Citrus Sinensis ID: 031082
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 166 | ||||||
| 14423552 | 174 | Unknown protein [Arabidopsis thaliana] g | 0.728 | 0.695 | 0.975 | 8e-66 | |
| 18379062 | 174 | peptide alpha-N-acetyltransferase [Arabi | 0.728 | 0.695 | 0.975 | 8e-66 | |
| 225437024 | 174 | PREDICTED: N-alpha-acetyltransferase 20 | 0.728 | 0.695 | 0.966 | 2e-65 | |
| 4587562 | 228 | Belongs to PF|00583 Acetyltransfersase ( | 0.728 | 0.530 | 0.975 | 3e-65 | |
| 84468430 | 174 | hypothetical protein [Trifolium pratense | 0.728 | 0.695 | 0.958 | 6e-65 | |
| 388492138 | 174 | unknown [Lotus japonicus] | 0.728 | 0.695 | 0.958 | 8e-65 | |
| 449458492 | 174 | PREDICTED: N-alpha-acetyltransferase 20- | 0.728 | 0.695 | 0.950 | 1e-64 | |
| 351726786 | 174 | uncharacterized protein LOC100306394 [Gl | 0.728 | 0.695 | 0.942 | 4e-64 | |
| 255559422 | 174 | n-acetyltransferase, putative [Ricinus c | 0.728 | 0.695 | 0.925 | 4e-63 | |
| 357512517 | 174 | N-terminal acetyltransferase B complex c | 0.728 | 0.695 | 0.925 | 5e-63 |
| >gi|14423552|gb|AAK62458.1|AF387013_1 Unknown protein [Arabidopsis thaliana] gi|20148275|gb|AAM10028.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 254 bits (649), Expect = 8e-66, Method: Compositional matrix adjust.
Identities = 118/121 (97%), Positives = 120/121 (99%)
Query: 43 MTTIRRFCCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRIMGYIMGK 102
MTTIRRF CNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNR+MGYIMGK
Sbjct: 1 MTTIRRFSCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRVMGYIMGK 60
Query: 103 VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK 162
VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK
Sbjct: 61 VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK 120
Query: 163 I 163
+
Sbjct: 121 M 121
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|18379062|ref|NP_563677.1| peptide alpha-N-acetyltransferase [Arabidopsis thaliana] gi|297843116|ref|XP_002889439.1| hypothetical protein ARALYDRAFT_887467 [Arabidopsis lyrata subsp. lyrata] gi|21536510|gb|AAM60842.1| unknown [Arabidopsis thaliana] gi|297335281|gb|EFH65698.1| hypothetical protein ARALYDRAFT_887467 [Arabidopsis lyrata subsp. lyrata] gi|332189415|gb|AEE27536.1| peptide alpha-N-acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225437024|ref|XP_002278246.1| PREDICTED: N-alpha-acetyltransferase 20 [Vitis vinifera] gi|296085201|emb|CBI28696.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|4587562|gb|AAD25793.1|AC006550_1 Belongs to PF|00583 Acetyltransfersase (GNAT) family [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|84468430|dbj|BAE71298.1| hypothetical protein [Trifolium pratense] | Back alignment and taxonomy information |
|---|
| >gi|388492138|gb|AFK34135.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449458492|ref|XP_004146981.1| PREDICTED: N-alpha-acetyltransferase 20-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|351726786|ref|NP_001238162.1| uncharacterized protein LOC100306394 [Glycine max] gi|255628397|gb|ACU14543.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255559422|ref|XP_002520731.1| n-acetyltransferase, putative [Ricinus communis] gi|223540116|gb|EEF41693.1| n-acetyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357512517|ref|XP_003626547.1| N-terminal acetyltransferase B complex catalytic subunit [Medicago truncatula] gi|355501562|gb|AES82765.1| N-terminal acetyltransferase B complex catalytic subunit [Medicago truncatula] gi|388520053|gb|AFK48088.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 166 | ||||||
| TAIR|locus:2007584 | 174 | AT1G03150 "AT1G03150" [Arabido | 0.728 | 0.695 | 0.975 | 7.9e-62 | |
| FB|FBgn0031043 | 175 | NAA20 "NAA20 ortholog" [Drosop | 0.722 | 0.685 | 0.636 | 2.1e-38 | |
| UNIPROTKB|P61599 | 178 | NAA20 "N-alpha-acetyltransfera | 0.722 | 0.674 | 0.593 | 5.7e-36 | |
| MGI|MGI:1915127 | 178 | Naa20 "N(alpha)-acetyltransfer | 0.722 | 0.674 | 0.593 | 5.7e-36 | |
| UNIPROTKB|E1C474 | 178 | NAA20 "Uncharacterized protein | 0.722 | 0.674 | 0.593 | 7.2e-36 | |
| ZFIN|ZDB-GENE-050327-47 | 178 | naa20 "N(alpha)-acetyltransfer | 0.722 | 0.674 | 0.577 | 1.9e-35 | |
| DICTYBASE|DDB_G0276345 | 173 | naa20 "N(alpha)-acetyltransfer | 0.728 | 0.699 | 0.570 | 4e-35 | |
| UNIPROTKB|E1B843 | 188 | NAA20 "Uncharacterized protein | 0.722 | 0.638 | 0.541 | 5.2e-33 | |
| UNIPROTKB|J9P2S9 | 188 | NAA20 "Uncharacterized protein | 0.722 | 0.638 | 0.541 | 5.2e-33 | |
| RGD|1307713 | 188 | Naa20 "N(alpha)-acetyltransfer | 0.722 | 0.638 | 0.541 | 5.2e-33 |
| TAIR|locus:2007584 AT1G03150 "AT1G03150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 632 (227.5 bits), Expect = 7.9e-62, P = 7.9e-62
Identities = 118/121 (97%), Positives = 120/121 (99%)
Query: 43 MTTIRRFCCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRIMGYIMGK 102
MTTIRRF CNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNR+MGYIMGK
Sbjct: 1 MTTIRRFSCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRVMGYIMGK 60
Query: 103 VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK 162
VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK
Sbjct: 61 VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK 120
Query: 163 I 163
+
Sbjct: 121 M 121
|
|
| FB|FBgn0031043 NAA20 "NAA20 ortholog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P61599 NAA20 "N-alpha-acetyltransferase 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915127 Naa20 "N(alpha)-acetyltransferase 20, NatB catalytic subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C474 NAA20 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050327-47 naa20 "N(alpha)-acetyltransferase 20, NatB catalytic subunit" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0276345 naa20 "N(alpha)-acetyltransferase 20, NatB catalytic subunit" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B843 NAA20 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P2S9 NAA20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1307713 Naa20 "N(alpha)-acetyltransferase 20, NatB catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 166 | |||
| COG0456 | 177 | COG0456, RimI, Acetyltransferases [General functio | 2e-17 | |
| pfam00583 | 80 | pfam00583, Acetyltransf_1, Acetyltransferase (GNAT | 1e-11 | |
| TIGR01575 | 131 | TIGR01575, rimI, ribosomal-protein-alanine acetylt | 6e-08 | |
| cd04301 | 65 | cd04301, NAT_SF, N-Acyltransferase superfamily: Va | 4e-06 | |
| PRK03624 | 140 | PRK03624, PRK03624, putative acetyltransferase; Pr | 6e-06 | |
| pfam13527 | 127 | pfam13527, Acetyltransf_9, Acetyltransferase (GNAT | 6e-04 | |
| pfam13508 | 79 | pfam13508, Acetyltransf_7, Acetyltransferase (GNAT | 0.004 |
| >gnl|CDD|223532 COG0456, RimI, Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
Score = 74.6 bits (183), Expect = 2e-17
Identities = 33/135 (24%), Positives = 55/135 (40%), Gaps = 12/135 (8%)
Query: 40 SRKMTTIRRFCCNDLLRFTSVNLDHLTETFN----MSFYMTYLARWPDYFHVAEGPG--- 92
S TIR DLL L+ T ++ L + P+ VAE G
Sbjct: 8 SEDKVTIREAINKDLLDVALAALEARTFDIRLPWSREYFEKDLTQAPELLLVAETGGLDG 67
Query: 93 ---NRIMGYIMGKV--EGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAY 147
+++G+++ +V GH+ + V PEYR + + + L++ + + A
Sbjct: 68 LLDGKVVGFLLVRVVDGRPSADHEGHIYNLAVDPEYRGRGIGRALLDEALERLRERGLAD 127
Query: 148 FVDLFVRASNTPAIK 162
+ L VR SN AI
Sbjct: 128 KIVLEVRESNEAAIG 142
|
Length = 177 |
| >gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family | Back alignment and domain information |
|---|
| >gnl|CDD|233477 TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >gnl|CDD|235142 PRK03624, PRK03624, putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222199 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 99.85 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 99.78 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 99.77 | |
| KOG3235 | 193 | consensus Subunit of the major N alpha-acetyltrans | 99.76 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 99.75 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 99.75 | |
| KOG3234 | 173 | consensus Acetyltransferase, (GNAT) family [Genera | 99.75 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 99.75 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 99.74 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 99.74 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 99.74 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 99.74 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 99.73 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 99.73 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 99.71 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 99.71 | |
| PHA01807 | 153 | hypothetical protein | 99.7 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 99.67 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 99.67 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 99.66 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 99.66 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 99.66 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 99.65 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 99.63 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 99.62 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 99.62 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 99.61 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 99.6 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 99.59 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 99.59 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 99.57 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 99.57 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 99.57 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 99.56 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 99.55 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 99.55 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 99.55 | |
| KOG3396 | 150 | consensus Glucosamine-phosphate N-acetyltransferas | 99.51 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 99.5 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 99.5 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 99.49 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 99.49 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 99.48 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 99.47 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 99.45 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 99.45 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 99.43 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 99.43 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 99.38 | |
| KOG3138 | 187 | consensus Predicted N-acetyltransferase [General f | 99.37 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 99.23 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 99.2 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 99.18 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 99.08 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 99.03 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 98.98 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 98.96 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 98.91 | |
| KOG3397 | 225 | consensus Acetyltransferases [General function pre | 98.84 | |
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 98.7 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 98.64 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 98.62 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 98.52 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 98.49 | |
| KOG4144 | 190 | consensus Arylalkylamine N-acetyltransferase [Gene | 98.48 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 98.41 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 98.37 | |
| COG5628 | 143 | Predicted acetyltransferase [General function pred | 98.3 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 98.22 | |
| PF04958 | 342 | AstA: Arginine N-succinyltransferase beta subunit; | 98.14 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 98.14 | |
| PRK10456 | 344 | arginine succinyltransferase; Provisional | 98.0 | |
| KOG4135 | 185 | consensus Predicted phosphoglucosamine acetyltrans | 97.91 | |
| COG3818 | 167 | Predicted acetyltransferase, GNAT superfamily [Gen | 97.85 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 97.85 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 97.8 | |
| PF01233 | 162 | NMT: Myristoyl-CoA:protein N-myristoyltransferase, | 97.77 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 97.76 | |
| COG3375 | 266 | Uncharacterized conserved protein [Function unknow | 97.67 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 97.64 | |
| TIGR03244 | 336 | arg_catab_AstA arginine N-succinyltransferase. In | 97.54 | |
| TIGR03245 | 336 | arg_AOST_alph arginine/ornithine succinyltransfera | 97.52 | |
| TIGR03243 | 335 | arg_catab_AOST arginine and ornithine succinyltran | 97.47 | |
| PF06852 | 181 | DUF1248: Protein of unknown function (DUF1248); In | 97.43 | |
| PF05301 | 120 | Mec-17: Touch receptor neuron protein Mec-17; Inte | 97.42 | |
| PF13880 | 70 | Acetyltransf_13: ESCO1/2 acetyl-transferase | 97.33 | |
| TIGR03694 | 241 | exosort_acyl putative PEP-CTERM/exosortase system- | 96.91 | |
| cd04264 | 99 | DUF619-NAGS DUF619 domain of various N-acetylgluta | 96.89 | |
| PF09390 | 161 | DUF1999: Protein of unknown function (DUF1999); In | 96.88 | |
| PF04768 | 170 | DUF619: Protein of unknown function (DUF619); Inte | 96.85 | |
| PF00765 | 182 | Autoind_synth: Autoinducer synthetase; InterPro: I | 96.73 | |
| PRK13834 | 207 | putative autoinducer synthesis protein; Provisiona | 96.68 | |
| TIGR03019 | 330 | pepcterm_femAB FemAB-related protein, PEP-CTERM sy | 96.51 | |
| COG5630 | 495 | ARG2 Acetylglutamate synthase [Amino acid transpor | 96.48 | |
| cd04265 | 99 | DUF619-NAGS-U DUF619 domain of various N-acetylglu | 96.48 | |
| COG3138 | 336 | AstA Arginine/ornithine N-succinyltransferase beta | 96.41 | |
| PF01853 | 188 | MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i | 96.21 | |
| KOG3698 | 891 | consensus Hyaluronoglucosaminidase [Posttranslatio | 96.15 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 96.03 | |
| PF04377 | 128 | ATE_C: Arginine-tRNA-protein transferase, C termin | 95.89 | |
| PF09924 | 299 | DUF2156: Uncharacterized conserved protein (DUF215 | 95.86 | |
| PLN03238 | 290 | probable histone acetyltransferase MYST; Provision | 95.71 | |
| COG3916 | 209 | LasI N-acyl-L-homoserine lactone synthetase [Signa | 95.51 | |
| KOG4601 | 264 | consensus Uncharacterized conserved protein [Funct | 95.5 | |
| PTZ00064 | 552 | histone acetyltransferase; Provisional | 95.3 | |
| PLN03239 | 351 | histone acetyltransferase; Provisional | 95.08 | |
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 94.67 | |
| PF02799 | 190 | NMT_C: Myristoyl-CoA:protein N-myristoyltransferas | 94.65 | |
| PRK01305 | 240 | arginyl-tRNA-protein transferase; Provisional | 93.98 | |
| KOG2779 | 421 | consensus N-myristoyl transferase [Lipid transport | 93.45 | |
| KOG2747 | 396 | consensus Histone acetyltransferase (MYST family) | 93.41 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 93.0 | |
| KOG2696 | 403 | consensus Histone acetyltransferase type b catalyt | 92.97 | |
| COG1243 | 515 | ELP3 Histone acetyltransferase [Transcription / Ch | 92.28 | |
| KOG2036 | 1011 | consensus Predicted P-loop ATPase fused to an acet | 92.21 | |
| PF13444 | 101 | Acetyltransf_5: Acetyltransferase (GNAT) domain | 91.86 | |
| PF04339 | 370 | DUF482: Protein of unknown function, DUF482; Inter | 90.3 | |
| KOG2535 | 554 | consensus RNA polymerase II elongator complex, sub | 90.23 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 88.52 | |
| PHA00432 | 137 | internal virion protein A | 87.85 | |
| COG5027 | 395 | SAS2 Histone acetyltransferase (MYST family) [Chro | 87.82 | |
| PRK04531 | 398 | acetylglutamate kinase; Provisional | 87.61 | |
| PHA01733 | 153 | hypothetical protein | 85.96 | |
| cd04266 | 108 | DUF619-NAGS-FABP DUF619 domain of N-acetylglutamat | 84.87 | |
| PRK02983 | 1094 | lysS lysyl-tRNA synthetase; Provisional | 84.87 | |
| COG2935 | 253 | Putative arginyl-tRNA:protein arginylyltransferase | 84.85 | |
| COG5653 | 406 | Protein involved in cellulose biosynthesis (CelD) | 83.72 | |
| KOG3014 | 257 | consensus Protein involved in establishing cohesio | 83.61 | |
| KOG2779 | 421 | consensus N-myristoyl transferase [Lipid transport | 83.04 | |
| COG5092 | 451 | NMT1 N-myristoyl transferase [Lipid metabolism] | 80.79 |
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
Probab=99.85 E-value=2.4e-20 Score=127.28 Aligned_cols=123 Identities=15% Similarity=0.166 Sum_probs=97.2
Q ss_pred ceeEEEEcccccHHHHHHHHhhhcCCCcchHH----HHHHhccCCCeEEEEEcCCCeEEEEEEEEEecC--CCceeEEEe
Q 031082 42 KMTTIRRFCCNDLLRFTSVNLDHLTETFNMSF----YMTYLARWPDYFHVAEGPGNRIMGYIMGKVEGQ--GESWHGHVT 115 (166)
Q Consensus 42 ~~~~ir~~~~~D~~~i~~l~~~~~~~~~~~~~----~~~~~~~~~~~~~v~~~~~~~ivG~~~~~~~~~--~~~~~~~i~ 115 (166)
+++.||+++++|++.+.++........+.... +.+.+..+...++++. .++++||++.+..... ...+.++|.
T Consensus 2 ~~~~ir~a~~~D~~~l~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~v~~-~~~~ivG~~~~~~~~~~~~~~~~~~i~ 80 (144)
T PRK10146 2 PACELRPATQYDTDAVYALICELKQAEFDHQAFRVGFNANLRDPNMRYHLAL-LDGEVVGMIGLHLQFHLHHVNWIGEIQ 80 (144)
T ss_pred CccEEeeCcHhhHHHHHHHHHHHhcccCCHHHHHHHHHHHhcCCCceEEEEE-ECCEEEEEEEEEecccccccchhheeh
Confidence 35789999999999999998766554444222 3334444445567777 4899999997754321 222346789
Q ss_pred EEEeCcchhcccHHHHHHHHHHHHHHhhcCcEEEEEEeecCChhhhhcccC
Q 031082 116 AVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIKISDM 166 (166)
Q Consensus 116 ~l~V~p~~rg~Gig~~Ll~~~~~~a~~~~g~~~i~l~v~~~N~~a~~~Y~k 166 (166)
.++|+|+|||+|+|+.|++.+++.+++ .|+..+.|++...|.+|++||+|
T Consensus 81 ~l~v~p~~rg~GiG~~Ll~~~~~~a~~-~~~~~i~l~~~~~n~~a~~fY~~ 130 (144)
T PRK10146 81 ELVVMPQARGLNVGSKLLAWAEEEARQ-AGAEMTELSTNVKRHDAHRFYLR 130 (144)
T ss_pred eeEECHHHcCCCHHHHHHHHHHHHHHH-cCCcEEEEecCCCchHHHHHHHH
Confidence 999999999999999999999999999 99999999999999999999985
|
|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3397 consensus Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5628 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >PRK10456 arginine succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3375 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03244 arg_catab_AstA arginine N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits | Back alignment and domain information |
|---|
| >PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch | Back alignment and domain information |
|---|
| >PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase | Back alignment and domain information |
|---|
| >TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase | Back alignment and domain information |
|---|
| >cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish | Back alignment and domain information |
|---|
| >PF09390 DUF1999: Protein of unknown function (DUF1999); InterPro: IPR018987 This family contains a putative Fe-S binding reductase (Q72J89 from SWISSPROT) whose structure adopts an alpha and beta fold | Back alignment and domain information |
|---|
| >PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 | Back alignment and domain information |
|---|
| >PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth | Back alignment and domain information |
|---|
| >PRK13834 putative autoinducer synthesis protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated | Back alignment and domain information |
|---|
| >COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish | Back alignment and domain information |
|---|
| >COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus | Back alignment and domain information |
|---|
| >KOG3698 consensus Hyaluronoglucosaminidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein | Back alignment and domain information |
|---|
| >PF09924 DUF2156: Uncharacterized conserved protein (DUF2156); InterPro: IPR024320 This domain of unknown function is found in uncharacterised proteins and in Lysylphosphatidylglycerol synthetase, which catalyses the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol [] | Back alignment and domain information |
|---|
| >PLN03238 probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG4601 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00064 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03239 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >PRK01305 arginyl-tRNA-protein transferase; Provisional | Back alignment and domain information |
|---|
| >KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2747 consensus Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2696 consensus Histone acetyltransferase type b catalytic subunit [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >PF04339 DUF482: Protein of unknown function, DUF482; InterPro: IPR007434 This family contains several proteins of uncharacterised function | Back alignment and domain information |
|---|
| >KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA00432 internal virion protein A | Back alignment and domain information |
|---|
| >COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK04531 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA01733 hypothetical protein | Back alignment and domain information |
|---|
| >cd04266 DUF619-NAGS-FABP DUF619 domain of N-acetylglutamate Synthase of the fungal arginine-biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK02983 lysS lysyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG2935 Putative arginyl-tRNA:protein arginylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5653 Protein involved in cellulose biosynthesis (CelD) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG3014 consensus Protein involved in establishing cohesion between sister chromatids during DNA replication [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5092 NMT1 N-myristoyl transferase [Lipid metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 166 | ||||
| 2x7b_A | 168 | Crystal Structure Of The N-Terminal Acetylase Ard1 | 3e-05 |
| >pdb|2X7B|A Chain A, Crystal Structure Of The N-Terminal Acetylase Ard1 From Sulfolobus Solfataricus P2 Length = 168 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 166 | |||
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 1e-44 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 1e-36 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 4e-15 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 7e-15 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 1e-14 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 2e-13 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 6e-13 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 9e-13 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 2e-12 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 1e-11 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 8e-11 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 8e-11 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 1e-10 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 2e-10 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 2e-10 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 2e-10 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 4e-10 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 4e-10 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 7e-10 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 1e-09 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 1e-09 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 3e-09 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 5e-09 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 8e-09 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 1e-08 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 1e-08 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 6e-08 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 6e-08 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 9e-08 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 2e-07 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 2e-07 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 2e-07 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 3e-07 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 3e-07 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 4e-07 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 6e-07 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 8e-07 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 1e-06 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 2e-06 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 2e-06 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 4e-06 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 5e-06 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 1e-05 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 1e-05 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 1e-05 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 1e-05 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 2e-05 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 2e-05 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 3e-05 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 3e-05 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 3e-05 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 3e-05 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 3e-05 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 4e-05 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 6e-05 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 7e-05 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 8e-05 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 1e-04 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 1e-04 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 1e-04 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 2e-04 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 2e-04 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 2e-04 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 3e-04 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 4e-04 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 4e-04 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 6e-04 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 9e-04 |
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Length = 168 | Back alignment and structure |
|---|
Score = 144 bits (364), Expect = 1e-44
Identities = 36/126 (28%), Positives = 57/126 (45%), Gaps = 9/126 (7%)
Query: 45 TIRRFCCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRIMGYIMGKVE 104
T+R +D+ + +N L E + F++ +L + F VA N ++GYIM ++E
Sbjct: 14 TLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAI-VDNSVVGYIMPRIE 72
Query: 105 GQGES--------WHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRAS 156
+ GHV ++ V EYRR+ +A L+ A + L VR S
Sbjct: 73 WGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVS 132
Query: 157 NTPAIK 162
N PAI
Sbjct: 133 NYPAIA 138
|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Length = 170 | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 159 | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187 | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160 | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166 | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228 | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143 | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182 | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149 | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184 | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312 | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189 | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Length = 160 | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165 | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165 | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166 | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207 | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Length = 180 | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166 | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Length = 318 | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197 | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Length = 224 | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176 | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Length = 174 | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Length = 183 | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169 | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 162 | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181 | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199 | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Length = 153 | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170 | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Length = 177 | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133 | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288 | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} Length = 163 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 149 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Length = 422 | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} Length = 428 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 99.89 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 99.88 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 99.87 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 99.87 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 99.87 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 99.86 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 99.86 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 99.85 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 99.85 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 99.85 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 99.84 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 99.83 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 99.83 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 99.83 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 99.83 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 99.83 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 99.83 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 99.82 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 99.82 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 99.82 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 99.82 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 99.82 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 99.82 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 99.82 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 99.82 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 99.82 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 99.81 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 99.81 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 99.81 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 99.81 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 99.81 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 99.81 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 99.81 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 99.81 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 99.81 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 99.81 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 99.81 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 99.8 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 99.8 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 99.8 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 99.8 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 99.8 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 99.8 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 99.8 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 99.8 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 99.8 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 99.79 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 99.79 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 99.79 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 99.79 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 99.79 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 99.79 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 99.79 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 99.79 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 99.79 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 99.79 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 99.78 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 99.78 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 99.78 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 99.78 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 99.78 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 99.78 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 99.78 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 99.78 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 99.78 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 99.78 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 99.78 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 99.77 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 99.77 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 99.77 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 99.77 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 99.76 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 99.76 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 99.76 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 99.75 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 99.75 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 99.75 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 99.75 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 99.75 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 99.74 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 99.74 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 99.74 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 99.74 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 99.74 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 99.74 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 99.74 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 99.74 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 99.73 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 99.73 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 99.73 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 99.73 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 99.73 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 99.73 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 99.73 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 99.73 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 99.73 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 99.73 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 99.72 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 99.72 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 99.72 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 99.72 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 99.72 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 99.72 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 99.71 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 99.71 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 99.71 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 99.71 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 99.7 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 99.7 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 99.69 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 99.69 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 99.69 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 99.69 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 99.69 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 99.69 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 99.68 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 99.67 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 99.67 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 99.67 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 99.67 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 99.66 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 99.65 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 99.65 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 99.65 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 99.65 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 99.64 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 99.64 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 99.64 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 99.63 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 99.63 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 99.62 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 99.62 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 99.62 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 99.62 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 99.61 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 99.61 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 99.61 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 99.6 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 99.6 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 99.6 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 99.57 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 99.57 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 99.57 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 99.53 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.53 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 99.53 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 99.52 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 99.49 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 99.46 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 99.44 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 99.43 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 99.37 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 99.19 | |
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 99.17 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 99.0 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 98.87 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 98.85 | |
| 1yle_A | 342 | Arginine N-succinyltransferase, alpha chain; struc | 98.83 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 98.66 | |
| 3dns_A | 135 | Ribosomal-protein-alanine acetyltransferase; N-ter | 98.51 | |
| 1kzf_A | 230 | Acyl-homoserinelactone synthase ESAI; alpha-beta, | 98.46 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 97.78 | |
| 4hkf_A | 191 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 97.59 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 97.58 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 97.53 | |
| 4b5o_A | 200 | Alpha-tubulin N-acetyltransferase; microtubules, c | 97.27 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 97.24 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 97.22 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 97.2 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 97.12 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 97.09 | |
| 4h6u_A | 200 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 97.09 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 97.07 | |
| 4gs4_A | 240 | Alpha-tubulin N-acetyltransferase; acetyl coenzyme | 97.02 | |
| 3gkr_A | 336 | FEMX; FEMX, peptidoglycan, hexapeptide, transferas | 96.83 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 96.71 | |
| 1rxt_A | 496 | Myristoyl-, glycylpeptide N-tetradecanoyltransfera | 96.45 | |
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 96.21 | |
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 96.02 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 96.0 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 95.86 | |
| 4ab7_A | 464 | Protein Arg5,6, mitochondrial; transferase, argini | 95.74 | |
| 1lrz_A | 426 | FEMA, factor essential for expression of methicill | 95.05 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 94.93 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 94.14 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 94.1 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 93.08 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 92.91 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 88.97 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 87.2 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 84.86 | |
| 2hqy_A | 305 | Conserved hypothetical protein; PSI2, MAD, structu | 83.67 | |
| 3gkr_A | 336 | FEMX; FEMX, peptidoglycan, hexapeptide, transferas | 80.85 | |
| 1rxt_A | 496 | Myristoyl-, glycylpeptide N-tetradecanoyltransfera | 80.48 |
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
Probab=99.89 E-value=1.1e-22 Score=140.81 Aligned_cols=124 Identities=30% Similarity=0.385 Sum_probs=102.7
Q ss_pred CceeEEEEcccccHHHHHHHHhhhcCCCcchHHHHHHhccCCCeEEEEEcCCCeEEEEEEEEEecCC--------CceeE
Q 031082 41 RKMTTIRRFCCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRIMGYIMGKVEGQG--------ESWHG 112 (166)
Q Consensus 41 ~~~~~ir~~~~~D~~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~ivG~~~~~~~~~~--------~~~~~ 112 (166)
..++.||+++++|++.+.++....++..++...+...+...+..++++. .+|++||++.+...... ....+
T Consensus 10 ~~~~~iR~~~~~D~~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~va~-~~~~ivG~~~~~~~~~~~~~~~~~~~~~~~ 88 (168)
T 2x7b_A 10 GRDFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAI-VDNSVVGYIMPRIEWGFSNIKQLPSLVRKG 88 (168)
T ss_dssp --CCEEEECCGGGHHHHHHHHHHHCSCCCCHHHHHHHHHHHGGGCEEEE-ETTEEEEEEEEEEEEEECSSCSSCCEEEEE
T ss_pred CccEEEEeCCHHHHHHHHHHHHHHCCCCccHHHHHHHHhcCCceEEEEE-ECCeEEEEEEEEEeccccccccccCCCcEE
Confidence 3457899999999999999998888888877766666654445567777 48999999976643221 12247
Q ss_pred EEeEEEeCcchhcccHHHHHHHHHHHHHHhhc-CcEEEEEEeecCChhhhhcccC
Q 031082 113 HVTAVTVSPEYRRQQLAKKLMNLLEDISDKID-KAYFVDLFVRASNTPAIKISDM 166 (166)
Q Consensus 113 ~i~~l~V~p~~rg~Gig~~Ll~~~~~~a~~~~-g~~~i~l~v~~~N~~a~~~Y~k 166 (166)
+|..++|+|+|||+|||++|++.+++++++ . |+..++|.|...|.+|++||+|
T Consensus 89 ~i~~l~V~p~~rg~GiG~~Ll~~~~~~a~~-~~g~~~i~l~v~~~N~~A~~~Yek 142 (168)
T 2x7b_A 89 HVVSIAVLEEYRRKGIATTLLEASMKSMKN-DYNAEEIYLEVRVSNYPAIALYEK 142 (168)
T ss_dssp EEEEEEECGGGTTSSHHHHHHHHHHHHHHH-TTCCSEEEEEEETTCHHHHHHHHH
T ss_pred EEEEEEECHHHhccCHHHHHHHHHHHHHHH-hcCeeEEEEEEEeCCHHHHHHHHH
Confidence 889999999999999999999999999999 7 9999999999999999999985
|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* | Back alignment and structure |
|---|
| >4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* | Back alignment and structure |
|---|
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* | Back alignment and structure |
|---|
| >4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* | Back alignment and structure |
|---|
| >1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4 | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2hqy_A Conserved hypothetical protein; PSI2, MAD, structural G protein structure initiative, midwest center for structural genomics; HET: COA; 1.80A {Bacteroides thetaiotaomicron} SCOP: d.108.1.4 d.108.1.4 | Back alignment and structure |
|---|
| >3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A | Back alignment and structure |
|---|
| >1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 166 | ||||
| d1sqha_ | 297 | d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr | 2e-07 | |
| d1p0ha_ | 308 | d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter | 3e-06 | |
| d1z4ea1 | 150 | d.108.1.1 (A:4-153) Transcriptional regulator BH19 | 3e-05 | |
| d1bo4a_ | 137 | d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferas | 1e-04 | |
| d1s3za_ | 147 | d.108.1.1 (A:) Aminoglycoside N-acetyltransferase | 1e-04 | |
| d1m4ia_ | 181 | d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransfera | 0.001 | |
| d1n71a_ | 180 | d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera | 0.002 |
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: Hypothetical protein cg14615-pa domain: Hypothetical protein cg14615-pa species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Score = 46.9 bits (111), Expect = 2e-07
Identities = 9/90 (10%), Positives = 28/90 (31%), Gaps = 9/90 (10%)
Query: 73 FYMTYLARWPDYFHVAEGPGNRIMGYIMGKVEGQGESWHGHVTAVTVSPEYRRQQLAKKL 132
+ + G ++ +I ++ + + V P+ R+ L L
Sbjct: 195 YLQALVRFNKSLGICRSDTG-ELIAWIF-------QNDFSGLGMLQVLPKAERRGLGGLL 246
Query: 133 MNLLEDISDKIDKAYFVDLFVRASNTPAIK 162
+ + + + ++ A+N +
Sbjct: 247 AAAMSREIAR-GEEITLTAWIVATNWRSEA 275
|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308 | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Length = 150 | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Length = 137 | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Length = 147 | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 99.88 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 99.86 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 99.85 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 99.85 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 99.84 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 99.84 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 99.83 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 99.83 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 99.83 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 99.82 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 99.82 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 99.82 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 99.82 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 99.82 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 99.81 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 99.81 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 99.8 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 99.8 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 99.8 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 99.79 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 99.79 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 99.79 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 99.78 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 99.78 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 99.78 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 99.77 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 99.77 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.77 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 99.76 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 99.75 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 99.75 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 99.75 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 99.75 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 99.74 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 99.74 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 99.72 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 99.71 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 99.7 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 99.67 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 99.67 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 99.67 | |
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.66 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 99.64 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 99.61 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 99.59 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 99.58 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 99.57 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 99.56 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 99.56 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 99.55 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 99.54 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 99.51 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 99.46 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 99.42 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 99.41 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 99.3 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 98.86 | |
| d1ylea1 | 338 | Arginine N-succinyltransferase, alpha chain, AstA | 98.32 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 98.26 | |
| d1lrza3 | 182 | Methicillin resistance protein FemA {Staphylococcu | 98.04 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 98.0 | |
| d1iyka1 | 165 | N-myristoyl transferase, NMT {Yeast (Candida albic | 97.95 | |
| d1iica1 | 185 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 97.86 | |
| d1rxta1 | 141 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 97.81 | |
| d1kzfa_ | 210 | Acyl-homoserinelactone synthase EsaI {Pantoea stew | 97.72 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 97.49 | |
| d2d4pa1 | 130 | Hypothetical protein TTHA1254 {Thermus thermophilu | 97.49 | |
| d1ne9a2 | 171 | Peptidyltransferase FemX {Weissella viridescens [T | 97.27 | |
| d1iyka2 | 227 | N-myristoyl transferase, NMT {Yeast (Candida albic | 96.35 | |
| d2ozua1 | 270 | Histone acetyltransferase MYST3 {Human (Homo sapie | 96.32 | |
| d2giva1 | 271 | Probable histone acetyltransferase MYST1 {Human (H | 96.24 | |
| d1fy7a_ | 273 | Histone acetyltransferase ESA1 {Baker's yeast (Sac | 95.65 | |
| d1iica2 | 237 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 95.31 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 91.99 | |
| d2hqya1 | 164 | Hypothetical protein BT3689 {Bacteroides thetaiota | 89.28 | |
| d1lrza2 | 165 | Methicillin resistance protein FemA {Staphylococcu | 86.43 | |
| d1rxta2 | 201 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 85.53 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 80.72 |
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Aminoglycoside N-acetyltransferase AAC(6')-IY species: Salmonella enteritidis [TaxId: 149539]
Probab=99.88 E-value=1.2e-21 Score=131.39 Aligned_cols=122 Identities=13% Similarity=0.080 Sum_probs=100.8
Q ss_pred eeEEEEcccccHHHHHHHHhhhcCCCcchH---HHHHHhccCCCeEEEEEcCCCeEEEEEEEEEecC-----CCceeEEE
Q 031082 43 MTTIRRFCCNDLLRFTSVNLDHLTETFNMS---FYMTYLARWPDYFHVAEGPGNRIMGYIMGKVEGQ-----GESWHGHV 114 (166)
Q Consensus 43 ~~~ir~~~~~D~~~i~~l~~~~~~~~~~~~---~~~~~~~~~~~~~~v~~~~~~~ivG~~~~~~~~~-----~~~~~~~i 114 (166)
+|.||+++.+|++++.++....++...... .+...+..+....+++. .+|++||++.+..... .....++|
T Consensus 2 ~m~Ir~~~~~d~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~va~-~~~~~vG~~~~~~~~~~~~~~~~~~~~~i 80 (147)
T d1s3za_ 2 HMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAM-ADGVAIGFADASIRHDYVNGCDSSPVVFL 80 (147)
T ss_dssp CEEEEECCGGGHHHHHHHHHHHSTTSCHHHHHHHHHHHHHCSSEEEEEEE-ETTEEEEEEEEEEECSCCTTCSSSSEEEE
T ss_pred ceEEEECCHHHHHHHHHHHHHHCCCCCcHHHHHHHHHHhhCCCcEEEEEE-ECCEEEEEEEEEeecCcccccCCCCeEEE
Confidence 478999999999999999999887654332 23444455555677777 5999999997765432 22345889
Q ss_pred eEEEeCcchhcccHHHHHHHHHHHHHHhhcCcEEEEEEeecCChhhhhcccC
Q 031082 115 TAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIKISDM 166 (166)
Q Consensus 115 ~~l~V~p~~rg~Gig~~Ll~~~~~~a~~~~g~~~i~l~v~~~N~~a~~~Y~k 166 (166)
..++|+|+|||+|||++|++.+++++++ .|+..+.+.|.++|++|++||+|
T Consensus 81 ~~l~V~~~~rg~Gig~~Ll~~~~~~a~~-~g~~~i~l~~~~~N~~a~~fY~k 131 (147)
T d1s3za_ 81 EGIFVLPSFRQRGVAKQLIAAVQRWGTN-KGCREMASDTSPENTISQKVHQA 131 (147)
T ss_dssp EEEEECGGGCSSSHHHHHHHHHHHHHHH-TTCSEEEEEECTTCHHHHHHHHH
T ss_pred EEEEECHHHcCCcHHHHHHHHHHHHhhh-ccccceEEEEcCCCHHHHHHHHH
Confidence 9999999999999999999999999999 99999999999999999999985
|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} | Back information, alignment and structure |
|---|
| >d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2hqya1 d.108.1.4 (A:135-298) Hypothetical protein BT3689 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1lrza2 d.108.1.4 (A:1-165) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1rxta2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|