Citrus Sinensis ID: 031117


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MATSLNFSANQVSTQPPELCLRRSSFKSKLSSPRRPKFVSFAVNSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGGH
cccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccEEEEEEEccccccccccccEEEEEEcccHHHHHHHHHcccccccccccEEEcccccEEEEEEEEccccEEEEEEEEEccccccccEEEEEEcHHHHHHHHHHHHccccc
cccEEEcccHHccccccHHHcccccccccccccccccEEEEEcccccccccccccccEEEEEEcccccccccccccHEEcccHHHHHHHHHHHcccEEEcccccEEEccccccccEEEEEcccccEEEEEEEEcccccccEEEEEcccHHHHHHHHHHHHccccc
matslnfsanqvstqppelclrrssfksklssprrpkfvsfavnstepsspepekpeielefiapragddgsypvERAKAISGEKLLRNIMLDNKIELYATYGkvmncggggscgtcivekpeswRLACQTIVgnkensgkcrikYLKVEALCSLYRAVGYLGGH
matslnfsanqvstqppelclrrssfksklssprrpkfvsfavnstepsspepekpeIELEFIApragddgsyPVERAKAisgekllrNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEKPESWRLACQTivgnkensgkcrikYLKVEALCSLYRAVGYLGGH
MATSLNFSANQVSTQPPELClrrssfksklssprrpkfVSFAVNstepsspepekpeieleFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGGH
******************************************************************************KAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYL***
************************************************************EFIAPRA****SYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLG**
*****************ELCLRRSS**********PKFVSFA**************EIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGGH
***********V**********************RPKF****VN*******EPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSLNFSANQVSTQPPELCLRRSSFKSKLSSPRRPKFVSFAVNSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
356563826161 PREDICTED: uncharacterized protein LOC10 0.660 0.677 0.651 5e-39
225430081172 PREDICTED: uncharacterized protein LOC10 0.860 0.825 0.586 4e-35
296081922137 unnamed protein product [Vitis vinifera] 0.660 0.795 0.661 1e-31
449441962176 PREDICTED: uncharacterized protein LOC10 0.848 0.795 0.554 9e-31
449441964158 PREDICTED: uncharacterized protein LOC10 0.848 0.886 0.522 1e-28
255551138171 electron carrier, putative [Ricinus comm 0.860 0.830 0.538 6e-27
224092396178 predicted protein [Populus trichocarpa] 0.684 0.634 0.604 5e-26
242091313185 hypothetical protein SORBIDRAFT_09g02789 0.666 0.594 0.569 2e-25
326523007182 predicted protein [Hordeum vulgare subsp 0.551 0.5 0.616 7e-25
297802756175 hypothetical protein ARALYDRAFT_913185 [ 0.606 0.571 0.616 1e-24
>gi|356563826|ref|XP_003550159.1| PREDICTED: uncharacterized protein LOC100807125 [Glycine max] Back     alignment and taxonomy information
 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 95/135 (70%), Gaps = 26/135 (19%)

Query: 34  RRPKFVSFAVNSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLD 93
           R+P  V FA  S+ P SP    PEIELEFI P+ G DGSYPVER KAISGEKLLRNIMLD
Sbjct: 27  RQPNTVIFAAASS-PESP----PEIELEFIGPKPGSDGSYPVERVKAISGEKLLRNIMLD 81

Query: 94  NKIELYATYGKVMNCGGGGSCGTCIVE---------------------KPESWRLACQTI 132
           NKIELYATYGK+MNC GGGSCGTCIVE                     KPESWRLACQTI
Sbjct: 82  NKIELYATYGKLMNCAGGGSCGTCIVEIIEGKDLLNERTNTELRYLSKKPESWRLACQTI 141

Query: 133 VGNKENSGKCRIKYL 147
           VGNKENSGK  ++ +
Sbjct: 142 VGNKENSGKVAVQRI 156




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225430081|ref|XP_002281853.1| PREDICTED: uncharacterized protein LOC100250753 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081922|emb|CBI20927.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441962|ref|XP_004138751.1| PREDICTED: uncharacterized protein LOC101202753 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441964|ref|XP_004138752.1| PREDICTED: uncharacterized protein LOC101202753 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255551138|ref|XP_002516617.1| electron carrier, putative [Ricinus communis] gi|223544437|gb|EEF45958.1| electron carrier, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224092396|ref|XP_002309590.1| predicted protein [Populus trichocarpa] gi|222855566|gb|EEE93113.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|242091313|ref|XP_002441489.1| hypothetical protein SORBIDRAFT_09g027890 [Sorghum bicolor] gi|241946774|gb|EES19919.1| hypothetical protein SORBIDRAFT_09g027890 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|326523007|dbj|BAJ88549.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|297802756|ref|XP_002869262.1| hypothetical protein ARALYDRAFT_913185 [Arabidopsis lyrata subsp. lyrata] gi|297315098|gb|EFH45521.1| hypothetical protein ARALYDRAFT_913185 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
TAIR|locus:2125637180 AT4G32590 [Arabidopsis thalian 0.357 0.327 0.796 1.5e-33
TAIR|locus:2094882204 PnsB3 "Photosynthetic NDH subc 0.303 0.245 0.519 2.2e-15
TAIR|locus:2125637 AT4G32590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 265 (98.3 bits), Expect = 1.5e-33, Sum P(2) = 1.5e-33
 Identities = 47/59 (79%), Positives = 53/59 (89%)

Query:    62 FIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVE 120
             F  P+ G DGSYPV++AKA+SG+KLLR+IM DNKIELYA YGKVMNCGGGGSCGTCIVE
Sbjct:    62 FFGPKPGSDGSYPVDKAKAVSGDKLLRSIMQDNKIELYAAYGKVMNCGGGGSCGTCIVE 120


GO:0009055 "electron carrier activity" evidence=IEA;ISS
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0009688 "abscisic acid biosynthetic process" evidence=RCA
TAIR|locus:2094882 PnsB3 "Photosynthetic NDH subcomplex B 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0013034101
hypothetical protein (178 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
PRK05464 409 PRK05464, PRK05464, Na(+)-translocating NADH-quino 6e-05
COG2871 410 COG2871, NqrF, Na+-transporting NADH:ubiquinone ox 7e-04
TIGR01941 405 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, N 9e-04
>gnl|CDD|235481 PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
 Score = 41.8 bits (99), Expect = 6e-05
 Identities = 25/72 (34%), Positives = 29/72 (40%), Gaps = 27/72 (37%)

Query: 82  SGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIV--------------------EK 121
           +G KLL   +  N I L +       CGGGGSCG C V                    E 
Sbjct: 52  AGGKLL-GALASNGIFLSSA------CGGGGSCGQCRVKVKEGGGDILPTELSHISKREA 104

Query: 122 PESWRLACQTIV 133
            E WRL+CQ  V
Sbjct: 105 KEGWRLSCQVKV 116


Length = 409

>gnl|CDD|225426 COG2871, NqrF, Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130996 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 165
PLN02593117 adrenodoxin-like ferredoxin protein 99.74
PTZ00490143 Ferredoxin superfamily; Provisional 99.73
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.69
KOG3309159 consensus Ferredoxin [Energy production and conver 99.62
CHL0013499 petF ferredoxin; Validated 99.61
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.6
PTZ00038191 ferredoxin; Provisional 99.56
PLN03136148 Ferredoxin; Provisional 99.56
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.53
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.5
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.44
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.43
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.42
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.41
PRK05713 312 hypothetical protein; Provisional 99.38
COG3894 614 Uncharacterized metal-binding protein [General fun 99.36
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.33
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.32
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 99.24
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.22
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.22
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 99.16
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.1
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 99.08
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 99.02
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 98.93
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 98.91
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 98.91
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 98.9
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 98.88
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 98.86
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 98.85
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.83
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 98.79
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 98.77
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 98.74
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 98.67
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.25
PRK12814 652 putative NADPH-dependent glutamate synthase small 98.12
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 98.09
PRK07860 797 NADH dehydrogenase subunit G; Validated 97.85
PRK08493 819 NADH dehydrogenase subunit G; Validated 97.85
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 97.68
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 97.64
PRK09130 687 NADH dehydrogenase subunit G; Validated 97.61
PRK09129 776 NADH dehydrogenase subunit G; Validated 97.59
KOG3049 288 consensus Succinate dehydrogenase, Fe-S protein su 97.53
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.44
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 97.34
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 97.07
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 97.06
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 96.69
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 96.53
PRK09800 956 putative hypoxanthine oxidase; Provisional 96.34
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 96.33
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 96.24
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 96.13
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 96.07
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron 95.42
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 95.27
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 95.15
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 95.12
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 94.87
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 94.73
PRK05802320 hypothetical protein; Provisional 94.7
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 94.41
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 93.72
TIGR02911261 sulfite_red_B sulfite reductase, subunit B. Member 93.39
PF1041840 DHODB_Fe-S_bind: Iron-sulfur cluster binding domai 92.52
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase 92.42
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 92.17
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 91.65
PRK08221263 anaerobic sulfite reductase subunit B; Provisional 90.68
PLN00192 1344 aldehyde oxidase 88.29
PRK12779944 putative bifunctional glutamate synthase subunit b 86.36
KOG2282 708 consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 86.28
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
Probab=99.74  E-value=8.4e-18  Score=128.00  Aligned_cols=78  Identities=35%  Similarity=0.526  Sum_probs=65.0

Q ss_pred             EEEEEecCCCCCCCCCCeEEEEecCChHHHHHHHHhCCCCccccCcccccCCCceeecccEEE-----------------
Q 031117           58 IELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVE-----------------  120 (165)
Q Consensus        58 i~v~f~~p~~~~DG~~~~~~v~v~~G~tLLRdall~~gi~l~~~~~~~~~CgG~G~CGTC~V~-----------------  120 (165)
                      |+|+|++    +||.  .+++++..|++|| ++++++|+++++      .|||.|.||||+|+                 
T Consensus         1 ~~V~fi~----~~G~--~~~v~~~~G~tLl-~a~~~~gi~i~~------~CgG~g~C~tC~V~V~~~~~~~~l~~~~~~E   67 (117)
T PLN02593          1 ISVTFVD----KDGE--ERTVKAPVGMSLL-EAAHENDIELEG------ACEGSLACSTCHVIVMDEKVYNKLPEPTDEE   67 (117)
T ss_pred             CEEEEEc----CCCC--EEEEEECCCCcHH-HHHHHcCCCCCc------cCCCcceeCCCEEEEecCccccCCCCCChHH
Confidence            5788887    5665  3789999999999 999999999999      79999999999998                 


Q ss_pred             ---------cCCCeEEeeeceeccccCCcceEEEEcCch
Q 031117          121 ---------KPESWRLACQTIVGNKENSGKCRIKYLKVE  150 (165)
Q Consensus       121 ---------~~~g~RLACQ~~v~~~~~~gDvtVe~~p~~  150 (165)
                               ..++||||||+.+. .+ .++++|++++..
T Consensus        68 ~~~L~~~~~~~~~sRLaCQ~~v~-~~-~~~~~v~ip~~~  104 (117)
T PLN02593         68 NDMLDLAFGLTETSRLGCQVIAK-PE-LDGMRLALPAAT  104 (117)
T ss_pred             HHHHhcccCCCCCeEecceeEee-cC-CCCEEEEcCchh
Confidence                     24689999999996 22 268999877664



>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B Back     alignment and domain information
>PF10418 DHODB_Fe-S_bind: Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B; InterPro: IPR019480 Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases (DHODs) A and B [] Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>PRK08221 anaerobic sulfite reductase subunit B; Provisional Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 40.2 bits (93), Expect = 1e-04
 Identities = 31/168 (18%), Positives = 47/168 (27%), Gaps = 42/168 (25%)

Query: 15  QPPELCLRRSSFKSKLSSPRR--PKFVSFAVNS-----TEPSSPEPEKPEIELE-FIAPR 66
               +      F + LS       KFV   +         P   E  +P +    +I  R
Sbjct: 57  SKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQR 116

Query: 67  --AGDDGS----YPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVE 120
               +D      Y V R +       LR  +L+ +         V+  G  G  G     
Sbjct: 117 DRLYNDNQVFAKYNVSRLQPY---LKLRQALLELRPAKN-----VLIDGVLG-SG----- 162

Query: 121 KPESWRLACQTIVGNKE-----------NSGKCRIKYLKVEALCSLYR 157
           K  +W +A    +  K            N   C      +E L  L  
Sbjct: 163 K--TW-VALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLY 207


>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.76
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.75
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.75
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.75
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.73
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.72
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.69
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.68
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.68
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.66
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.65
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.62
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.61
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.61
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.61
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.61
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.6
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.58
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.56
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.55
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.45
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.44
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.44
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.3
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 98.99
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 98.99
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 98.92
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 98.83
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 98.83
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 98.42
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 98.36
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.36
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 98.13
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 98.11
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 98.07
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 98.01
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 97.1
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 96.99
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 96.88
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 95.94
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 95.86
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 94.85
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); het 94.07
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 93.69
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 83.7
3u7z_A101 Putative metal binding protein rumgna_00854; the b 80.59
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
Probab=99.76  E-value=1.5e-18  Score=126.94  Aligned_cols=77  Identities=26%  Similarity=0.547  Sum_probs=61.1

Q ss_pred             CCCCcEEEEEecCCCCCCCCCCeEEEEecCChHHHHHHHHhCCCCcc--ccCcccccCCCceeecccEEE----------
Q 031117           53 PEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELY--ATYGKVMNCGGGGSCGTCIVE----------  120 (165)
Q Consensus        53 ~~~p~i~v~f~~p~~~~DG~~~~~~v~v~~G~tLLRdall~~gi~l~--~~~~~~~~CgG~G~CGTC~V~----------  120 (165)
                      ..|  ++|+|.+    +||.  .++|++.+|+||| ++|+++||+++  +      +|+|.|.||||+|+          
T Consensus         4 ~~m--~~V~~~~----~~g~--~~~v~~~~g~tLL-~aa~~~gi~i~~~~------~Cgg~G~CgtC~v~v~~g~~~~l~   68 (108)
T 2bt6_A            4 GDK--ITVHFIN----RDGE--TLTTKGKIGDSLL-DVVVQNNLDIDGFG------ACEGTLACSTCHLIFEQHIFEKLE   68 (108)
T ss_dssp             -CE--EEEEEEC----TTSC--EEEEEEETTCBHH-HHHHHTTCCCTTTT------TTSSSSSBSTTEEECCHHHHTTSC
T ss_pred             Cce--EEEEEEC----CCCC--EEEEEECCCChHH-HHHHHcCCCCCccc------CCCCCcCcCCCEEEECccccccCC
Confidence            445  5566664    4564  3789999999999 99999999999  8      79999999999998          


Q ss_pred             ---------------cCCCeEEeeeceeccccCCcceEEEE
Q 031117          121 ---------------KPESWRLACQTIVGNKENSGKCRIKY  146 (165)
Q Consensus       121 ---------------~~~g~RLACQ~~v~~~~~~gDvtVe~  146 (165)
                                     +.+|||||||+++.. + ..+++|++
T Consensus        69 ~~~~~E~~~L~~~~~~~~g~rLaCq~~~~~-d-~d~~~V~~  107 (108)
T 2bt6_A           69 AITDEENDMLDLAYGLTDRSRLGCQICLTK-A-MDNMTVRV  107 (108)
T ss_dssp             CCCHHHHHHHTTCTTCCTTEEEGGGCBCCG-G-GTTEEEEC
T ss_pred             CCCHHHHHHHhCcccCCCCcEeeEEEEecC-C-CCCEEEEc
Confidence                           346899999999961 1 12688875



>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.78
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.78
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.77
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.74
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.74
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.71
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.71
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.71
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.71
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.71
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.71
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.67
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.63
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.56
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.55
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.52
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.46
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 99.3
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 99.28
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 99.07
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.53
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 98.01
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 97.76
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.72
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.66
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.59
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.48
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 96.52
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 94.78
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 94.28
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin-like ferredoxin
species: Escherichia coli [TaxId: 562]
Probab=99.78  E-value=9.3e-20  Score=133.31  Aligned_cols=78  Identities=28%  Similarity=0.413  Sum_probs=64.7

Q ss_pred             CcEEEEEecCCCCCCCCCCeEEEEecCChHHHHHHHHhCCCCccccCcccccCCCceeecccEEE---------------
Q 031117           56 PEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVE---------------  120 (165)
Q Consensus        56 p~i~v~f~~p~~~~DG~~~~~~v~v~~G~tLLRdall~~gi~l~~~~~~~~~CgG~G~CGTC~V~---------------  120 (165)
                      |+|+| ..+....|||    ++|++++|++|| ++|+++||++++      .|||.|.||||+|+               
T Consensus         1 pki~~-~p~~~~~p~g----~~v~~~~G~tLl-~aa~~~gi~i~~------~CgG~g~CgtC~v~v~~G~~~l~~~~~~E   68 (109)
T d1i7ha_           1 PKIVI-LPHQDLCPDG----AVLEANSGETIL-DAALRNGIEIEH------ACEKSCACTTCHCIVREGFDSLPESSEQE   68 (109)
T ss_dssp             CEEEE-CCBTTTBTTC----EEEECCTTCBHH-HHHHHTTCCCCC------TTSSSSCCSTTEEEEEECGGGSCCCCHHH
T ss_pred             CeEEE-ecCcccCCCC----cEEEeCCCCcHH-HHHHHcCCCCCc------CCCCcceeCCeEEEeecCccccCCCChHH
Confidence            45665 3344455777    589999999999 999999999999      79999999999998               


Q ss_pred             ---------cCCCeEEeeeceeccccCCcceEEEEcCc
Q 031117          121 ---------KPESWRLACQTIVGNKENSGKCRIKYLKV  149 (165)
Q Consensus       121 ---------~~~g~RLACQ~~v~~~~~~gDvtVe~~p~  149 (165)
                               ++++||||||+++.    .+|++|+++..
T Consensus        69 ~~~l~~~~~~~~~~RLaCQ~~v~----~~dl~V~lP~~  102 (109)
T d1i7ha_          69 DDMLDKAWGLEPESRLSCQARVT----DEDLVVEIPRY  102 (109)
T ss_dssp             HHHHTTCTTCCTTEEETTTCBCC----SSCEEEECCSC
T ss_pred             hhhhhccccCCCCeEEEEeeEEC----CCCEEEEeCcc
Confidence                     56789999999996    35999997553



>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure