Citrus Sinensis ID: 031117
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 165 | ||||||
| 356563826 | 161 | PREDICTED: uncharacterized protein LOC10 | 0.660 | 0.677 | 0.651 | 5e-39 | |
| 225430081 | 172 | PREDICTED: uncharacterized protein LOC10 | 0.860 | 0.825 | 0.586 | 4e-35 | |
| 296081922 | 137 | unnamed protein product [Vitis vinifera] | 0.660 | 0.795 | 0.661 | 1e-31 | |
| 449441962 | 176 | PREDICTED: uncharacterized protein LOC10 | 0.848 | 0.795 | 0.554 | 9e-31 | |
| 449441964 | 158 | PREDICTED: uncharacterized protein LOC10 | 0.848 | 0.886 | 0.522 | 1e-28 | |
| 255551138 | 171 | electron carrier, putative [Ricinus comm | 0.860 | 0.830 | 0.538 | 6e-27 | |
| 224092396 | 178 | predicted protein [Populus trichocarpa] | 0.684 | 0.634 | 0.604 | 5e-26 | |
| 242091313 | 185 | hypothetical protein SORBIDRAFT_09g02789 | 0.666 | 0.594 | 0.569 | 2e-25 | |
| 326523007 | 182 | predicted protein [Hordeum vulgare subsp | 0.551 | 0.5 | 0.616 | 7e-25 | |
| 297802756 | 175 | hypothetical protein ARALYDRAFT_913185 [ | 0.606 | 0.571 | 0.616 | 1e-24 |
| >gi|356563826|ref|XP_003550159.1| PREDICTED: uncharacterized protein LOC100807125 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 165 bits (418), Expect = 5e-39, Method: Compositional matrix adjust.
Identities = 88/135 (65%), Positives = 95/135 (70%), Gaps = 26/135 (19%)
Query: 34 RRPKFVSFAVNSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLD 93
R+P V FA S+ P SP PEIELEFI P+ G DGSYPVER KAISGEKLLRNIMLD
Sbjct: 27 RQPNTVIFAAASS-PESP----PEIELEFIGPKPGSDGSYPVERVKAISGEKLLRNIMLD 81
Query: 94 NKIELYATYGKVMNCGGGGSCGTCIVE---------------------KPESWRLACQTI 132
NKIELYATYGK+MNC GGGSCGTCIVE KPESWRLACQTI
Sbjct: 82 NKIELYATYGKLMNCAGGGSCGTCIVEIIEGKDLLNERTNTELRYLSKKPESWRLACQTI 141
Query: 133 VGNKENSGKCRIKYL 147
VGNKENSGK ++ +
Sbjct: 142 VGNKENSGKVAVQRI 156
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225430081|ref|XP_002281853.1| PREDICTED: uncharacterized protein LOC100250753 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296081922|emb|CBI20927.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449441962|ref|XP_004138751.1| PREDICTED: uncharacterized protein LOC101202753 isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449441964|ref|XP_004138752.1| PREDICTED: uncharacterized protein LOC101202753 isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255551138|ref|XP_002516617.1| electron carrier, putative [Ricinus communis] gi|223544437|gb|EEF45958.1| electron carrier, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224092396|ref|XP_002309590.1| predicted protein [Populus trichocarpa] gi|222855566|gb|EEE93113.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|242091313|ref|XP_002441489.1| hypothetical protein SORBIDRAFT_09g027890 [Sorghum bicolor] gi|241946774|gb|EES19919.1| hypothetical protein SORBIDRAFT_09g027890 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|326523007|dbj|BAJ88549.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|297802756|ref|XP_002869262.1| hypothetical protein ARALYDRAFT_913185 [Arabidopsis lyrata subsp. lyrata] gi|297315098|gb|EFH45521.1| hypothetical protein ARALYDRAFT_913185 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 165 | ||||||
| TAIR|locus:2125637 | 180 | AT4G32590 [Arabidopsis thalian | 0.357 | 0.327 | 0.796 | 1.5e-33 | |
| TAIR|locus:2094882 | 204 | PnsB3 "Photosynthetic NDH subc | 0.303 | 0.245 | 0.519 | 2.2e-15 |
| TAIR|locus:2125637 AT4G32590 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 265 (98.3 bits), Expect = 1.5e-33, Sum P(2) = 1.5e-33
Identities = 47/59 (79%), Positives = 53/59 (89%)
Query: 62 FIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVE 120
F P+ G DGSYPV++AKA+SG+KLLR+IM DNKIELYA YGKVMNCGGGGSCGTCIVE
Sbjct: 62 FFGPKPGSDGSYPVDKAKAVSGDKLLRSIMQDNKIELYAAYGKVMNCGGGGSCGTCIVE 120
|
|
| TAIR|locus:2094882 PnsB3 "Photosynthetic NDH subcomplex B 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0013034101 | hypothetical protein (178 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| PRK05464 | 409 | PRK05464, PRK05464, Na(+)-translocating NADH-quino | 6e-05 | |
| COG2871 | 410 | COG2871, NqrF, Na+-transporting NADH:ubiquinone ox | 7e-04 | |
| TIGR01941 | 405 | TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, N | 9e-04 |
| >gnl|CDD|235481 PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional | Back alignment and domain information |
|---|
Score = 41.8 bits (99), Expect = 6e-05
Identities = 25/72 (34%), Positives = 29/72 (40%), Gaps = 27/72 (37%)
Query: 82 SGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIV--------------------EK 121
+G KLL + N I L + CGGGGSCG C V E
Sbjct: 52 AGGKLL-GALASNGIFLSSA------CGGGGSCGQCRVKVKEGGGDILPTELSHISKREA 104
Query: 122 PESWRLACQTIV 133
E WRL+CQ V
Sbjct: 105 KEGWRLSCQVKV 116
|
Length = 409 |
| >gnl|CDD|225426 COG2871, NqrF, Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|130996 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| PLN02593 | 117 | adrenodoxin-like ferredoxin protein | 99.74 | |
| PTZ00490 | 143 | Ferredoxin superfamily; Provisional | 99.73 | |
| TIGR02007 | 110 | fdx_isc ferredoxin, 2Fe-2S type, ISC system. This | 99.69 | |
| KOG3309 | 159 | consensus Ferredoxin [Energy production and conver | 99.62 | |
| CHL00134 | 99 | petF ferredoxin; Validated | 99.61 | |
| TIGR02008 | 97 | fdx_plant ferredoxin [2Fe-2S]. This model represen | 99.6 | |
| PTZ00038 | 191 | ferredoxin; Provisional | 99.56 | |
| PLN03136 | 148 | Ferredoxin; Provisional | 99.56 | |
| PRK10713 | 84 | 2Fe-2S ferredoxin YfaE; Provisional | 99.53 | |
| TIGR01941 | 405 | nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo | 99.5 | |
| COG0633 | 102 | Fdx Ferredoxin [Energy production and conversion] | 99.44 | |
| PRK05464 | 409 | Na(+)-translocating NADH-quinone reductase subunit | 99.43 | |
| COG2871 | 410 | NqrF Na+-transporting NADH:ubiquinone oxidoreducta | 99.42 | |
| cd00207 | 84 | fer2 2Fe-2S iron-sulfur cluster binding domain. Ir | 99.41 | |
| PRK05713 | 312 | hypothetical protein; Provisional | 99.38 | |
| COG3894 | 614 | Uncharacterized metal-binding protein [General fun | 99.36 | |
| PRK07609 | 339 | CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat | 99.33 | |
| PRK11872 | 340 | antC anthranilate dioxygenase reductase; Provision | 99.32 | |
| PF13085 | 110 | Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; | 99.24 | |
| PF00111 | 78 | Fer2: 2Fe-2S iron-sulfur cluster binding domain; I | 99.22 | |
| PRK10684 | 332 | HCP oxidoreductase, NADH-dependent; Provisional | 99.22 | |
| PLN00129 | 276 | succinate dehydrogenase [ubiquinone] iron-sulfur s | 99.16 | |
| TIGR02160 | 352 | PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, | 99.1 | |
| PRK13552 | 239 | frdB fumarate reductase iron-sulfur subunit; Provi | 99.08 | |
| COG0479 | 234 | FrdB Succinate dehydrogenase/fumarate reductase, F | 99.02 | |
| PRK08640 | 249 | sdhB succinate dehydrogenase iron-sulfur subunit; | 98.93 | |
| PRK12575 | 235 | succinate dehydrogenase iron-sulfur subunit; Provi | 98.91 | |
| PRK12385 | 244 | fumarate reductase iron-sulfur subunit; Provisiona | 98.91 | |
| PRK06259 | 486 | succinate dehydrogenase/fumarate reductase iron-su | 98.9 | |
| PRK07569 | 234 | bidirectional hydrogenase complex protein HoxU; Va | 98.88 | |
| PRK12386 | 251 | fumarate reductase iron-sulfur subunit; Provisiona | 98.86 | |
| PRK12577 | 329 | succinate dehydrogenase iron-sulfur subunit; Provi | 98.85 | |
| PF13510 | 82 | Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; | 98.83 | |
| PRK05950 | 232 | sdhB succinate dehydrogenase iron-sulfur subunit; | 98.79 | |
| PRK07570 | 250 | succinate dehydrogenase/fumarate reductase iron-su | 98.77 | |
| PRK12576 | 279 | succinate dehydrogenase iron-sulfur subunit; Provi | 98.74 | |
| TIGR00384 | 220 | dhsB succinate dehydrogenase and fumarate reductas | 98.67 | |
| PRK08166 | 847 | NADH dehydrogenase subunit G; Validated | 98.25 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 98.12 | |
| PTZ00305 | 297 | NADH:ubiquinone oxidoreductase; Provisional | 98.09 | |
| PRK07860 | 797 | NADH dehydrogenase subunit G; Validated | 97.85 | |
| PRK08493 | 819 | NADH dehydrogenase subunit G; Validated | 97.85 | |
| PRK11433 | 217 | aldehyde oxidoreductase 2Fe-2S subunit; Provisiona | 97.68 | |
| TIGR01973 | 603 | NuoG NADH-quinone oxidoreductase, chain G. This mo | 97.64 | |
| PRK09130 | 687 | NADH dehydrogenase subunit G; Validated | 97.61 | |
| PRK09129 | 776 | NADH dehydrogenase subunit G; Validated | 97.59 | |
| KOG3049 | 288 | consensus Succinate dehydrogenase, Fe-S protein su | 97.53 | |
| PRK09908 | 159 | xanthine dehydrogenase subunit XdhC; Provisional | 97.44 | |
| TIGR03193 | 148 | 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm | 97.34 | |
| COG1034 | 693 | NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc | 97.07 | |
| TIGR03198 | 151 | pucE xanthine dehydrogenase E subunit. This gene h | 97.06 | |
| COG3383 | 978 | Uncharacterized anaerobic dehydrogenase [General f | 96.69 | |
| COG2080 | 156 | CoxS Aerobic-type carbon monoxide dehydrogenase, s | 96.53 | |
| PRK09800 | 956 | putative hypoxanthine oxidase; Provisional | 96.34 | |
| PRK08345 | 289 | cytochrome-c3 hydrogenase subunit gamma; Provision | 96.33 | |
| cd06219 | 248 | DHOD_e_trans_like1 FAD/NAD binding domain in the e | 96.24 | |
| PRK06222 | 281 | ferredoxin-NADP(+) reductase subunit alpha; Review | 96.13 | |
| PRK00054 | 250 | dihydroorotate dehydrogenase electron transfer sub | 96.07 | |
| cd06192 | 243 | DHOD_e_trans_like FAD/NAD binding domain (electron | 95.42 | |
| TIGR03313 | 951 | Se_sel_red_Mo probable selenate reductase, molybde | 95.27 | |
| TIGR03311 | 848 | Se_dep_Molyb_1 selenium-dependent molybdenum hydro | 95.15 | |
| cd06218 | 246 | DHOD_e_trans FAD/NAD binding domain in the electro | 95.12 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 94.87 | |
| TIGR02963 | 467 | xanthine_xdhA xanthine dehydrogenase, small subuni | 94.73 | |
| PRK05802 | 320 | hypothetical protein; Provisional | 94.7 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 94.41 | |
| cd06220 | 233 | DHOD_e_trans_like2 FAD/NAD binding domain in the e | 93.72 | |
| TIGR02911 | 261 | sulfite_red_B sulfite reductase, subunit B. Member | 93.39 | |
| PF10418 | 40 | DHODB_Fe-S_bind: Iron-sulfur cluster binding domai | 92.52 | |
| cd06221 | 253 | sulfite_reductase_like Anaerobic sulfite reductase | 92.42 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 92.17 | |
| TIGR02969 | 1330 | mam_aldehyde_ox aldehyde oxidase. Members of this | 91.65 | |
| PRK08221 | 263 | anaerobic sulfite reductase subunit B; Provisional | 90.68 | |
| PLN00192 | 1344 | aldehyde oxidase | 88.29 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 86.36 | |
| KOG2282 | 708 | consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 | 86.28 |
| >PLN02593 adrenodoxin-like ferredoxin protein | Back alignment and domain information |
|---|
Probab=99.74 E-value=8.4e-18 Score=128.00 Aligned_cols=78 Identities=35% Similarity=0.526 Sum_probs=65.0
Q ss_pred EEEEEecCCCCCCCCCCeEEEEecCChHHHHHHHHhCCCCccccCcccccCCCceeecccEEE-----------------
Q 031117 58 IELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVE----------------- 120 (165)
Q Consensus 58 i~v~f~~p~~~~DG~~~~~~v~v~~G~tLLRdall~~gi~l~~~~~~~~~CgG~G~CGTC~V~----------------- 120 (165)
|+|+|++ +||. .+++++..|++|| ++++++|+++++ .|||.|.||||+|+
T Consensus 1 ~~V~fi~----~~G~--~~~v~~~~G~tLl-~a~~~~gi~i~~------~CgG~g~C~tC~V~V~~~~~~~~l~~~~~~E 67 (117)
T PLN02593 1 ISVTFVD----KDGE--ERTVKAPVGMSLL-EAAHENDIELEG------ACEGSLACSTCHVIVMDEKVYNKLPEPTDEE 67 (117)
T ss_pred CEEEEEc----CCCC--EEEEEECCCCcHH-HHHHHcCCCCCc------cCCCcceeCCCEEEEecCccccCCCCCChHH
Confidence 5788887 5665 3789999999999 999999999999 79999999999998
Q ss_pred ---------cCCCeEEeeeceeccccCCcceEEEEcCch
Q 031117 121 ---------KPESWRLACQTIVGNKENSGKCRIKYLKVE 150 (165)
Q Consensus 121 ---------~~~g~RLACQ~~v~~~~~~gDvtVe~~p~~ 150 (165)
..++||||||+.+. .+ .++++|++++..
T Consensus 68 ~~~L~~~~~~~~~sRLaCQ~~v~-~~-~~~~~v~ip~~~ 104 (117)
T PLN02593 68 NDMLDLAFGLTETSRLGCQVIAK-PE-LDGMRLALPAAT 104 (117)
T ss_pred HHHHhcccCCCCCeEecceeEee-cC-CCCEEEEcCchh
Confidence 24689999999996 22 268999877664
|
|
| >PTZ00490 Ferredoxin superfamily; Provisional | Back alignment and domain information |
|---|
| >TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system | Back alignment and domain information |
|---|
| >KOG3309 consensus Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >CHL00134 petF ferredoxin; Validated | Back alignment and domain information |
|---|
| >TIGR02008 fdx_plant ferredoxin [2Fe-2S] | Back alignment and domain information |
|---|
| >PTZ00038 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PLN03136 Ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10713 2Fe-2S ferredoxin YfaE; Provisional | Back alignment and domain information |
|---|
| >TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit | Back alignment and domain information |
|---|
| >COG0633 Fdx Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain | Back alignment and domain information |
|---|
| >PRK05713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3894 Uncharacterized metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated | Back alignment and domain information |
|---|
| >PRK11872 antC anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B | Back alignment and domain information |
|---|
| >PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions | Back alignment and domain information |
|---|
| >PRK10684 HCP oxidoreductase, NADH-dependent; Provisional | Back alignment and domain information |
|---|
| >PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit | Back alignment and domain information |
|---|
| >TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit | Back alignment and domain information |
|---|
| >PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12385 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07569 bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >PRK12386 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein | Back alignment and domain information |
|---|
| >PRK08166 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00305 NADH:ubiquinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07860 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK08493 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01973 NuoG NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >PRK09130 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK09129 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09908 xanthine dehydrogenase subunit XdhC; Provisional | Back alignment and domain information |
|---|
| >TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit | Back alignment and domain information |
|---|
| >COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03198 pucE xanthine dehydrogenase E subunit | Back alignment and domain information |
|---|
| >COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09800 putative hypoxanthine oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional | Back alignment and domain information |
|---|
| >cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed | Back alignment and domain information |
|---|
| >cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit | Back alignment and domain information |
|---|
| >TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 | Back alignment and domain information |
|---|
| >cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit | Back alignment and domain information |
|---|
| >PRK05802 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >TIGR02911 sulfite_red_B sulfite reductase, subunit B | Back alignment and domain information |
|---|
| >PF10418 DHODB_Fe-S_bind: Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B; InterPro: IPR019480 Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases (DHODs) A and B [] | Back alignment and domain information |
|---|
| >cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02969 mam_aldehyde_ox aldehyde oxidase | Back alignment and domain information |
|---|
| >PRK08221 anaerobic sulfite reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >PLN00192 aldehyde oxidase | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1l5p_A | 93 | Ferredoxin; [2Fe-2S] cluster, electron transfer, i | 5e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 40.2 bits (93), Expect = 1e-04
Identities = 31/168 (18%), Positives = 47/168 (27%), Gaps = 42/168 (25%)
Query: 15 QPPELCLRRSSFKSKLSSPRR--PKFVSFAVNS-----TEPSSPEPEKPEIELE-FIAPR 66
+ F + LS KFV + P E +P + +I R
Sbjct: 57 SKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQR 116
Query: 67 --AGDDGS----YPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVE 120
+D Y V R + LR +L+ + V+ G G G
Sbjct: 117 DRLYNDNQVFAKYNVSRLQPY---LKLRQALLELRPAKN-----VLIDGVLG-SG----- 162
Query: 121 KPESWRLACQTIVGNKE-----------NSGKCRIKYLKVEALCSLYR 157
K +W +A + K N C +E L L
Sbjct: 163 K--TW-VALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLY 207
|
| >1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| 2bt6_A | 108 | Adrenodoxin 1; ruthenium(II) bipyridyl complex, in | 99.76 | |
| 3hui_A | 126 | Ferredoxin; cytochrome P450, electron transfer, ir | 99.75 | |
| 2y5c_A | 109 | Adrenodoxin-like protein, mitochondrial; electron | 99.75 | |
| 3lxf_A | 104 | Ferredoxin; iron, iron-sulfur, metal-binding, meta | 99.75 | |
| 3n9z_C | 123 | Adrenodoxin; cytochrome P450, 22-hydroxycholestero | 99.73 | |
| 3ah7_A | 113 | [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur | 99.72 | |
| 1uwm_A | 106 | Ferredoxin VI, FDVI; electron transport, metal-bin | 99.69 | |
| 2wlb_A | 103 | ETP1-FD, electron transfer protein 1, mitochondria | 99.68 | |
| 1xlq_A | 106 | Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored | 99.68 | |
| 1i7h_A | 111 | Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch | 99.66 | |
| 1b9r_A | 105 | Protein (terpredoxin); structure from molmol, ferr | 99.65 | |
| 1czp_A | 98 | Ferredoxin I; [2Fe-2S] protein, crystal reduced wi | 99.62 | |
| 1awd_A | 94 | Ferredoxin; electron transport, eukaryotic, green | 99.61 | |
| 1iue_A | 98 | Ferredoxin; electron transport, iron-sulfur; 1.70A | 99.61 | |
| 1a70_A | 97 | Ferredoxin; iron-sulfur protein, photosynthesis, e | 99.61 | |
| 1frd_A | 98 | Heterocyst [2Fe-2S] ferredoxin; electron transport | 99.61 | |
| 1frr_A | 95 | Ferredoxin I; electron transfer(iron-sulfur protei | 99.6 | |
| 1wri_A | 93 | Ferredoxin II, ferredoxin; electron transport; 1.2 | 99.58 | |
| 1jq4_A | 98 | Methane monooxygenase component C; [2Fe-2S] ferred | 99.56 | |
| 1l5p_A | 93 | Ferredoxin; [2Fe-2S] cluster, electron transfer, i | 99.55 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 99.45 | |
| 3zyy_X | 631 | Iron-sulfur cluster binding protein; iron-sulfur-b | 99.44 | |
| 1doi_A | 128 | 2Fe-2S ferredoxin; halophilic protein, redox prote | 99.44 | |
| 2pia_A | 321 | Phthalate dioxygenase reductase; HET: FMN; 2.00A { | 99.3 | |
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 98.99 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 98.99 | |
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 98.92 | |
| 3vr8_B | 282 | Iron-sulfur subunit of succinate dehydrogenase; me | 98.83 | |
| 2h88_B | 252 | Succinate dehydrogenase IP subunit; complex II, me | 98.83 | |
| 1t3q_A | 168 | Quinoline 2-oxidoreductase small subunit; QOR, mol | 98.42 | |
| 3c8y_A | 574 | Iron hydrogenase 1; dithiomethylether, H-cluster, | 98.36 | |
| 3i9v_3 | 783 | NADH-quinone oxidoreductase subunit 3; electron tr | 98.36 | |
| 1n62_A | 166 | Carbon monoxide dehydrogenase small chain; CODH, m | 98.13 | |
| 1rm6_C | 161 | 4-hydroxybenzoyl-COA reductase gamma subunit; xant | 98.11 | |
| 1ffv_A | 163 | CUTS, iron-sulfur protein of carbon monoxide dehyd | 98.07 | |
| 3hrd_D | 160 | Nicotinate dehydrogenase small FES subunit; seleni | 98.01 | |
| 1vlb_A | 907 | Aldehyde oxidoreductase; iron-sulphur cluster; HET | 97.1 | |
| 1dgj_A | 907 | Aldehyde oxidoreductase; beta half-barrel, four-he | 96.99 | |
| 2w3s_A | 462 | Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 | 96.88 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 95.94 | |
| 3nvw_A | 164 | Xanthine dehydrogenase/oxidase; hydroxylase, homod | 95.86 | |
| 3kwl_A | 514 | Uncharacterized protein; putative oxidoreductase, | 94.85 | |
| 1ep3_B | 262 | Dihydroorotate dehydrogenase B (PYRK subunit); het | 94.07 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 93.69 | |
| 3unc_A | 1332 | Xanthine dehydrogenase/oxidase; oxidoreductase; HE | 83.7 | |
| 3u7z_A | 101 | Putative metal binding protein rumgna_00854; the b | 80.59 |
| >2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* | Back alignment and structure |
|---|
Probab=99.76 E-value=1.5e-18 Score=126.94 Aligned_cols=77 Identities=26% Similarity=0.547 Sum_probs=61.1
Q ss_pred CCCCcEEEEEecCCCCCCCCCCeEEEEecCChHHHHHHHHhCCCCcc--ccCcccccCCCceeecccEEE----------
Q 031117 53 PEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELY--ATYGKVMNCGGGGSCGTCIVE---------- 120 (165)
Q Consensus 53 ~~~p~i~v~f~~p~~~~DG~~~~~~v~v~~G~tLLRdall~~gi~l~--~~~~~~~~CgG~G~CGTC~V~---------- 120 (165)
..| ++|+|.+ +||. .++|++.+|+||| ++|+++||+++ + +|+|.|.||||+|+
T Consensus 4 ~~m--~~V~~~~----~~g~--~~~v~~~~g~tLL-~aa~~~gi~i~~~~------~Cgg~G~CgtC~v~v~~g~~~~l~ 68 (108)
T 2bt6_A 4 GDK--ITVHFIN----RDGE--TLTTKGKIGDSLL-DVVVQNNLDIDGFG------ACEGTLACSTCHLIFEQHIFEKLE 68 (108)
T ss_dssp -CE--EEEEEEC----TTSC--EEEEEEETTCBHH-HHHHHTTCCCTTTT------TTSSSSSBSTTEEECCHHHHTTSC
T ss_pred Cce--EEEEEEC----CCCC--EEEEEECCCChHH-HHHHHcCCCCCccc------CCCCCcCcCCCEEEECccccccCC
Confidence 445 5566664 4564 3789999999999 99999999999 8 79999999999998
Q ss_pred ---------------cCCCeEEeeeceeccccCCcceEEEE
Q 031117 121 ---------------KPESWRLACQTIVGNKENSGKCRIKY 146 (165)
Q Consensus 121 ---------------~~~g~RLACQ~~v~~~~~~gDvtVe~ 146 (165)
+.+|||||||+++.. + ..+++|++
T Consensus 69 ~~~~~E~~~L~~~~~~~~g~rLaCq~~~~~-d-~d~~~V~~ 107 (108)
T 2bt6_A 69 AITDEENDMLDLAYGLTDRSRLGCQICLTK-A-MDNMTVRV 107 (108)
T ss_dssp CCCHHHHHHHTTCTTCCTTEEEGGGCBCCG-G-GTTEEEEC
T ss_pred CCCHHHHHHHhCcccCCCCcEeeEEEEecC-C-CCCEEEEc
Confidence 346899999999961 1 12688875
|
| >3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 | Back alignment and structure |
|---|
| >3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A | Back alignment and structure |
|---|
| >3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A | Back alignment and structure |
|---|
| >2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A | Back alignment and structure |
|---|
| >1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... | Back alignment and structure |
|---|
| >1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A | Back alignment and structure |
|---|
| >1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 | Back alignment and structure |
|---|
| >1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} | Back alignment and structure |
|---|
| >1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* | Back alignment and structure |
|---|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* | Back alignment and structure |
|---|
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* | Back alignment and structure |
|---|
| >3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* | Back alignment and structure |
|---|
| >2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... | Back alignment and structure |
|---|
| >1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* | Back alignment and structure |
|---|
| >3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* | Back alignment and structure |
|---|
| >1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* | Back alignment and structure |
|---|
| >1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* | Back alignment and structure |
|---|
| >1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* | Back alignment and structure |
|---|
| >3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* | Back alignment and structure |
|---|
| >1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 | Back alignment and structure |
|---|
| >2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* | Back alignment and structure |
|---|
| >3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* | Back alignment and structure |
|---|
| >3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| d1i7ha_ | 109 | Adrenodoxin-like ferredoxin {Escherichia coli [Tax | 99.78 | |
| d1xlqa1 | 106 | 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox | 99.78 | |
| d1e9ma_ | 106 | 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo | 99.77 | |
| d2bt6a1 | 104 | Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} | 99.77 | |
| d1b9ra_ | 105 | 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T | 99.74 | |
| d1krha3 | 104 | Benzoate dioxygenase reductase, N-terminal domain | 99.74 | |
| d1frra_ | 95 | 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] | 99.71 | |
| d1a70a_ | 97 | 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta | 99.71 | |
| d1awda_ | 94 | 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | 99.71 | |
| d1czpa_ | 98 | 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), | 99.71 | |
| d1iuea_ | 98 | 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa | 99.71 | |
| d1frda_ | 98 | 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), | 99.71 | |
| d1l5pa_ | 93 | 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 | 99.67 | |
| d1jq4a_ | 98 | Methane monooxygenase reductase N-terminal domain | 99.63 | |
| d2piaa3 | 98 | Phthalate dioxygenase reductase, C-terminal domain | 99.56 | |
| d2fug33 | 95 | Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi | 99.55 | |
| d1wria_ | 93 | 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] | 99.52 | |
| d1doia_ | 128 | 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui | 99.46 | |
| d1kf6b2 | 105 | Fumarate reductase iron-sulfur protein, N-terminal | 99.3 | |
| d2bs2b2 | 106 | Fumarate reductase iron-sulfur protein, N-terminal | 99.28 | |
| d1nekb2 | 106 | Succinate dehydogenase iron-sulfur protein, N-term | 99.07 | |
| d3c8ya2 | 126 | Fe-only hydrogenase, N-terminal domain {Clostridiu | 98.53 | |
| d1t3qa2 | 81 | Quinoline 2-oxidoreductase small subunit QorS, N-d | 98.01 | |
| d1rm6c2 | 81 | 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, | 97.76 | |
| d1dgja2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 97.72 | |
| d1vlba2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 97.66 | |
| d1ffva2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 97.59 | |
| d1n62a2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 97.48 | |
| d1jroa2 | 84 | Xanthine dehydrogenase chain A, N-terminal domain | 96.52 | |
| d1ep3b2 | 160 | Dihydroorotate dehydrogenase B, PyrK subunit {Lact | 94.78 | |
| d1v97a2 | 90 | Xanthine oxidase, N-terminal domain {Cow (Bos taur | 94.28 |
| >d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: 2Fe-2S ferredoxin-like family: 2Fe-2S ferredoxin-related domain: Adrenodoxin-like ferredoxin species: Escherichia coli [TaxId: 562]
Probab=99.78 E-value=9.3e-20 Score=133.31 Aligned_cols=78 Identities=28% Similarity=0.413 Sum_probs=64.7
Q ss_pred CcEEEEEecCCCCCCCCCCeEEEEecCChHHHHHHHHhCCCCccccCcccccCCCceeecccEEE---------------
Q 031117 56 PEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVE--------------- 120 (165)
Q Consensus 56 p~i~v~f~~p~~~~DG~~~~~~v~v~~G~tLLRdall~~gi~l~~~~~~~~~CgG~G~CGTC~V~--------------- 120 (165)
|+|+| ..+....||| ++|++++|++|| ++|+++||++++ .|||.|.||||+|+
T Consensus 1 pki~~-~p~~~~~p~g----~~v~~~~G~tLl-~aa~~~gi~i~~------~CgG~g~CgtC~v~v~~G~~~l~~~~~~E 68 (109)
T d1i7ha_ 1 PKIVI-LPHQDLCPDG----AVLEANSGETIL-DAALRNGIEIEH------ACEKSCACTTCHCIVREGFDSLPESSEQE 68 (109)
T ss_dssp CEEEE-CCBTTTBTTC----EEEECCTTCBHH-HHHHHTTCCCCC------TTSSSSCCSTTEEEEEECGGGSCCCCHHH
T ss_pred CeEEE-ecCcccCCCC----cEEEeCCCCcHH-HHHHHcCCCCCc------CCCCcceeCCeEEEeecCccccCCCChHH
Confidence 45665 3344455777 589999999999 999999999999 79999999999998
Q ss_pred ---------cCCCeEEeeeceeccccCCcceEEEEcCc
Q 031117 121 ---------KPESWRLACQTIVGNKENSGKCRIKYLKV 149 (165)
Q Consensus 121 ---------~~~g~RLACQ~~v~~~~~~gDvtVe~~p~ 149 (165)
++++||||||+++. .+|++|+++..
T Consensus 69 ~~~l~~~~~~~~~~RLaCQ~~v~----~~dl~V~lP~~ 102 (109)
T d1i7ha_ 69 DDMLDKAWGLEPESRLSCQARVT----DEDLVVEIPRY 102 (109)
T ss_dssp HHHHTTCTTCCTTEEETTTCBCC----SSCEEEECCSC
T ss_pred hhhhhccccCCCCeEEEEeeEEC----CCCEEEEeCcc
Confidence 56789999999996 35999997553
|
| >d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} | Back information, alignment and structure |
|---|
| >d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} | Back information, alignment and structure |
|---|
| >d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | Back information, alignment and structure |
|---|
| >d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} | Back information, alignment and structure |
|---|
| >d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} | Back information, alignment and structure |
|---|
| >d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} | Back information, alignment and structure |
|---|
| >d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} | Back information, alignment and structure |
|---|
| >d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|