 (167)
                      ++|++++++|+++|++||.++++++|++|++||+|||++|||||+++..
T Consensus        82 ~~~~~~l~~A~~~I~~lL~p~~e~~de~K~~QL~eLA~lNGt~r~~~~~  130 (140)
T 2bl5_A           82 NRAELKLKRAVEEVKKLLVPAAEGEDSLKKMKLMELAILNGTYRDANLK  130 (140)
T ss_dssp             HHHHHHHHHHHHHHHHHSSCCSSSSSHHHHHHHTGGGSSSTTTSGGGGS
T ss_pred             hhHHHHHHHHHHHHHHHCCCCCcchhHHHHHHHHHHHHhcCCcCCCccc
Confidence            9999999999999999999999999999999999999999999998753
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 167
d2bl5a1134 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {Afric 1e-58
d1k1ga_122 d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo s 4e-47
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 6e-05
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 6e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 0.001
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 0.003
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 0.003
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 134 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Quaking protein A (Xqua)
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score =  177 bits (450), Expect = 1e-58
 Identities = 59/129 (45%), Positives = 95/129 (73%), Gaps = 1/129 (0%)

Query: 22  RLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGY 81
           +L +PV  YP+FNFVGR+LGPRG + K++EA TGC++ +RGKGS++D  KE++ RG+P +
Sbjct: 5   KLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNW 64

Query: 82  EHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNF 141
           EHLN+ LH+LI  +   N  +++L++A E +++LL P  E +D +K+ +L ELA+LN  +
Sbjct: 65  EHLNEDLHVLITVEDAQNRAELKLKRAVEEVKKLLVPAAEGEDSLKKMKLMELAILNGTY 124

Query: 142 REDS-PGPS 149
           R+ +   P+
Sbjct: 125 RDANLKSPA 133
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 100.0
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 100.0
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 99.23
d2cpqa178 Fragile X mental retardation syndrome related prot 99.21
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 99.21
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.19
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.17
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 99.15
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.13
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.13
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.12
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.07
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 99.05
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.04
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.02
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 99.01
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.95
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.9
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 98.89
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.8
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.66
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.59
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 95.74
d3etja179 N5-carboxyaminoimidazole ribonucleotide synthetase 85.4
d1hh2p368 Transcription factor NusA, C-terminal domains {The 83.62
d2asba367 Transcription factor NusA, C-terminal domains {Myc 80.04
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Quaking protein A (Xqua)
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=100.00  E-value=3.9e-50  Score=308.08  Aligned_cols=129  Identities=45%  Similarity=0.857  Sum_probs=124.6

Q ss_pred             ceEEEEecCCCCCCCCceeeEEeCCCcchHHHHHHHhCCeEEEecccCCCCCCcccccCCCCCCCCCCCCcEEEEEecCC
Q 031032           18 KRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLP   97 (167)
Q Consensus        18 ~~~~ki~IPv~~~P~~NfiG~IIGP~G~tiK~Iq~eTG~kI~IrG~GS~k~~~~~~~~~~~p~~~~~~epLHV~Isa~~~   97 (167)
                      +.++|||||+++||+|||+|+||||+|+|+|+||++|||||.|||+||+++.+++.+++++++++|++|||||+|+++++
T Consensus         1 kl~eKv~IP~~~~P~~NfvG~IiGPrG~t~K~le~eTg~kI~IrGrGS~k~~~~~~~~~~~~~~~~~~epLHv~I~a~~~   80 (134)
T d2bl5a1           1 QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDA   80 (134)
T ss_dssp             CEEEEEECCTTTCSSSCHHHHHTTTTHHHHHHHHHHHSEEEEEESTTSSCCHHHHHTSTTSHHHHTTTSCCEEEEEECSC
T ss_pred             CcceEEeCCCCCCCCCCeeEEEECCCCchHHHHHHHHCCEEEEEecCCCcCccccccccCCCCCcCCCCCCEEEEEecCc
Confidence            46799999999999999999999999999999999999999999999999999998899999999999999999999999


Q ss_pred             cchHHHHHHHHHHHHHhccCCCCcchHHHHHHHHHHHHHhcCccCCCCC
Q 031032           98 ANIVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREDSP  146 (167)
Q Consensus        98 ~~~a~~~l~~A~~~Ie~LL~~~~~~~d~~k~~QL~elA~lnGt~r~~~~  146 (167)
                      +..|+.+|++|+++|++||.|+++++|++|++||+|||++|||||+++.
T Consensus        81 ~~~a~~kl~~A~~~I~~lL~p~~e~~de~k~~QL~eLa~lNGt~r~~~~  129 (134)
T d2bl5a1          81 QNRAELKLKRAVEEVKKLLVPAAEGEDSLKKMKLMELAILNGTYRDANL  129 (134)
T ss_dssp             CHHHHHHHHHHHHHHHHHSSCCSSSSSHHHHHHHTGGGSSSTTTSGGGG
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCccchHHHHHHHHHHHHHhcCccccccC
Confidence            9999999999999999999999999999999999999999999999874
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure