Citrus Sinensis ID: 031126
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 165 | ||||||
| 255536817 | 206 | protein with unknown function [Ricinus c | 0.830 | 0.665 | 0.992 | 2e-75 | |
| 224103431 | 206 | predicted protein [Populus trichocarpa] | 0.830 | 0.665 | 0.985 | 3e-75 | |
| 77745448 | 206 | unknown [Solanum tuberosum] gi|78191474| | 0.830 | 0.665 | 0.978 | 5e-75 | |
| 449465391 | 206 | PREDICTED: ras-related protein Rab7-like | 0.830 | 0.665 | 0.985 | 5e-75 | |
| 356538781 | 206 | PREDICTED: ras-related protein Rab7-like | 0.830 | 0.665 | 0.978 | 6e-75 | |
| 408784807 | 206 | small GTP binding protein [Arachis hypog | 0.830 | 0.665 | 0.970 | 6e-75 | |
| 351726788 | 206 | uncharacterized protein LOC100305642 [Gl | 0.830 | 0.665 | 0.978 | 7e-75 | |
| 297741446 | 253 | unnamed protein product [Vitis vinifera] | 0.830 | 0.541 | 0.978 | 1e-74 | |
| 388507798 | 206 | unknown [Lotus japonicus] | 0.830 | 0.665 | 0.970 | 1e-74 | |
| 1370186 | 206 | RAB7C [Lotus japonicus] | 0.830 | 0.665 | 0.970 | 2e-74 |
| >gi|255536817|ref|XP_002509475.1| protein with unknown function [Ricinus communis] gi|223549374|gb|EEF50862.1| protein with unknown function [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 286 bits (731), Expect = 2e-75, Method: Compositional matrix adjust.
Identities = 136/137 (99%), Positives = 137/137 (100%)
Query: 1 MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ 60
MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ
Sbjct: 1 MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ 60
Query: 61 IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF 120
IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDP+NFPF
Sbjct: 61 IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF 120
Query: 121 VVLGNKIDVDGGNSRVV 137
VVLGNKIDVDGGNSRVV
Sbjct: 121 VVLGNKIDVDGGNSRVV 137
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224103431|ref|XP_002313053.1| predicted protein [Populus trichocarpa] gi|118485510|gb|ABK94609.1| unknown [Populus trichocarpa] gi|222849461|gb|EEE87008.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|77745448|gb|ABB02623.1| unknown [Solanum tuberosum] gi|78191474|gb|ABB29958.1| unknown [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|449465391|ref|XP_004150411.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus] gi|449508065|ref|XP_004163207.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus] gi|34484308|gb|AAQ72787.1| putative GTP-binding protein [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356538781|ref|XP_003537879.1| PREDICTED: ras-related protein Rab7-like isoform 1 [Glycine max] gi|356538783|ref|XP_003537880.1| PREDICTED: ras-related protein Rab7-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|408784807|gb|AFU91386.1| small GTP binding protein [Arachis hypogaea] | Back alignment and taxonomy information |
|---|
| >gi|351726788|ref|NP_001238418.1| uncharacterized protein LOC100305642 [Glycine max] gi|255626165|gb|ACU13427.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297741446|emb|CBI32577.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388507798|gb|AFK41965.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|1370186|emb|CAA98170.1| RAB7C [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 165 | ||||||
| TAIR|locus:2094029 | 206 | RAB7B "RAB GTPase homolog G3F" | 0.830 | 0.665 | 0.956 | 2.1e-68 | |
| TAIR|locus:2010257 | 206 | RABG3E "RAB GTPase homolog G3E | 0.830 | 0.665 | 0.956 | 7.2e-68 | |
| TAIR|locus:2018124 | 206 | RABG3d "RAB GTPase homolog G3D | 0.830 | 0.665 | 0.919 | 4.1e-65 | |
| TAIR|locus:2093437 | 206 | RABG3c "RAB GTPase homolog G3C | 0.830 | 0.665 | 0.905 | 9.7e-64 | |
| TAIR|locus:2199716 | 203 | RABG3B "RAB GTPase homolog G3B | 0.830 | 0.674 | 0.817 | 1.2e-58 | |
| DICTYBASE|DDB_G0269236 | 203 | rab7A "Rab GTPase" [Dictyostel | 0.818 | 0.665 | 0.795 | 2.5e-56 | |
| ZFIN|ZDB-GENE-040927-2 | 205 | zgc:100918 "zgc:100918" [Danio | 0.787 | 0.634 | 0.823 | 2.3e-55 | |
| UNIPROTKB|E1C0F3 | 207 | RAB7A "Uncharacterized protein | 0.787 | 0.628 | 0.815 | 6.1e-55 | |
| UNIPROTKB|F1MJQ1 | 207 | RAB7A "Ras-related protein Rab | 0.787 | 0.628 | 0.815 | 6.1e-55 | |
| UNIPROTKB|Q3T0F5 | 207 | RAB7A "Ras-related protein Rab | 0.787 | 0.628 | 0.815 | 6.1e-55 |
| TAIR|locus:2094029 RAB7B "RAB GTPase homolog G3F" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 694 (249.4 bits), Expect = 2.1e-68, P = 2.1e-68
Identities = 131/137 (95%), Positives = 136/137 (99%)
Query: 1 MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ 60
MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ
Sbjct: 1 MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ 60
Query: 61 IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF 120
IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSF+NLNNWREEFLIQASPSDP+NFPF
Sbjct: 61 IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPF 120
Query: 121 VVLGNKIDVDGGNSRVV 137
V++GNK+DVD GNSRVV
Sbjct: 121 VLIGNKVDVDDGNSRVV 137
|
|
| TAIR|locus:2010257 RABG3E "RAB GTPase homolog G3E" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018124 RABG3d "RAB GTPase homolog G3D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093437 RABG3c "RAB GTPase homolog G3C" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199716 RABG3B "RAB GTPase homolog G3B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0269236 rab7A "Rab GTPase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040927-2 zgc:100918 "zgc:100918" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C0F3 RAB7A "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MJQ1 RAB7A "Ras-related protein Rab-7a" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0F5 RAB7A "Ras-related protein Rab-7a" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_IX1851 | SubName- Full=Putative uncharacterized protein; (207 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| cd01862 | 172 | cd01862, Rab7, Rab GTPase family 7 (Rab7) | 1e-100 | |
| smart00175 | 164 | smart00175, RAB, Rab subfamily of small GTPases | 2e-67 | |
| cd00154 | 159 | cd00154, Rab, Ras-related in brain (Rab) family of | 3e-60 | |
| pfam00071 | 162 | pfam00071, Ras, Ras family | 4e-59 | |
| cd04116 | 170 | cd04116, Rab9, Rab GTPase family 9 (Rab9) | 6e-56 | |
| cd01861 | 161 | cd01861, Rab6, Rab GTPase family 6 (Rab6) | 8e-43 | |
| cd01863 | 161 | cd01863, Rab18, Rab GTPase family 18 (Rab18) | 3e-41 | |
| cd01868 | 165 | cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- | 4e-38 | |
| cd01867 | 167 | cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie | 1e-37 | |
| cd01860 | 163 | cd01860, Rab5_related, Rab-related GTPase family i | 1e-37 | |
| cd04123 | 162 | cd04123, Rab21, Rab GTPase family 21 (Rab21) | 2e-37 | |
| COG1100 | 219 | COG1100, COG1100, GTPase SAR1 and related small G | 3e-37 | |
| cd04107 | 201 | cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 | 3e-35 | |
| cd01869 | 166 | cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t | 5e-35 | |
| cd04113 | 161 | cd04113, Rab4, Rab GTPase family 4 (Rab4) | 8e-34 | |
| cd04106 | 162 | cd04106, Rab23_like, Rab GTPase family 23 (Rab23)- | 4e-33 | |
| cd01866 | 168 | cd01866, Rab2, Rab GTPase family 2 (Rab2) | 1e-32 | |
| cd04127 | 180 | cd04127, Rab27A, Rab GTPase family 27a (Rab27a) | 1e-32 | |
| cd00876 | 160 | cd00876, Ras, Rat sarcoma (Ras) family of small gu | 6e-31 | |
| cd04115 | 170 | cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu | 7e-31 | |
| cd04122 | 166 | cd04122, Rab14, Rab GTPase family 14 (Rab14) | 3e-30 | |
| PLN03110 | 216 | PLN03110, PLN03110, Rab GTPase; Provisional | 5e-30 | |
| cd04110 | 199 | cd04110, Rab35, Rab GTPase family 35 (Rab35) | 1e-29 | |
| PLN03108 | 210 | PLN03108, PLN03108, Rab family protein; Provisiona | 2e-29 | |
| cd04111 | 211 | cd04111, Rab39, Rab GTPase family 39 (Rab39) | 2e-29 | |
| cd04114 | 169 | cd04114, Rab30, Rab GTPase family 30 (Rab30) | 3e-29 | |
| cd04120 | 202 | cd04120, Rab12, Rab GTPase family 12 (Rab12) | 4e-29 | |
| cd04119 | 168 | cd04119, RJL, Rab GTPase family J-like (RabJ-like) | 8e-29 | |
| cd01865 | 165 | cd01865, Rab3, Rab GTPase family 3 contains Rab3A, | 2e-28 | |
| cd01864 | 165 | cd01864, Rab19, Rab GTPase family 19 (Rab19) | 4e-28 | |
| cd04112 | 191 | cd04112, Rab26, Rab GTPase family 26 (Rab26) | 5e-28 | |
| cd04124 | 161 | cd04124, RabL2, Rab GTPase-like family 2 (Rab-like | 8e-27 | |
| cd04108 | 170 | cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 | 2e-26 | |
| cd04118 | 193 | cd04118, Rab24, Rab GTPase family 24 (Rab24) | 6e-26 | |
| cd04109 | 213 | cd04109, Rab28, Rab GTPase family 28 (Rab28) | 1e-25 | |
| smart00173 | 164 | smart00173, RAS, Ras subfamily of RAS small GTPase | 1e-24 | |
| PLN03118 | 211 | PLN03118, PLN03118, Rab family protein; Provisiona | 1e-24 | |
| cd00877 | 166 | cd00877, Ran, Ras-related nuclear proteins (Ran)/T | 1e-24 | |
| cd00157 | 171 | cd00157, Rho, Ras homology family (Rho) of small g | 2e-24 | |
| smart00010 | 166 | smart00010, small_GTPase, Small GTPase of the Ras | 4e-24 | |
| cd04126 | 220 | cd04126, Rab20, Rab GTPase family 20 (Rab20) | 5e-24 | |
| cd04117 | 164 | cd04117, Rab15, Rab GTPase family 15 (Rab15) | 7e-24 | |
| cd00882 | 161 | cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s | 1e-23 | |
| PTZ00132 | 215 | PTZ00132, PTZ00132, GTP-binding nuclear protein Ra | 3e-23 | |
| cd04138 | 162 | cd04138, H_N_K_Ras_like, Ras GTPase family contain | 5e-22 | |
| cd04145 | 164 | cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 | 4e-21 | |
| PTZ00369 | 189 | PTZ00369, PTZ00369, Ras-like protein; Provisional | 7e-21 | |
| cd04177 | 168 | cd04177, RSR1, RSR1/Bud1p family GTPase | 1e-20 | |
| smart00174 | 174 | smart00174, RHO, Rho (Ras homology) subfamily of R | 1e-20 | |
| PLN03071 | 219 | PLN03071, PLN03071, GTP-binding nuclear protein Ra | 1e-20 | |
| cd04176 | 163 | cd04176, Rap2, Rap2 family GTPase consists of Rap2 | 2e-20 | |
| cd04136 | 164 | cd04136, Rap_like, Rap-like family consists of Rap | 3e-20 | |
| TIGR00231 | 162 | TIGR00231, small_GTP, small GTP-binding protein do | 9e-20 | |
| cd04175 | 164 | cd04175, Rap1, Rap1 family GTPase consists of Rap1 | 1e-19 | |
| cd04139 | 163 | cd04139, RalA_RalB, Ral (Ras-like) family containi | 2e-19 | |
| cd04137 | 180 | cd04137, RheB, Ras Homolog Enriched in Brain (RheB | 3e-19 | |
| cd04144 | 190 | cd04144, Ras2, Rat sarcoma (Ras) family 2 of small | 3e-18 | |
| smart00176 | 200 | smart00176, RAN, Ran (Ras-related nuclear proteins | 4e-18 | |
| cd04132 | 197 | cd04132, Rho4_like, Ras homology family 4 (Rho4) o | 4e-18 | |
| cd04121 | 189 | cd04121, Rab40, Rab GTPase family 40 (Rab40) conta | 6e-18 | |
| PTZ00099 | 176 | PTZ00099, PTZ00099, rab6; Provisional | 2e-17 | |
| cd04147 | 197 | cd04147, Ras_dva, Ras - dorsal-ventral anterior lo | 5e-16 | |
| cd04146 | 166 | cd04146, RERG_RasL11_like, Ras-related and Estroge | 6e-16 | |
| cd04128 | 182 | cd04128, Spg1, Septum-promoting GTPase (Spg1) | 4e-15 | |
| cd04134 | 185 | cd04134, Rho3, Ras homology family 3 (Rho3) of sma | 5e-15 | |
| cd04129 | 190 | cd04129, Rho2, Ras homology family 2 (Rho2) of sma | 1e-14 | |
| pfam08477 | 116 | pfam08477, Miro, Miro-like protein | 2e-14 | |
| cd04135 | 174 | cd04135, Tc10, Rho GTPase TC10 (Tc10) | 2e-14 | |
| cd04101 | 167 | cd04101, RabL4, Rab GTPase-like family 4 (Rab-like | 2e-14 | |
| cd04141 | 172 | cd04141, Rit_Rin_Ric, Ras-like protein in all tiss | 5e-14 | |
| cd04142 | 198 | cd04142, RRP22, Ras-related protein on chromosome | 7e-14 | |
| cd04133 | 173 | cd04133, Rop_like, Rho-related protein from plants | 7e-14 | |
| cd09914 | 161 | cd09914, RocCOR, Ras of complex proteins (Roc) C-t | 9e-14 | |
| cd04130 | 173 | cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W | 2e-13 | |
| PLN00023 | 334 | PLN00023, PLN00023, GTP-binding protein; Provision | 2e-13 | |
| cd01874 | 175 | cd01874, Cdc42, cell division cycle 42 (Cdc42) is | 7e-13 | |
| cd04131 | 176 | cd04131, Rnd, Rho family GTPase subfamily Rnd incl | 8e-13 | |
| cd04102 | 204 | cd04102, RabL3, Rab GTPase-like family 3 (Rab-like | 1e-12 | |
| cd01871 | 174 | cd01871, Rac1_like, Ras-related C3 botulinum toxin | 1e-12 | |
| cd00878 | 158 | cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf | 9e-12 | |
| cd04143 | 247 | cd04143, Rhes_like, Ras homolog enriched in striat | 1e-11 | |
| cd04140 | 165 | cd04140, ARHI_like, A Ras homolog member I (ARHI) | 2e-11 | |
| cd01870 | 175 | cd01870, RhoA_like, Ras homology family A (RhoA)-l | 3e-11 | |
| cd01875 | 191 | cd01875, RhoG, Ras homolog family, member G (RhoG) | 3e-11 | |
| cd04159 | 159 | cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl | 2e-10 | |
| cd01893 | 168 | cd01893, Miro1, Mitochondrial Rho family 1 (Miro1) | 2e-10 | |
| cd04148 | 219 | cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam | 8e-10 | |
| pfam00025 | 174 | pfam00025, Arf, ADP-ribosylation factor family | 8e-10 | |
| cd04172 | 182 | cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases | 4e-09 | |
| cd04160 | 168 | cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) | 5e-09 | |
| cd04174 | 232 | cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases | 3e-08 | |
| cd04103 | 158 | cd04103, Centaurin_gamma, Centaurin gamma (CENTG) | 1e-07 | |
| cd04155 | 174 | cd04155, Arl3, Arf-like 3 (Arl3) GTPase | 2e-07 | |
| cd04173 | 221 | cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases | 1e-06 | |
| cd04152 | 183 | cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) | 5e-06 | |
| cd04156 | 160 | cd04156, ARLTS1, Arf-like tumor suppressor gene 1 | 6e-06 | |
| cd04153 | 174 | cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) | 1e-05 | |
| cd04162 | 164 | cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp | 1e-05 | |
| cd01892 | 180 | cd01892, Miro2, Mitochondrial Rho family 2 (Miro2) | 4e-05 | |
| cd04158 | 169 | cd04158, ARD1, (ADP-ribosylation factor domain pro | 6e-05 | |
| smart00177 | 175 | smart00177, ARF, ARF-like small GTPases; ARF, ADP- | 9e-05 | |
| cd04151 | 158 | cd04151, Arl1, ADP ribosylation factor 1 (Arf1) | 1e-04 | |
| TIGR00450 | 442 | TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas | 1e-04 | |
| pfam04670 | 230 | pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserve | 2e-04 | |
| cd04154 | 173 | cd04154, Arl2, Arf-like 2 (Arl2) GTPase | 2e-04 | |
| COG2229 | 187 | COG2229, COG2229, Predicted GTPase [General functi | 7e-04 | |
| PTZ00133 | 182 | PTZ00133, PTZ00133, ADP-ribosylation factor; Provi | 0.001 | |
| cd04157 | 162 | cd04157, Arl6, Arf-like 6 (Arl6) GTPase | 0.002 |
| >gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) | Back alignment and domain information |
|---|
Score = 286 bits (733), Expect = e-100
Identities = 108/129 (83%), Positives = 118/129 (91%), Gaps = 2/129 (1%)
Query: 9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQE 68
LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEV +DRL TLQIWDTAGQE
Sbjct: 1 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVTVDDRLVTLQIWDTAGQE 60
Query: 69 RFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKID 128
RFQSLGVAFYRGADCCVLVYDV + KSF++L++WR+EFLIQASP DP+NFPFVVLGNKID
Sbjct: 61 RFQSLGVAFYRGADCCVLVYDVTNPKSFESLDSWRDEFLIQASPRDPENFPFVVLGNKID 120
Query: 129 VDGGNSRVV 137
++ R V
Sbjct: 121 LE--EKRQV 127
|
Rab7 subfamily. Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway. The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion. Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 172 |
| >gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|215692 pfam00071, Ras, Ras family | Back alignment and domain information |
|---|
| >gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) | Back alignment and domain information |
|---|
| >gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) | Back alignment and domain information |
|---|
| >gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) | Back alignment and domain information |
|---|
| >gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 | Back alignment and domain information |
|---|
| >gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) | Back alignment and domain information |
|---|
| >gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion | Back alignment and domain information |
|---|
| >gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) | Back alignment and domain information |
|---|
| >gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) | Back alignment and domain information |
|---|
| >gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 | Back alignment and domain information |
|---|
| >gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) | Back alignment and domain information |
|---|
| >gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like | Back alignment and domain information |
|---|
| >gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) | Back alignment and domain information |
|---|
| >gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) | Back alignment and domain information |
|---|
| >gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B | Back alignment and domain information |
|---|
| >gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) | Back alignment and domain information |
|---|
| >gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) | Back alignment and domain information |
|---|
| >gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) | Back alignment and domain information |
|---|
| >gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) | Back alignment and domain information |
|---|
| >gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) | Back alignment and domain information |
|---|
| >gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) | Back alignment and domain information |
|---|
| >gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D | Back alignment and domain information |
|---|
| >gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) | Back alignment and domain information |
|---|
| >gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) | Back alignment and domain information |
|---|
| >gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2) | Back alignment and domain information |
|---|
| >gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) | Back alignment and domain information |
|---|
| >gnl|CDD|133318 cd04118, Rab24, Rab GTPase family 24 (Rab24) | Back alignment and domain information |
|---|
| >gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) | Back alignment and domain information |
|---|
| >gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133326 cd04126, Rab20, Rab GTPase family 20 (Rab20) | Back alignment and domain information |
|---|
| >gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) | Back alignment and domain information |
|---|
| >gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B | Back alignment and domain information |
|---|
| >gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 | Back alignment and domain information |
|---|
| >gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c | Back alignment and domain information |
|---|
| >gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 | Back alignment and domain information |
|---|
| >gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms | Back alignment and domain information |
|---|
| >gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB | Back alignment and domain information |
|---|
| >gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|128473 smart00176, RAN, Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like | Back alignment and domain information |
|---|
| >gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c | Back alignment and domain information |
|---|
| >gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family | Back alignment and domain information |
|---|
| >gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families | Back alignment and domain information |
|---|
| >gnl|CDD|206701 cd04128, Spg1, Septum-promoting GTPase (Spg1) | Back alignment and domain information |
|---|
| >gnl|CDD|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|219856 pfam08477, Miro, Miro-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10) | Back alignment and domain information |
|---|
| >gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) | Back alignment and domain information |
|---|
| >gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) | Back alignment and domain information |
|---|
| >gnl|CDD|133342 cd04142, RRP22, Ras-related protein on chromosome 22 (RRP22) family | Back alignment and domain information |
|---|
| >gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like | Back alignment and domain information |
|---|
| >gnl|CDD|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family | Back alignment and domain information |
|---|
| >gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42 | Back alignment and domain information |
|---|
| >gnl|CDD|177661 PLN00023, PLN00023, GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of the Rho family | Back alignment and domain information |
|---|
| >gnl|CDD|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8 | Back alignment and domain information |
|---|
| >gnl|CDD|206689 cd04102, RabL3, Rab GTPase-like family 3 (Rab-like3) | Back alignment and domain information |
|---|
| >gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3 | Back alignment and domain information |
|---|
| >gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and activator of G-protein signaling 1 (Dexras1/AGS1) | Back alignment and domain information |
|---|
| >gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) | Back alignment and domain information |
|---|
| >gnl|CDD|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes RhoA, RhoB and RhoC | Back alignment and domain information |
|---|
| >gnl|CDD|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206680 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1), N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family | Back alignment and domain information |
|---|
| >gnl|CDD|206735 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) | Back alignment and domain information |
|---|
| >gnl|CDD|206737 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|133303 cd04103, Centaurin_gamma, Centaurin gamma (CENTG) GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|206736 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) | Back alignment and domain information |
|---|
| >gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|206679 cd01892, Miro2, Mitochondrial Rho family 2 (Miro2), C-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) | Back alignment and domain information |
|---|
| >gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) | Back alignment and domain information |
|---|
| >gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >gnl|CDD|218203 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserved region | Back alignment and domain information |
|---|
| >gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| KOG0084 | 205 | consensus GTPase Rab1/YPT1, small G protein superf | 100.0 | |
| KOG0092 | 200 | consensus GTPase Rab5/YPT51 and related small G pr | 100.0 | |
| KOG0078 | 207 | consensus GTP-binding protein SEC4, small G protei | 100.0 | |
| KOG0394 | 210 | consensus Ras-related GTPase [General function pre | 100.0 | |
| KOG0094 | 221 | consensus GTPase Rab6/YPT6/Ryh1, small G protein s | 100.0 | |
| KOG0079 | 198 | consensus GTP-binding protein H-ray, small G prote | 100.0 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 100.0 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 100.0 | |
| KOG0093 | 193 | consensus GTPase Rab3, small G protein superfamily | 100.0 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 100.0 | |
| KOG0087 | 222 | consensus GTPase Rab11/YPT3, small G protein super | 100.0 | |
| cd04133 | 176 | Rop_like Rop subfamily. The Rop (Rho-related prote | 100.0 | |
| KOG0080 | 209 | consensus GTPase Rab18, small G protein superfamil | 100.0 | |
| KOG0098 | 216 | consensus GTPase Rab2, small G protein superfamily | 100.0 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 100.0 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 100.0 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 100.0 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 100.0 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 100.0 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 100.0 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 100.0 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 100.0 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 100.0 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 100.0 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 100.0 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 100.0 | |
| KOG0086 | 214 | consensus GTPase Rab4, small G protein superfamily | 100.0 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 100.0 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 100.0 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 100.0 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 100.0 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 100.0 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 100.0 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 100.0 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 99.98 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 99.98 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 99.98 | |
| KOG0095 | 213 | consensus GTPase Rab30, small G protein superfamil | 99.98 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 99.98 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 99.98 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 99.98 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 99.98 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 99.97 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 99.97 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 99.97 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 99.97 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 99.97 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 99.97 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 99.97 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 99.97 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 99.97 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 99.97 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 99.97 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 99.97 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 99.97 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 99.97 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 99.97 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 99.97 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 99.97 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 99.97 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 99.97 | |
| smart00176 | 200 | RAN Ran (Ras-related nuclear proteins) /TC4 subfam | 99.97 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 99.97 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 99.97 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 99.97 | |
| KOG0091 | 213 | consensus GTPase Rab39, small G protein superfamil | 99.97 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 99.97 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 99.97 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 99.97 | |
| PLN03108 | 210 | Rab family protein; Provisional | 99.97 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 99.97 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 99.97 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 99.97 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 99.97 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 99.97 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 99.97 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 99.97 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 99.97 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 99.97 | |
| cd01873 | 195 | RhoBTB RhoBTB subfamily. Members of the RhoBTB sub | 99.97 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 99.97 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 99.97 | |
| PLN03118 | 211 | Rab family protein; Provisional | 99.97 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 99.96 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 99.96 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 99.96 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 99.96 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 99.96 | |
| KOG0088 | 218 | consensus GTPase Rab21, small G protein superfamil | 99.96 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 99.96 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 99.96 | |
| KOG0395 | 196 | consensus Ras-related GTPase [General function pre | 99.96 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 99.96 | |
| KOG0081 | 219 | consensus GTPase Rab27, small G protein superfamil | 99.96 | |
| KOG0083 | 192 | consensus GTPase Rab26/Rab37, small G protein supe | 99.96 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 99.96 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 99.96 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 99.96 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 99.96 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 99.95 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 99.95 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 99.95 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 99.95 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 99.95 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 99.95 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 99.95 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 99.95 | |
| KOG0393 | 198 | consensus Ras-related small GTPase, Rho type [Gene | 99.95 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 99.95 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 99.95 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 99.95 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 99.95 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 99.95 | |
| KOG0097 | 215 | consensus GTPase Rab14, small G protein superfamil | 99.95 | |
| PLN00023 | 334 | GTP-binding protein; Provisional | 99.95 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 99.95 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 99.95 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 99.94 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 99.94 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 99.94 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 99.94 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 99.93 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 99.93 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 99.93 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 99.92 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 99.92 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 99.92 | |
| KOG4252 | 246 | consensus GTP-binding protein [Signal transduction | 99.92 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 99.92 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 99.92 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 99.91 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 99.91 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 99.91 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 99.91 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 99.91 | |
| KOG0075 | 186 | consensus GTP-binding ADP-ribosylation factor-like | 99.91 | |
| KOG0073 | 185 | consensus GTP-binding ADP-ribosylation factor-like | 99.9 | |
| PTZ00099 | 176 | rab6; Provisional | 99.9 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 99.9 | |
| KOG0096 | 216 | consensus GTPase Ran/TC4/GSP1 (nuclear protein tra | 99.9 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 99.89 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 99.89 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 99.89 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 99.89 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 99.89 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 99.88 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 99.88 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 99.88 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 99.88 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 99.88 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 99.87 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.87 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.87 | |
| KOG0070 | 181 | consensus GTP-binding ADP-ribosylation factor Arf1 | 99.87 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 99.87 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 99.87 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 99.86 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 99.86 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 99.86 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 99.86 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 99.86 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 99.86 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 99.85 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 99.85 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 99.85 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.84 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 99.84 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 99.84 | |
| KOG1673 | 205 | consensus Ras GTPases [General function prediction | 99.84 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 99.84 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 99.84 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 99.84 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 99.84 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 99.84 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 99.84 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 99.83 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 99.83 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 99.83 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 99.82 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.82 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 99.82 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.82 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 99.82 | |
| KOG3883 | 198 | consensus Ras family small GTPase [Signal transduc | 99.82 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 99.82 | |
| KOG0071 | 180 | consensus GTP-binding ADP-ribosylation factor Arf6 | 99.82 | |
| TIGR00437 | 591 | feoB ferrous iron transporter FeoB. FeoB (773 amin | 99.82 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 99.81 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 99.81 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 99.81 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 99.81 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 99.81 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 99.8 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.8 | |
| KOG0074 | 185 | consensus GTP-binding ADP-ribosylation factor-like | 99.8 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.8 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 99.8 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 99.8 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.8 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 99.8 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 99.79 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 99.79 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 99.79 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 99.79 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 99.79 | |
| KOG4423 | 229 | consensus GTP-binding protein-like, RAS superfamil | 99.79 | |
| KOG0462 | 650 | consensus Elongation factor-type GTP-binding prote | 99.78 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 99.78 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 99.78 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 99.77 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 99.76 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 99.76 | |
| COG2229 | 187 | Predicted GTPase [General function prediction only | 99.76 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 99.75 | |
| KOG0076 | 197 | consensus GTP-binding ADP-ribosylation factor-like | 99.75 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 99.75 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 99.75 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 99.75 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 99.75 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 99.75 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 99.75 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 99.75 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 99.74 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 99.74 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 99.74 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 99.74 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 99.73 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 99.73 | |
| CHL00071 | 409 | tufA elongation factor Tu | 99.73 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 99.73 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 99.72 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 99.72 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 99.72 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 99.72 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 99.71 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 99.71 | |
| KOG1489 | 366 | consensus Predicted GTP-binding protein (ODN super | 99.7 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 99.7 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 99.7 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 99.7 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 99.7 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 99.69 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 99.69 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 99.69 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 99.68 | |
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 99.68 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 99.67 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 99.67 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 99.67 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 99.66 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 99.65 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 99.65 | |
| PF04670 | 232 | Gtr1_RagA: Gtr1/RagA G protein conserved region; I | 99.64 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 99.64 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 99.64 | |
| KOG0072 | 182 | consensus GTP-binding ADP-ribosylation factor-like | 99.62 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 99.62 | |
| KOG0077 | 193 | consensus Vesicle coat complex COPII, GTPase subun | 99.62 | |
| KOG1145 | 683 | consensus Mitochondrial translation initiation fac | 99.6 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 99.59 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 99.58 | |
| KOG1490 | 620 | consensus GTP-binding protein CRFG/NOG1 (ODN super | 99.58 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 99.58 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 99.58 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 99.57 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 99.56 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 99.56 | |
| KOG1423 | 379 | consensus Ras-like GTPase ERA [Cell cycle control, | 99.56 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 99.55 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 99.53 | |
| KOG0090 | 238 | consensus Signal recognition particle receptor, be | 99.53 | |
| COG0536 | 369 | Obg Predicted GTPase [General function prediction | 99.52 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 99.52 | |
| KOG0458 | 603 | consensus Elongation factor 1 alpha [Translation, | 99.5 | |
| smart00010 | 124 | small_GTPase Small GTPase of the Ras superfamily; | 99.5 | |
| KOG1191 | 531 | consensus Mitochondrial GTPase [Translation, ribos | 99.49 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 99.48 | |
| PF00735 | 281 | Septin: Septin; InterPro: IPR000038 Septins consti | 99.46 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 99.44 | |
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 99.43 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 99.43 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 99.41 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 99.4 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 99.4 | |
| PTZ00258 | 390 | GTP-binding protein; Provisional | 99.39 | |
| cd00066 | 317 | G-alpha G protein alpha subunit. The alpha subunit | 99.38 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 99.37 | |
| smart00275 | 342 | G_alpha G protein alpha subunit. Subunit of G prot | 99.36 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 99.34 | |
| KOG0468 | 971 | consensus U5 snRNP-specific protein [Translation, | 99.32 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 99.32 | |
| COG4917 | 148 | EutP Ethanolamine utilization protein [Amino acid | 99.31 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 99.3 | |
| KOG0461 | 522 | consensus Selenocysteine-specific elongation facto | 99.29 | |
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 99.27 | |
| KOG3886 | 295 | consensus GTP-binding protein [Signal transduction | 99.26 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 99.25 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 99.24 | |
| PRK13768 | 253 | GTPase; Provisional | 99.22 | |
| KOG0082 | 354 | consensus G-protein alpha subunit (small G protein | 99.18 | |
| COG5019 | 373 | CDC3 Septin family protein [Cell division and chro | 99.18 | |
| KOG3905 | 473 | consensus Dynein light intermediate chain [Cell mo | 99.17 | |
| TIGR02836 | 492 | spore_IV_A stage IV sporulation protein A. A compa | 99.17 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 99.16 | |
| KOG2655 | 366 | consensus Septin family protein (P-loop GTPase) [C | 99.16 | |
| KOG1954 | 532 | consensus Endocytosis/signaling protein EHD1 [Sign | 99.14 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 99.14 | |
| PRK09601 | 364 | GTP-binding protein YchF; Reviewed | 99.14 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 99.13 | |
| PF05783 | 472 | DLIC: Dynein light intermediate chain (DLIC); Inte | 99.11 | |
| cd01900 | 274 | YchF YchF subfamily. YchF is a member of the Obg f | 99.11 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 99.09 | |
| KOG1486 | 364 | consensus GTP-binding protein DRG2 (ODN superfamil | 99.08 | |
| KOG1547 | 336 | consensus Septin CDC10 and related P-loop GTPases | 99.06 | |
| KOG0410 | 410 | consensus Predicted GTP binding protein [General f | 99.02 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 99.02 | |
| KOG3887 | 347 | consensus Predicted small GTPase involved in nucle | 99.0 | |
| KOG0467 | 887 | consensus Translation elongation factor 2/ribosome | 99.0 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 99.0 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 98.99 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 98.98 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 98.96 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 98.95 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 98.91 | |
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 98.9 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 98.88 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 98.85 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 98.8 | |
| KOG1491 | 391 | consensus Predicted GTP-binding protein (ODN super | 98.76 | |
| COG0012 | 372 | Predicted GTPase, probable translation factor [Tra | 98.76 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 98.74 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 98.74 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 98.73 | |
| TIGR00092 | 368 | GTP-binding protein YchF. This predicted GTP-bindi | 98.73 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 98.72 | |
| KOG0448 | 749 | consensus Mitofusin 1 GTPase, involved in mitochon | 98.71 | |
| KOG2486 | 320 | consensus Predicted GTPase [General function predi | 98.69 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.69 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 98.68 | |
| KOG0460 | 449 | consensus Mitochondrial translation elongation fac | 98.66 | |
| TIGR03348 | 1169 | VI_IcmF type VI secretion protein IcmF. Members of | 98.65 | |
| cd01851 | 224 | GBP Guanylate-binding protein (GBP), N-terminal do | 98.61 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 98.61 | |
| KOG0464 | 753 | consensus Elongation factor G [Translation, riboso | 98.61 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 98.58 | |
| KOG1143 | 591 | consensus Predicted translation elongation factor | 98.55 | |
| KOG3859 | 406 | consensus Septins (P-loop GTPases) [Cell cycle con | 98.53 | |
| COG5258 | 527 | GTPBP1 GTPase [General function prediction only] | 98.52 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 98.51 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 98.49 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 98.48 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 98.48 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 98.48 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 98.47 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 98.46 | |
| KOG0469 | 842 | consensus Elongation factor 2 [Translation, riboso | 98.44 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 98.43 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 98.42 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 98.41 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 98.39 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 98.38 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 98.37 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 98.37 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 98.36 | |
| KOG0099 | 379 | consensus G protein subunit Galphas, small G prote | 98.34 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 98.34 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 98.33 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 98.32 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 98.32 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 98.31 | |
| KOG0465 | 721 | consensus Mitochondrial elongation factor [Transla | 98.28 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 98.27 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 98.26 | |
| PF09547 | 492 | Spore_IV_A: Stage IV sporulation protein A (spore_ | 98.25 | |
| KOG1487 | 358 | consensus GTP-binding protein DRG1 (ODN superfamil | 98.24 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 98.23 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 98.21 | |
| KOG0447 | 980 | consensus Dynamin-like GTP binding protein [Genera | 98.21 | |
| KOG0463 | 641 | consensus GTP-binding protein GP-1 [General functi | 98.21 | |
| PF00503 | 389 | G-alpha: G-protein alpha subunit; InterPro: IPR001 | 98.18 | |
| PF06858 | 58 | NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte | 98.17 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 98.16 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 98.16 | |
| KOG0459 | 501 | consensus Polypeptide release factor 3 [Translatio | 98.16 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 98.09 | |
| KOG1424 | 562 | consensus Predicted GTP-binding protein MMR1 [Gene | 98.09 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 98.09 | |
| COG3523 | 1188 | IcmF Type VI protein secretion system component Va | 98.0 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 97.96 | |
| KOG0085 | 359 | consensus G protein subunit Galphaq/Galphay, small | 97.96 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 97.9 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.88 | |
| PRK13695 | 174 | putative NTPase; Provisional | 97.87 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 97.86 | |
| KOG2484 | 435 | consensus GTPase [General function prediction only | 97.86 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 97.84 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.82 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 97.8 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 97.79 | |
| KOG0466 | 466 | consensus Translation initiation factor 2, gamma s | 97.77 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.74 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 97.73 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 97.73 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 97.72 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 97.72 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.71 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 97.7 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 97.69 | |
| KOG2485 | 335 | consensus Conserved ATP/GTP binding protein [Gener | 97.68 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 97.67 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 97.67 | |
| KOG4273 | 418 | consensus Uncharacterized conserved protein [Funct | 97.65 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.6 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 97.59 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 97.54 | |
| cd02038 | 139 | FleN-like FleN is a member of the Fer4_NifH superf | 97.54 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.54 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.53 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 97.53 | |
| PF05729 | 166 | NACHT: NACHT domain | 97.52 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 97.52 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 97.51 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 97.5 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 97.48 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 97.47 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 97.46 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 97.45 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 97.45 | |
| PRK06217 | 183 | hypothetical protein; Validated | 97.44 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 97.44 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.43 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 97.43 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.42 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 97.42 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 97.41 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.39 | |
| PRK03839 | 180 | putative kinase; Provisional | 97.39 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 97.37 | |
| PRK11537 | 318 | putative GTP-binding protein YjiA; Provisional | 97.37 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 97.37 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 97.37 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.35 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 97.35 | |
| KOG2423 | 572 | consensus Nucleolar GTPase [General function predi | 97.34 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 97.34 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 97.33 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 97.33 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 97.33 | |
| KOG1424 | 562 | consensus Predicted GTP-binding protein MMR1 [Gene | 97.32 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 97.31 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 97.31 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 97.28 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 97.28 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 97.27 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 97.27 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 97.27 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 97.27 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 97.27 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 97.26 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 97.26 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 97.26 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 97.26 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 97.26 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.25 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 97.25 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 97.24 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 97.24 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.24 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 97.24 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 97.23 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 97.23 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 97.22 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.22 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 97.22 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 97.22 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.19 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 97.19 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 97.19 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.18 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 97.17 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 97.16 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.16 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 97.15 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 97.15 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 97.15 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 97.15 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 97.15 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 97.14 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 97.14 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 97.13 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 97.13 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 97.12 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 97.11 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 97.11 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 97.1 | |
| PLN02200 | 234 | adenylate kinase family protein | 97.1 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 97.1 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 97.1 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 97.1 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 97.09 |
| >KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.1e-40 Score=218.30 Aligned_cols=159 Identities=37% Similarity=0.675 Sum_probs=149.8
Q ss_pred CCcccceeeEEEEEcCCCCChHHHHHHHhcCCCCCCCCCceeeeEEEEEEEECCeEEEEEEEeCCCccccccchhhcccc
Q 031126 1 MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRG 80 (165)
Q Consensus 1 m~~~~~~~~~i~i~G~~~~GKSsli~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~g~~~~~~~~~~~~~~ 80 (165)
|++..++.+||+++|++|+|||+|+.||..+.|.+.+..|.+.++..+.++++++.+.+++|||.||+.|+....+++++
T Consensus 2 ~~~~~dylFKiiliGds~VGKtCL~~Rf~~~~f~e~~~sTIGVDf~~rt~e~~gk~iKlQIWDTAGQERFrtit~syYR~ 81 (205)
T KOG0084|consen 2 MNPEYDYLFKIILIGDSGVGKTCLLLRFKDDTFTESYISTIGVDFKIRTVELDGKTIKLQIWDTAGQERFRTITSSYYRG 81 (205)
T ss_pred CCcccceEEEEEEECCCCcChhhhhhhhccCCcchhhcceeeeEEEEEEeeecceEEEEEeeeccccHHHhhhhHhhccC
Confidence 56778899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccEEEEEEeCCChhhHHHHHHHHHHHHHHcCCCCCCCCcEEEEEeCCCCCCCCCchhc-hhHHhhhhcceec-eeeeccc
Q 031126 81 ADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVC-IFCDVFSSIITLS-HTHTHGH 158 (165)
Q Consensus 81 ~~~~i~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~~~~piilv~nK~Dl~~~~~~~~~-~~~~~~~~~~~i~-~~~~s~~ 158 (165)
||++|+|||+++.+||+.+..|+.++.+.... ++|.++||||||+.+. +.++ +.++.|+...++. +.++|||
T Consensus 82 ahGii~vyDiT~~~SF~~v~~Wi~Ei~~~~~~----~v~~lLVGNK~Dl~~~--~~v~~~~a~~fa~~~~~~~f~ETSAK 155 (205)
T KOG0084|consen 82 AHGIIFVYDITKQESFNNVKRWIQEIDRYASE----NVPKLLVGNKCDLTEK--RVVSTEEAQEFADELGIPIFLETSAK 155 (205)
T ss_pred CCeEEEEEEcccHHHhhhHHHHHHHhhhhccC----CCCeEEEeeccccHhh--eecCHHHHHHHHHhcCCcceeecccC
Confidence 99999999999999999999999999998775 7899999999999887 6665 7788999999999 9999999
Q ss_pred cccCCCC
Q 031126 159 TNTHSNQ 165 (165)
Q Consensus 159 ~~~~~~~ 165 (165)
.+.|+++
T Consensus 156 ~~~NVe~ 162 (205)
T KOG0084|consen 156 DSTNVED 162 (205)
T ss_pred CccCHHH
Confidence 9998764
|
|
| >KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0394 consensus Ras-related GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04133 Rop_like Rop subfamily | Back alignment and domain information |
|---|
| >KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >cd01873 RhoBTB RhoBTB subfamily | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >KOG0395 consensus Ras-related GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >PTZ00099 rab6; Provisional | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >KOG1673 consensus Ras GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00437 feoB ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >COG2229 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG0536 Obg Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily | Back alignment and domain information |
|---|
| >KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00258 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd00066 G-alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >smart00275 G_alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3905 consensus Dynein light intermediate chain [Cell motility] | Back alignment and domain information |
|---|
| >TIGR02836 spore_IV_A stage IV sporulation protein A | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK09601 GTP-binding protein YchF; Reviewed | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins | Back alignment and domain information |
|---|
| >cd01900 YchF YchF subfamily | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0410 consensus Predicted GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >TIGR00092 GTP-binding protein YchF | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2486 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03348 VI_IcmF type VI secretion protein IcmF | Back alignment and domain information |
|---|
| >cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5258 GTPBP1 GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A | Back alignment and domain information |
|---|
| >KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] | Back alignment and domain information |
|---|
| >PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] | Back alignment and domain information |
|---|
| >PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >KOG0085 consensus G protein subunit Galphaq/Galphay, small G protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >KOG2484 consensus GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG4273 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK11537 putative GTP-binding protein YjiA; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >KOG2423 consensus Nucleolar GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 165 | ||||
| 1vg1_A | 185 | Gdp-bound Rab7 Length = 185 | 2e-60 | ||
| 1vg0_B | 207 | The Crystal Structures Of The Rep-1 Protein In Comp | 2e-60 | ||
| 3law_A | 207 | Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 | 4e-60 | ||
| 1t91_A | 207 | Crystal Structure Of Human Small Gtpase Rab7(Gtp) L | 1e-59 | ||
| 1ky2_A | 182 | Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 | 1e-53 | ||
| 2ocb_A | 180 | Crystal Structure Of Human Rab9b In Complex With A | 1e-40 | ||
| 1s8f_A | 177 | Crystal Structure Of Rab9 Complexed To Gdp Reveals | 2e-39 | ||
| 1wms_A | 177 | High Resolution Crystal Structure Of Human Rab9 Gtp | 2e-39 | ||
| 1yzl_A | 179 | Gppnhp-Bound Rab9 Gtpase Length = 179 | 1e-38 | ||
| 1yvd_A | 169 | Gppnhp-Bound Rab22 Gtpase Length = 169 | 1e-24 | ||
| 3qbt_A | 174 | Crystal Structure Of Ocrl1 540-678 In Complex With | 2e-24 | ||
| 2fu5_C | 183 | Structure Of Rab8 In Complex With Mss4 Length = 183 | 2e-24 | ||
| 1tu4_A | 171 | Crystal Structure Of Rab5-Gdp Complex Length = 171 | 2e-24 | ||
| 1tu3_A | 171 | Crystal Structure Of Rab5 Complex With Rabaptin5 C- | 2e-24 | ||
| 1n6h_A | 170 | Crystal Structure Of Human Rab5a Length = 170 | 2e-24 | ||
| 3cpj_B | 223 | Crystal Structure Of Ypt31 In Complex With Yeast Ra | 3e-24 | ||
| 1z0j_A | 170 | Structure Of Gtp-Bound Rab22q64l Gtpase In Complex | 3e-24 | ||
| 2hei_A | 179 | Crystal Structure Of Human Rab5b In Complex With Gd | 3e-24 | ||
| 1huq_A | 164 | 1.8a Crystal Structure Of The Monomeric Gtpase Rab5 | 3e-24 | ||
| 1n6o_A | 170 | Crystal Structure Of Human Rab5a A30k Mutant Comple | 4e-24 | ||
| 1n6i_A | 170 | Crystal Structure Of Human Rab5a A30p Mutant Comple | 4e-24 | ||
| 1n6p_A | 170 | Crystal Structure Of Human Rab5a A30e Mutant Comple | 4e-24 | ||
| 1n6n_A | 170 | Crystal Structure Of Human Rab5a A30r Mutant Comple | 5e-24 | ||
| 3bfk_A | 181 | Crystal Structure Of Plasmodium Falciparum Rab11a I | 6e-24 | ||
| 1n6r_A | 170 | Crystal Structure Of Human Rab5a A30l Mutant Comple | 7e-24 | ||
| 1oiv_A | 191 | X-Ray Structure Of The Small G Protein Rab11a In Co | 7e-24 | ||
| 2fg5_A | 192 | Crystal Structure Of Human Rab31 In Complex With A | 8e-24 | ||
| 1yzk_A | 184 | Gppnhp Bound Rab11 Gtpase Length = 184 | 8e-24 | ||
| 3rwm_B | 185 | Crystal Structure Of Ypt32 In Complex With Gppnhp L | 9e-24 | ||
| 1z22_A | 168 | Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Spac | 1e-23 | ||
| 2rhd_A | 175 | Crystal Structure Of Cryptosporidium Parvum Small G | 1e-23 | ||
| 2f9l_A | 199 | 3d Structure Of Inactive Human Rab11b Gtpase Length | 1e-23 | ||
| 2il1_A | 192 | Crystal Structure Of A Predicted Human Gtpase In Co | 1e-23 | ||
| 3mjh_A | 168 | Crystal Structure Of Human Rab5a In Complex With Th | 2e-23 | ||
| 3tkl_A | 196 | Crystal Structure Of The Gtp-Bound Rab1a In Complex | 2e-23 | ||
| 4fmb_B | 171 | Vira-Rab1 Complex Structure Length = 171 | 2e-23 | ||
| 2fol_A | 191 | Crystal Structure Of Human Rab1a In Complex With Gd | 2e-23 | ||
| 4fmc_B | 171 | Espg-Rab1 Complex Length = 171 | 2e-23 | ||
| 3l0i_B | 199 | Complex Structure Of Sidm/drra With The Wild Type R | 2e-23 | ||
| 1z07_A | 166 | Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 | 3e-23 | ||
| 1z0d_A | 167 | Gdp-bound Rab5c Gtpase Length = 167 | 3e-23 | ||
| 3sfv_A | 181 | Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan | 3e-23 | ||
| 2bmd_A | 186 | High Resolution Structure Of Gdp-Bound Human Rab4a | 4e-23 | ||
| 2a5j_A | 191 | Crystal Structure Of Human Rab2b Length = 191 | 4e-23 | ||
| 4fmd_F | 164 | Espg-Rab1 Complex Structure At 3.05 A Length = 164 | 5e-23 | ||
| 1yu9_A | 175 | Gppnhp-Bound Rab4a Length = 175 | 6e-23 | ||
| 1oiw_A | 191 | X-ray Structure Of The Small G Protein Rab11a In Co | 6e-23 | ||
| 2hv8_A | 172 | Crystal Structure Of Gtp-Bound Rab11 In Complex Wit | 6e-23 | ||
| 1ek0_A | 170 | Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 | 8e-23 | ||
| 1g17_A | 170 | Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) | 8e-23 | ||
| 3jza_A | 175 | Crystal Structure Of Human Rab1b In Complex With Th | 8e-23 | ||
| 4i1o_A | 181 | Crystal Structure Of The Legionella Pneumophila Gap | 9e-23 | ||
| 3tw8_B | 181 | Gef Domain Of Dennd 1b In Complex With Rab Gtpase R | 9e-23 | ||
| 1x3s_A | 195 | Crystal Structure Of Human Rab18 In Complex With Gp | 9e-23 | ||
| 2gzd_A | 173 | Crystal Structure Of Rab11 In Complex With Rab11-Fi | 1e-22 | ||
| 3cph_A | 213 | Crystal Structure Of Sec4 In Complex With Rab-Gdi L | 1e-22 | ||
| 2eqb_A | 174 | Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 | 1e-22 | ||
| 2d7c_A | 167 | Crystal Structure Of Human Rab11 In Complex With Fi | 1e-22 | ||
| 1g16_A | 170 | Crystal Structure Of Sec4-Gdp Length = 170 | 2e-22 | ||
| 2wwx_A | 175 | Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra | 2e-22 | ||
| 4fmc_F | 117 | Espg-Rab1 Complex Length = 117 | 2e-22 | ||
| 1z08_A | 170 | Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 | 3e-22 | ||
| 1z0a_A | 174 | Gdp-Bound Rab2a Gtpase Length = 174 | 3e-22 | ||
| 2fe4_A | 171 | The Crystal Structure Of Human Neuronal Rab6b In It | 3e-22 | ||
| 2ocy_C | 170 | Complex Of The Guanine Exchange Factor Sec2p And Th | 3e-22 | ||
| 1yzq_A | 170 | Gppnhp-Bound Rab6 Gtpase Length = 170 | 3e-22 | ||
| 1z0k_A | 172 | Structure Of Gtp-Bound Rab4q67l Gtpase In Complex W | 4e-22 | ||
| 2o52_A | 200 | Crystal Structure Of Human Rab4b In Complex With Gd | 4e-22 | ||
| 2gil_A | 162 | Structure Of The Extremely Slow Gtpase Rab6a In The | 4e-22 | ||
| 2y8e_A | 179 | Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo | 7e-22 | ||
| 1ukv_Y | 206 | Structure Of Rabgdp-Dissociation Inhibitor In Compl | 8e-22 | ||
| 2bcg_Y | 206 | Structure Of Doubly Prenylated Ypt1:gdi Complex Len | 9e-22 | ||
| 1z0f_A | 179 | Gdp-Bound Rab14 Gtpase Length = 179 | 9e-22 | ||
| 3rab_A | 169 | Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 | 9e-22 | ||
| 2f7s_A | 217 | The Crystal Structure Of Human Rab27b Bound To Gdp | 1e-21 | ||
| 3dz8_A | 191 | Crystal Structure Of Human Rab3b Gtpase Bound With | 2e-21 | ||
| 1yzn_A | 185 | Gppnhp-Bound Ypt1p Gtpase Length = 185 | 2e-21 | ||
| 1yzt_A | 184 | Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng | 2e-21 | ||
| 2gf9_A | 189 | Crystal Structure Of Human Rab3d In Complex With Gd | 2e-21 | ||
| 3bc1_A | 195 | Crystal Structure Of The Complex Rab27a-slp2a Lengt | 2e-21 | ||
| 1yzu_A | 170 | Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng | 2e-21 | ||
| 2efc_B | 181 | Ara7-GdpATVPS9A Length = 181 | 2e-21 | ||
| 3cwz_A | 188 | Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 | 3e-21 | ||
| 2ew1_A | 201 | Crystal Structure Of Rab30 In Complex With A Gtp An | 4e-21 | ||
| 4dkx_A | 216 | Crystal Structure Of The Rab 6a'(Q72l) Length = 216 | 4e-21 | ||
| 3bbp_A | 211 | Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = | 5e-21 | ||
| 2if0_A | 200 | Crystal Structure Of Mouse Rab27b Bound To Gdp In M | 5e-21 | ||
| 2iey_A | 195 | Crystal Structure Of Mouse Rab27b Bound To Gdp In H | 5e-21 | ||
| 4drz_A | 196 | Crystal Structure Of Human Rab14 Length = 196 | 6e-21 | ||
| 2zet_A | 203 | Crystal Structure Of The Small Gtpase Rab27b Comple | 6e-21 | ||
| 2iez_A | 220 | Crystal Structure Of Mouse Rab27b Bound To Gdp In M | 8e-21 | ||
| 2g77_B | 198 | Crystal Structure Of Gyp1 Tbc Domain In Complex Wit | 1e-20 | ||
| 1z06_A | 189 | Gppnhp-Bound Rab33 Gtpase Length = 189 | 2e-20 | ||
| 2g6b_A | 180 | Crystal Structure Of Human Rab26 In Complex With A | 2e-20 | ||
| 1zbd_A | 203 | Structural Basis Of Rab Effector Specificity: Cryst | 3e-20 | ||
| 1d5c_A | 162 | Crystal Structure Of Plasmodium Falciparum Rab6 Com | 5e-20 | ||
| 2hup_A | 201 | Crystal Structure Of Human Rab43 In Complex With Gd | 1e-19 | ||
| 2p5s_A | 199 | Rab Domain Of Human Rasef In Complex With Gdp Lengt | 2e-19 | ||
| 3tso_A | 178 | Structure Of The Cancer Associated Rab25 Protein In | 2e-19 | ||
| 2oil_A | 193 | Crystal Structure Of Human Rab25 In Complex With Gd | 3e-19 | ||
| 2hxs_A | 178 | Crystal Structure Of Rab28a Gtpase In The Inactive | 5e-18 | ||
| 3gj0_A | 221 | Crystal Structure Of Human Rangdp Length = 221 | 8e-17 | ||
| 3ea5_A | 216 | Kap95p Binding Induces The Switch Loops Of Rangdp T | 8e-17 | ||
| 1rrp_A | 204 | Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = | 8e-17 | ||
| 1qg2_A | 216 | Canine Gdp-Ran R76e Mutant Length = 216 | 8e-17 | ||
| 1a2k_C | 216 | Gdpran-Ntf2 Complex Length = 216 | 9e-17 | ||
| 1wa5_A | 176 | Crystal Structure Of The Exportin Cse1p Complexed W | 1e-16 | ||
| 1qbk_C | 216 | Structure Of The Karyopherin Beta2-ran Gppnhp Nucle | 1e-16 | ||
| 4djt_A | 218 | Crystal Structure Of A Nuclear Gtp-Binding Protein | 2e-16 | ||
| 1qg4_A | 216 | Canine Gdp-Ran F72y Mutant Length = 216 | 2e-16 | ||
| 1byu_A | 216 | Canine Gdp-Ran Length = 216 | 3e-16 | ||
| 2bku_A | 177 | Kap95p:rangtp Complex Length = 177 | 3e-16 | ||
| 3m1i_A | 219 | Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex | 5e-16 | ||
| 2x19_A | 172 | Crystal Structure Of Importin13 - Rangtp Complex Le | 6e-16 | ||
| 3icq_B | 171 | Karyopherin Nuclear State Length = 171 | 6e-16 | ||
| 3nc1_C | 182 | Crystal Structure Of The Crm1-Rangtp Complex Length | 6e-16 | ||
| 3nby_C | 176 | Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclea | 6e-16 | ||
| 3ran_A | 216 | Canine Gdp-Ran Q69l Mutant Length = 216 | 6e-16 | ||
| 3gj4_A | 221 | Crystal Structure Of Human Rangdp-Nup153znf3 Comple | 7e-16 | ||
| 1jah_A | 166 | H-Ras P21 Protein Mutant G12p, Complexed With Guano | 5e-15 | ||
| 3brw_D | 167 | Structure Of The Rap-Rapgap Complex Length = 167 | 1e-14 | ||
| 1agp_A | 166 | Three-Dimensional Structures And Properties Of A Tr | 1e-14 | ||
| 421p_A | 166 | Three-Dimensional Structures Of H-Ras P21 Mutants: | 2e-14 | ||
| 1clu_A | 166 | H-Ras Complexed With Diaminobenzophenone-Beta,Gamma | 2e-14 | ||
| 4dxa_A | 169 | Co-Crystal Structure Of Rap1 In Complex With Krit1 | 2e-14 | ||
| 4dso_A | 189 | Small-Molecule Ligands Bind To A Distinct Pocket In | 3e-14 | ||
| 1gua_A | 167 | Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 | 3e-14 | ||
| 2j0v_A | 212 | The Crystal Structure Of Arabidopsis Thaliana Rac7- | 4e-14 | ||
| 1c1y_A | 167 | Crystal Structure Of Rap.Gmppnp In Complex With The | 4e-14 | ||
| 4epr_A | 170 | Discovery Of Small Molecules That Bind To K-Ras And | 5e-14 | ||
| 2j1l_A | 214 | Crystal Structure Of Human Rho-Related Gtp-Binding | 1e-13 | ||
| 2bov_A | 206 | Molecular Recognition Of An Adp-Ribosylating Clostr | 3e-13 | ||
| 1u8y_A | 168 | Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal | 3e-13 | ||
| 2a78_A | 187 | Crystal Structure Of The C3bot-Rala Complex Reveals | 4e-13 | ||
| 1uad_A | 175 | Crystal Structure Of The Rala-gppnhp-sec5 Ral-bindi | 4e-13 | ||
| 3clv_A | 208 | Crystal Structure Of Rab5a From Plasmodium Falcipar | 1e-12 | ||
| 3oes_A | 201 | Crystal Structure Of The Small Gtpase Rhebl1 Length | 2e-12 | ||
| 2ke5_A | 174 | Solution Structure And Dynamics Of The Small Gtpase | 3e-12 | ||
| 1zc3_A | 175 | Crystal Structure Of The Ral-Binding Domain Of Exo8 | 3e-12 | ||
| 2kwi_A | 178 | Ralb-Rlip76 (Ralbp1) Complex Length = 178 | 3e-12 | ||
| 2wbl_C | 180 | Three-Dimensional Structure Of A Binary Rop-Prone C | 3e-12 | ||
| 3bwd_D | 182 | Crystal Structure Of The Plant Rho Protein Rop5 Len | 4e-12 | ||
| 2atx_A | 194 | Crystal Structure Of The Tc10 Gppnhp Complex Length | 7e-12 | ||
| 2nty_C | 180 | Rop4-Gdp-Prone8 Length = 180 | 8e-12 | ||
| 3ref_B | 194 | Crystal Structure Of Ehrho1 Bound To Gdp And Magnes | 9e-12 | ||
| 4dvg_A | 188 | Crystal Structure Of E. Histolytica Formin1 Bound T | 1e-11 | ||
| 2ery_A | 172 | The Crystal Structure Of The Ras Related Protein Rr | 4e-11 | ||
| 2h7v_A | 188 | Co-crystal Structure Of Ypka-rac1 Length = 188 | 4e-11 | ||
| 1hh4_A | 192 | Rac1-Rhogdi Complex Involved In Nadph Oxidase Activ | 4e-11 | ||
| 2odb_A | 192 | The Crystal Structure Of Human Cdc42 In Complex Wit | 4e-11 | ||
| 1mh1_A | 186 | Small G-Protein Length = 186 | 5e-11 | ||
| 1g4u_R | 184 | Crystal Structure Of The Salmonella Tyrosine Phosph | 5e-11 | ||
| 1grn_A | 191 | Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. | 5e-11 | ||
| 1am4_D | 177 | Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. S | 5e-11 | ||
| 2dfk_B | 194 | Crystal Structure Of The Cdc42-Collybistin Ii Compl | 5e-11 | ||
| 3eg5_A | 178 | Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex W | 5e-11 | ||
| 2qrz_A | 189 | Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is | 5e-11 | ||
| 1cee_A | 179 | Solution Structure Of Cdc42 In Complex With The Gtp | 5e-11 | ||
| 1ees_A | 178 | Solution Structure Of Cdc42hs Complexed With A Pept | 5e-11 | ||
| 2wm9_B | 190 | Structure Of The Complex Between Dock9 And Cdc42. L | 6e-11 | ||
| 1an0_A | 190 | Cdc42hs-Gdp Complex Length = 190 | 6e-11 | ||
| 4did_A | 193 | Crystal Structure Of Salmonella Effector N-Terminal | 6e-11 | ||
| 1kz7_B | 188 | Crystal Structure Of The DhPH FRAGMENT OF MURINE DB | 6e-11 | ||
| 1gzs_A | 180 | Crystal Structure Of The Complex Between The Gef Do | 6e-11 | ||
| 1a4r_B | 191 | G12v Mutant Of Human Placental Cdc42 Gtpase In The | 6e-11 | ||
| 2yc2_C | 208 | Intraflagellar Transport Complex 25-27 From Chlamyd | 6e-11 | ||
| 3gcg_A | 182 | Crystal Structure Of Map And Cdc42 Complex Length = | 6e-11 | ||
| 1aje_A | 194 | Cdc42 From Human, Nmr, 20 Structures Length = 194 | 7e-11 | ||
| 1doa_A | 191 | Structure Of The Rho Family Gtp-Binding Protein Cdc | 7e-11 | ||
| 3sbd_A | 187 | Crystal Structure Of Rac1 P29s Mutant Length = 187 | 7e-11 | ||
| 3i3s_R | 166 | Crystal Structure Of H-Ras With Thr50 Replaced By I | 8e-11 | ||
| 2vrw_A | 184 | Critical Structural Role For The Ph And C1 Domains | 1e-10 | ||
| 1i4d_D | 192 | Crystal Structure Analysis Of Rac1-Gdp Complexed Wi | 1e-10 | ||
| 1he1_C | 176 | Crystal Structure Of The Complex Between The Gap Do | 1e-10 | ||
| 3qbv_A | 178 | Structure Of Designed Orthogonal Interaction Betwee | 1e-10 | ||
| 2c5l_A | 173 | Structure Of Plc Epsilon Ras Association Domain Wit | 1e-10 | ||
| 1foe_B | 177 | Crystal Structure Of Rac1 In Complex With The Guani | 1e-10 | ||
| 3sua_A | 184 | Crystal Structure Of The Intracellular Domain Of Pl | 1e-10 | ||
| 2fju_A | 178 | Activated Rac1 Bound To Its Effector Phospholipase | 1e-10 | ||
| 4q21_A | 189 | Molecular Switch For Signal Transduction: Structura | 1e-10 | ||
| 3th5_A | 204 | Crystal Structure Of Wild-Type Rac1 Length = 204 | 2e-10 | ||
| 4efm_A | 171 | Crystal Structure Of H-Ras G12v In Complex With Gpp | 2e-10 | ||
| 4efl_A | 171 | Crystal Structure Of H-Ras Wt In Complex With Gppnh | 2e-10 | ||
| 3v4f_A | 166 | H-Ras Peg 400CACL2, ORDERED OFF Length = 166 | 2e-10 | ||
| 2yin_C | 196 | Structure Of The Complex Between Dock2 And Rac1. Le | 2e-10 | ||
| 6q21_A | 171 | Molecular Switch For Signal Transduction: Structura | 2e-10 | ||
| 2q21_A | 171 | Crystal Structures At 2.2 Angstroms Resolution Of T | 2e-10 | ||
| 1wq1_R | 166 | Ras-Rasgap Complex Length = 166 | 2e-10 | ||
| 1rvd_A | 166 | H-Ras Complexed With Diaminobenzophenone-Beta,Gamma | 2e-10 | ||
| 2kb0_A | 178 | Cdc42(T35a) Length = 178 | 2e-10 | ||
| 2ase_A | 178 | Nmr Structure Of The F28l Mutant Of Cdc42hs Length | 2e-10 | ||
| 2x1v_A | 166 | Crystal Structure Of The Activating H-Ras I163f Mut | 2e-10 | ||
| 1lfd_B | 167 | Crystal Structure Of The Active Ras Protein Complex | 3e-10 | ||
| 221p_A | 166 | Three-Dimensional Structures Of H-Ras P21 Mutants: | 3e-10 | ||
| 2cld_X | 166 | Crystal Structure Analysis Of A Fluorescent Form Of | 3e-10 | ||
| 3ddc_A | 166 | Crystal Structure Of Nore1a In Complex With Ras Len | 3e-10 | ||
| 3vhl_B | 195 | Crystal Structure Of The Dhr-2 Domain Of Dock8 In C | 3e-10 | ||
| 3lo5_A | 166 | Crystal Structure Of The Dominant Negative S17n Mut | 4e-10 | ||
| 2quz_A | 166 | Crystal Structure Of The Activating H-Rask117r Muta | 4e-10 | ||
| 2atv_A | 196 | The Crystal Structure Of Human Rerg In The Gdp Boun | 4e-10 | ||
| 1nf3_A | 195 | Structure Of Cdc42 In A Complex With The Gtpase-Bin | 4e-10 | ||
| 1cf4_A | 184 | Cdc42ACK GTPASE-Binding Domain Complex Length = 184 | 4e-10 | ||
| 2gco_A | 201 | Crystal Structure Of The Human Rhoc-gppnhp Complex | 4e-10 | ||
| 3kkm_A | 172 | Crystal Structure Of H-Ras T35s In Complex With Gpp | 4e-10 | ||
| 3pir_A | 183 | Crystal Structure Of M-Rasd41e In Complex With Gppn | 4e-10 | ||
| 3kkp_A | 183 | Crystal Structure Of M-Ras P40d In Complex With Gpp | 5e-10 | ||
| 2gcn_A | 201 | Crystal Structure Of The Human Rhoc-Gdp Complex Len | 5e-10 | ||
| 4epx_A | 170 | Discovery Of Small Molecules That Bind To K-Ras And | 5e-10 | ||
| 4ept_A | 170 | Discovery Of Small Molecules That Bind To K-Ras And | 5e-10 | ||
| 1iaq_A | 166 | C-H-Ras P21 Protein Mutant With Thr 35 Replaced By | 5e-10 | ||
| 2c2h_A | 192 | Crystal Structure Of The Human Rac3 In Complex With | 5e-10 | ||
| 2ic5_A | 180 | Crystal Structure Of Human Rac3 Grown In The Presen | 5e-10 | ||
| 2g0n_A | 179 | The Crystal Structure Of The Human Rac3 In Complex | 5e-10 | ||
| 621p_A | 166 | Three-Dimensional Structures Of H-Ras P21 Mutants: | 5e-10 | ||
| 1s1c_A | 183 | Crystal Structure Of The Complex Between The Human | 6e-10 | ||
| 4gzm_A | 204 | Crystal Structure Of Rac1 F28l Mutant Length = 204 | 6e-10 | ||
| 3kz1_E | 182 | Crystal Structure Of The Complex Of Pdz-Rhogef DhPH | 6e-10 | ||
| 3lw8_A | 185 | Shigella Ipgb2 In Complex With Human Rhoa, Gdp And | 6e-10 | ||
| 1lf0_A | 166 | Crystal Structure Of Rasa59g In The Gtp-Bound Form | 6e-10 | ||
| 1e96_A | 192 | Structure Of The RacP67PHOX COMPLEX Length = 192 | 6e-10 | ||
| 521p_A | 166 | Three-Dimensional Structures Of H-Ras P21 Mutants: | 6e-10 | ||
| 3tvd_A | 193 | Crystal Structure Of Mouse Rhoa-Gtp Complex Length | 6e-10 | ||
| 2rgb_A | 166 | Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 | 6e-10 | ||
| 1x86_B | 196 | Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-A | 6e-10 | ||
| 4f38_A | 195 | Crystal Structure Of Geranylgeranylated Rhoa In Com | 6e-10 | ||
| 3kko_A | 183 | Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX | 6e-10 | ||
| 1ds6_A | 192 | Crystal Structure Of A Rac-Rhogdi Complex Length = | 6e-10 | ||
| 3b13_B | 184 | Crystal Structure Of The Dhr-2 Domain Of Dock2 In C | 6e-10 | ||
| 1i4t_D | 192 | Crystal Structure Analysis Of Rac1-Gmppnp In Comple | 6e-10 | ||
| 3k9n_A | 166 | Allosteric Modulation Of H-Ras Gtpase Length = 166 | 7e-10 | ||
| 1nvv_Q | 166 | Structural Evidence For Feedback Activation By Rasg | 7e-10 | ||
| 1lb1_B | 192 | Crystal Structure Of The Dbl And Pleckstrin Homolog | 7e-10 | ||
| 1cxz_A | 182 | Crystal Structure Of Human Rhoa Complexed With The | 8e-10 | ||
| 3con_A | 190 | Crystal Structure Of The Human Nras Gtpase Bound Wi | 8e-10 | ||
| 3ryt_C | 180 | The Plexin A1 Intracellular Region In Complex With | 9e-10 | ||
| 1xcm_A | 167 | Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mu | 9e-10 | ||
| 1xj0_A | 166 | Crystal Structure Of The Gdp-Bound Form Of The Rasg | 9e-10 | ||
| 1x1r_A | 178 | Crystal Structure Of M-Ras In Complex With Gdp Leng | 1e-09 | ||
| 4gzl_A | 204 | Crystal Structure Of Rac1 Q61l Mutant Length = 204 | 1e-09 | ||
| 2w2t_A | 185 | Rac2 (G12v) In Complex With Gdp Length = 185 | 1e-09 | ||
| 1zw6_A | 166 | Crystal Structure Of The Gtp-Bound Form Of Rasq61g | 1e-09 | ||
| 3gft_A | 187 | Human K-Ras In Complex With A Gtp Analogue Length = | 1e-09 | ||
| 4efn_A | 171 | Crystal Structure Of H-Ras Q61l In Complex With Gpp | 1e-09 | ||
| 2w2v_A | 184 | Rac2 (G12v) In Complex With Gtpgs Length = 184 | 1e-09 | ||
| 1zvq_A | 166 | Structure Of The Q61g Mutant Of Ras In The Gdp-Boun | 1e-09 | ||
| 1xtq_A | 177 | Structure Of Small Gtpase Human Rheb In Complex Wit | 1e-09 | ||
| 3t5g_A | 181 | Structure Of Fully Modified Farnesylated Rheb In Co | 1e-09 | ||
| 721p_A | 166 | Three-Dimensional Structures Of H-Ras P21 Mutants: | 1e-09 | ||
| 2rgc_A | 166 | Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 | 2e-09 | ||
| 2rga_A | 166 | Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 | 2e-09 | ||
| 1z2c_A | 193 | Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With | 2e-09 | ||
| 2l0x_A | 169 | Solution Structure Of The 21 Kda Gtpase Rheb Bound | 2e-09 | ||
| 2wkp_A | 332 | Structure Of A Photoactivatable Rac1 Containing Lov | 2e-09 | ||
| 1tx4_B | 177 | RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 | 2e-09 | ||
| 3msx_A | 180 | Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With | 2e-09 | ||
| 2wkr_A | 332 | Structure Of A Photoactivatable Rac1 Containing The | 2e-09 | ||
| 1xcg_B | 178 | Crystal Structure Of Human Rhoa In Complex With DhP | 2e-09 | ||
| 1ow3_B | 193 | Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With | 2e-09 | ||
| 2wkq_A | 332 | Structure Of A Photoactivatable Rac1 Containing The | 2e-09 | ||
| 1cc0_A | 190 | Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Le | 2e-09 | ||
| 2q3h_A | 201 | The Crystal Structure Of Rhoua In The Gdp-bound Sta | 2e-09 | ||
| 2fv8_A | 207 | The Crystal Structure Of Rhob In The Gdp-Bound Stat | 3e-09 | ||
| 2cl0_X | 166 | Crystal Structure Analysis Of A Fluorescent Form Of | 3e-09 | ||
| 1dpf_A | 180 | Crystal Structure Of A Mg-Free Form Of Rhoa Complex | 5e-09 | ||
| 3d6t_B | 171 | Structure Of The Roc Domain From The Parkinson's Di | 5e-09 | ||
| 2erx_A | 172 | Crystal Structure Of Diras2 In Complex With Gdp And | 5e-09 | ||
| 2zej_A | 184 | Structure Of The Roc Domain From The Parkinson's Di | 6e-09 | ||
| 3rap_R | 167 | The Small G Protein Rap2 In A Non Catalytic Complex | 7e-09 | ||
| 1kmq_A | 184 | Crystal Structure Of A Constitutively Activated Rho | 2e-08 | ||
| 3sea_A | 167 | Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo | 2e-08 | ||
| 1ryf_A | 203 | Alternative Splicing Of Rac1 Generates Rac1b, A Sel | 2e-08 | ||
| 2fn4_A | 181 | The Crystal Structure Of Human Ras-Related Protein, | 6e-08 | ||
| 1gwn_A | 205 | The Crystal Structure Of The Core Domain Of RhoeRND | 1e-07 | ||
| 1m7b_A | 184 | Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATI | 1e-07 | ||
| 2v55_B | 200 | Mechanism Of Multi-site Phosphorylation From A Rock | 1e-07 | ||
| 2rex_B | 197 | Crystal Structure Of The Effector Domain Of Plxnb1 | 1e-07 | ||
| 2cls_A | 198 | The Crystal Structure Of The Human Rnd1 Gtpase In T | 1e-07 | ||
| 3a58_B | 188 | Crystal Structure Of Sec3p - Rho1p Complex From Sac | 2e-07 | ||
| 3q3j_B | 214 | Crystal Structure Of Plexin A2 Rbd In Complex With | 2e-07 | ||
| 2nzj_A | 175 | The Crystal Structure Of Rem1 In Complex With Gdp L | 7e-07 | ||
| 2al7_A | 186 | Structure Of Human Adp-Ribosylation Factor-Like 10c | 2e-06 | ||
| 1zd9_A | 188 | Structure Of Human Adp-Ribosylation Factor-Like 10b | 4e-06 | ||
| 2h18_A | 193 | Structure Of Human Adp-Ribosylation Factor-Like 10b | 2e-05 | ||
| 3ihw_A | 184 | Crystal Structure Of The Ras-Like Domain Of Centg3 | 5e-05 | ||
| 3qq5_A | 423 | Crystal Structure Of The [fefe]-Hydrogenase Maturat | 5e-05 | ||
| 4bas_A | 199 | Structure Of The Arl6 Bbs3 Small Gtpase From Trypan | 6e-05 | ||
| 3tjz_A | 164 | Crystal Structure Of Arf1 Bound To The GammaZETA-Co | 6e-05 | ||
| 2k5u_A | 181 | Solution Structure Of Myirstoylated Yeast Arf1 Prot | 7e-05 | ||
| 1mr3_F | 181 | Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 | 1e-04 | ||
| 3rd1_A | 178 | Structure Of An Adp Ribosylation Factor From Entamo | 1e-04 | ||
| 4goj_A | 189 | The Crystal Structure Of Full Length Arl3gppnhp In | 2e-04 | ||
| 1fzq_A | 181 | Crystal Structure Of Murine Arl3-Gdp Length = 181 | 2e-04 | ||
| 1yzg_A | 179 | Structure Of Human Adp-ribosylation Factor-like 8 L | 2e-04 | ||
| 2gf0_A | 199 | The Crystal Structure Of The Human Diras1 Gtpase In | 3e-04 | ||
| 3bh7_A | 164 | Crystal Structure Of The Rp2-Arl3 Complex Bound To | 3e-04 | ||
| 1ksg_A | 186 | Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt | 3e-04 | ||
| 3doe_A | 192 | Complex Of Arl2 And Bart, Crystal Form 1 Length = 1 | 3e-04 | ||
| 1ksh_A | 186 | Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati | 3e-04 | ||
| 4aii_A | 180 | Crystal Structure Of The Rat Rem2 Gtpase - G Domain | 3e-04 | ||
| 3c5c_A | 187 | Crystal Structure Of Human Ras-Like, Family 12 Prot | 4e-04 | ||
| 3lrp_A | 181 | Crystal Structure Of Plasmodium Falciparum Adp-Ribo | 5e-04 | ||
| 3dpu_A | 535 | Roccor Domain Tandem Of Rab Family Protein (Roco) L | 6e-04 | ||
| 1z6y_A | 179 | Structure Of Human Adp-Ribosylation Factor-Like 5 L | 7e-04 | ||
| 1zj6_A | 187 | Crystal Structure Of Human Arl5 Length = 187 | 7e-04 |
| >pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 | Back alignment and structure |
|
| >pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 | Back alignment and structure |
| >pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 | Back alignment and structure |
| >pdb|1T91|A Chain A, Crystal Structure Of Human Small Gtpase Rab7(Gtp) Length = 207 | Back alignment and structure |
| >pdb|1KY2|A Chain A, Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 | Back alignment and structure |
| >pdb|2OCB|A Chain A, Crystal Structure Of Human Rab9b In Complex With A Gtp Analogue Length = 180 | Back alignment and structure |
| >pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii Length = 177 | Back alignment and structure |
| >pdb|1WMS|A Chain A, High Resolution Crystal Structure Of Human Rab9 Gtpase: A Novel Antiviral Drug Target Length = 177 | Back alignment and structure |
| >pdb|1YZL|A Chain A, Gppnhp-Bound Rab9 Gtpase Length = 179 | Back alignment and structure |
| >pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 | Back alignment and structure |
| >pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 | Back alignment and structure |
| >pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 | Back alignment and structure |
| >pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 | Back alignment and structure |
| >pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 | Back alignment and structure |
| >pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 | Back alignment and structure |
| >pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 | Back alignment and structure |
| >pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 | Back alignment and structure |
| >pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 | Back alignment and structure |
| >pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Monomeric Gtpase Rab5c (Mouse) Length = 164 | Back alignment and structure |
| >pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 | Back alignment and structure |
| >pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 | Back alignment and structure |
| >pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 | Back alignment and structure |
| >pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 | Back alignment and structure |
| >pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 | Back alignment and structure |
| >pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 | Back alignment and structure |
| >pdb|1Z22|A Chain A, Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Space Group Length = 168 | Back alignment and structure |
| >pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 | Back alignment and structure |
| >pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 | Back alignment and structure |
| >pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 | Back alignment and structure |
| >pdb|3MJH|A Chain A, Crystal Structure Of Human Rab5a In Complex With The C2h2 Zinc Finger Of Eea1 Length = 168 | Back alignment and structure |
| >pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 | Back alignment and structure |
| >pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 | Back alignment and structure |
| >pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 | Back alignment and structure |
| >pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 | Back alignment and structure |
| >pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 | Back alignment and structure |
| >pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 | Back alignment and structure |
| >pdb|1Z0D|A Chain A, Gdp-bound Rab5c Gtpase Length = 167 | Back alignment and structure |
| >pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 | Back alignment and structure |
| >pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 | Back alignment and structure |
| >pdb|2A5J|A Chain A, Crystal Structure Of Human Rab2b Length = 191 | Back alignment and structure |
| >pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 | Back alignment and structure |
| >pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 | Back alignment and structure |
| >pdb|1OIW|A Chain A, X-ray Structure Of The Small G Protein Rab11a In Complex With Gtpgammas Length = 191 | Back alignment and structure |
| >pdb|2HV8|A Chain A, Crystal Structure Of Gtp-Bound Rab11 In Complex With Fip3 Length = 172 | Back alignment and structure |
| >pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 | Back alignment and structure |
| >pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 | Back alignment and structure |
| >pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 | Back alignment and structure |
| >pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 | Back alignment and structure |
| >pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 | Back alignment and structure |
| >pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 | Back alignment and structure |
| >pdb|2GZD|A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 Length = 173 | Back alignment and structure |
| >pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 | Back alignment and structure |
| >pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 | Back alignment and structure |
| >pdb|2D7C|A Chain A, Crystal Structure Of Human Rab11 In Complex With Fip3 Rab- Binding Domain Length = 167 | Back alignment and structure |
| >pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 | Back alignment and structure |
| >pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 | Back alignment and structure |
| >pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 | Back alignment and structure |
| >pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 | Back alignment and structure |
| >pdb|1Z0A|A Chain A, Gdp-Bound Rab2a Gtpase Length = 174 | Back alignment and structure |
| >pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 | Back alignment and structure |
| >pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 | Back alignment and structure |
| >pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 | Back alignment and structure |
| >pdb|1Z0K|A Chain A, Structure Of Gtp-Bound Rab4q67l Gtpase In Complex With The Central Rab Binding Domain Of Rabenosyn-5 Length = 172 | Back alignment and structure |
| >pdb|2O52|A Chain A, Crystal Structure Of Human Rab4b In Complex With Gdp Length = 200 | Back alignment and structure |
| >pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 | Back alignment and structure |
| >pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 | Back alignment and structure |
| >pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 | Back alignment and structure |
| >pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 | Back alignment and structure |
| >pdb|1Z0F|A Chain A, Gdp-Bound Rab14 Gtpase Length = 179 | Back alignment and structure |
| >pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 | Back alignment and structure |
| >pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 | Back alignment and structure |
| >pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 | Back alignment and structure |
| >pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 | Back alignment and structure |
| >pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 | Back alignment and structure |
| >pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 | Back alignment and structure |
| >pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 | Back alignment and structure |
| >pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 | Back alignment and structure |
| >pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 | Back alignment and structure |
| >pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 | Back alignment and structure |
| >pdb|2EW1|A Chain A, Crystal Structure Of Rab30 In Complex With A Gtp Analogue Length = 201 | Back alignment and structure |
| >pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 | Back alignment and structure |
| >pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 | Back alignment and structure |
| >pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 | Back alignment and structure |
| >pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 | Back alignment and structure |
| >pdb|4DRZ|A Chain A, Crystal Structure Of Human Rab14 Length = 196 | Back alignment and structure |
| >pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 | Back alignment and structure |
| >pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 | Back alignment and structure |
| >pdb|2G77|B Chain B, Crystal Structure Of Gyp1 Tbc Domain In Complex With Rab33 Gtpase Bound To Gdp And Alf3 Length = 198 | Back alignment and structure |
| >pdb|1Z06|A Chain A, Gppnhp-Bound Rab33 Gtpase Length = 189 | Back alignment and structure |
| >pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 | Back alignment and structure |
| >pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 | Back alignment and structure |
| >pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 | Back alignment and structure |
| >pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 | Back alignment and structure |
| >pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 | Back alignment and structure |
| >pdb|3TSO|A Chain A, Structure Of The Cancer Associated Rab25 Protein In Complex With Fip2 Length = 178 | Back alignment and structure |
| >pdb|2OIL|A Chain A, Crystal Structure Of Human Rab25 In Complex With Gdp Length = 193 | Back alignment and structure |
| >pdb|2HXS|A Chain A, Crystal Structure Of Rab28a Gtpase In The Inactive (Gdp-3'p- Bound) Form Length = 178 | Back alignment and structure |
| >pdb|3GJ0|A Chain A, Crystal Structure Of Human Rangdp Length = 221 | Back alignment and structure |
| >pdb|3EA5|A Chain A, Kap95p Binding Induces The Switch Loops Of Rangdp To Adopt The Gtp- Bound Conformation: Implications For Nuclear Import Complex Assembly Dynamics Length = 216 | Back alignment and structure |
| >pdb|1RRP|A Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 204 | Back alignment and structure |
| >pdb|1QG2|A Chain A, Canine Gdp-Ran R76e Mutant Length = 216 | Back alignment and structure |
| >pdb|1A2K|C Chain C, Gdpran-Ntf2 Complex Length = 216 | Back alignment and structure |
| >pdb|1WA5|A Chain A, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 176 | Back alignment and structure |
| >pdb|1QBK|C Chain C, Structure Of The Karyopherin Beta2-ran Gppnhp Nuclear Transport Complex Length = 216 | Back alignment and structure |
| >pdb|4DJT|A Chain A, Crystal Structure Of A Nuclear Gtp-Binding Protein From Encephalitozoon Cuniculi Bound To Gdp-Mg2+ Length = 218 | Back alignment and structure |
| >pdb|1QG4|A Chain A, Canine Gdp-Ran F72y Mutant Length = 216 | Back alignment and structure |
| >pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 | Back alignment and structure |
| >pdb|2BKU|A Chain A, Kap95p:rangtp Complex Length = 177 | Back alignment and structure |
| >pdb|3M1I|A Chain A, Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex With Yeas (Yrb1p) And Yeast Rangtp (Gsp1pgtp) Length = 219 | Back alignment and structure |
| >pdb|2X19|A Chain A, Crystal Structure Of Importin13 - Rangtp Complex Length = 172 | Back alignment and structure |
| >pdb|3ICQ|B Chain B, Karyopherin Nuclear State Length = 171 | Back alignment and structure |
| >pdb|3NC1|C Chain C, Crystal Structure Of The Crm1-Rangtp Complex Length = 182 | Back alignment and structure |
| >pdb|3NBY|C Chain C, Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclear Export Complex Length = 176 | Back alignment and structure |
| >pdb|3RAN|A Chain A, Canine Gdp-Ran Q69l Mutant Length = 216 | Back alignment and structure |
| >pdb|3GJ4|A Chain A, Crystal Structure Of Human Rangdp-Nup153znf3 Complex Length = 221 | Back alignment and structure |
| >pdb|1JAH|A Chain A, H-Ras P21 Protein Mutant G12p, Complexed With Guanosine-5'- [beta,Gamma-Methylene] Triphosphate And Magnesium Length = 166 | Back alignment and structure |
| >pdb|3BRW|D Chain D, Structure Of The Rap-Rapgap Complex Length = 167 | Back alignment and structure |
| >pdb|1AGP|A Chain A, Three-Dimensional Structures And Properties Of A Transforming And A Nontransforming Gly-12 Mutant Of P21-H-Ras Length = 166 | Back alignment and structure |
| >pdb|421P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 | Back alignment and structure |
| >pdb|1CLU|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 | Back alignment and structure |
| >pdb|4DXA|A Chain A, Co-Crystal Structure Of Rap1 In Complex With Krit1 Length = 169 | Back alignment and structure |
| >pdb|4DSO|A Chain A, Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity Length = 189 | Back alignment and structure |
| >pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 167 | Back alignment and structure |
| >pdb|2J0V|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Rac7-Rop9: The First Ras Superfamily Gtpase From The Plant Kingdom Length = 212 | Back alignment and structure |
| >pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 167 | Back alignment and structure |
| >pdb|4EPR|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 | Back alignment and structure |
| >pdb|2J1L|A Chain A, Crystal Structure Of Human Rho-Related Gtp-Binding Protein Rhod Length = 214 | Back alignment and structure |
| >pdb|2BOV|A Chain A, Molecular Recognition Of An Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme By Rala Gtpase Length = 206 | Back alignment and structure |
| >pdb|1U8Y|A Chain A, Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal Two Novel Binding Sites That Are Also Present In Ras And Rap Length = 168 | Back alignment and structure |
| >pdb|2A78|A Chain A, Crystal Structure Of The C3bot-Rala Complex Reveals A Novel Type Of Action Of A Bacterial Exoenzyme Length = 187 | Back alignment and structure |
| >pdb|1UAD|A Chain A, Crystal Structure Of The Rala-gppnhp-sec5 Ral-binding Domain Complex Length = 175 | Back alignment and structure |
| >pdb|3CLV|A Chain A, Crystal Structure Of Rab5a From Plasmodium Falciparum, Pfb0500c Length = 208 | Back alignment and structure |
| >pdb|3OES|A Chain A, Crystal Structure Of The Small Gtpase Rhebl1 Length = 201 | Back alignment and structure |
| >pdb|2KE5|A Chain A, Solution Structure And Dynamics Of The Small Gtpase Ralb In Its Active Conformation: Significance For Effector Protein Binding Length = 174 | Back alignment and structure |
| >pdb|1ZC3|A Chain A, Crystal Structure Of The Ral-Binding Domain Of Exo84 In Complex With The Active Rala Length = 175 | Back alignment and structure |
| >pdb|2KWI|A Chain A, Ralb-Rlip76 (Ralbp1) Complex Length = 178 | Back alignment and structure |
| >pdb|2WBL|C Chain C, Three-Dimensional Structure Of A Binary Rop-Prone Complex Length = 180 | Back alignment and structure |
| >pdb|3BWD|D Chain D, Crystal Structure Of The Plant Rho Protein Rop5 Length = 182 | Back alignment and structure |
| >pdb|2ATX|A Chain A, Crystal Structure Of The Tc10 Gppnhp Complex Length = 194 | Back alignment and structure |
| >pdb|2NTY|C Chain C, Rop4-Gdp-Prone8 Length = 180 | Back alignment and structure |
| >pdb|3REF|B Chain B, Crystal Structure Of Ehrho1 Bound To Gdp And Magnesium Length = 194 | Back alignment and structure |
| >pdb|4DVG|A Chain A, Crystal Structure Of E. Histolytica Formin1 Bound To Ehrho1-Gtpgammas Length = 188 | Back alignment and structure |
| >pdb|2ERY|A Chain A, The Crystal Structure Of The Ras Related Protein Rras2 (Rras2) In The Gdp Bound State Length = 172 | Back alignment and structure |
| >pdb|2H7V|A Chain A, Co-crystal Structure Of Ypka-rac1 Length = 188 | Back alignment and structure |
| >pdb|1HH4|A Chain A, Rac1-Rhogdi Complex Involved In Nadph Oxidase Activation Length = 192 | Back alignment and structure |
| >pdb|2ODB|A Chain A, The Crystal Structure Of Human Cdc42 In Complex With The Crib Domain Of Human P21-Activated Kinase 6 (Pak6) Length = 192 | Back alignment and structure |
| >pdb|1MH1|A Chain A, Small G-Protein Length = 186 | Back alignment and structure |
| >pdb|1G4U|R Chain R, Crystal Structure Of The Salmonella Tyrosine Phosphatase And Gtpase Activating Protein Sptp Bound To Rac1 Length = 184 | Back alignment and structure |
| >pdb|1GRN|A Chain A, Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. Length = 191 | Back alignment and structure |
| >pdb|1AM4|D Chain D, Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. Sapiens) Length = 177 | Back alignment and structure |
| >pdb|2DFK|B Chain B, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 194 | Back alignment and structure |
| >pdb|3EG5|A Chain A, Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex With Cdc42-Gmppnp Length = 178 | Back alignment and structure |
| >pdb|2QRZ|A Chain A, Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is Required Length = 189 | Back alignment and structure |
| >pdb|1CEE|A Chain A, Solution Structure Of Cdc42 In Complex With The Gtpase Binding Domain Of Wasp Length = 179 | Back alignment and structure |
| >pdb|1EES|A Chain A, Solution Structure Of Cdc42hs Complexed With A Peptide Derived From P-21 Activated Kinase, Nmr, 20 Structures Length = 178 | Back alignment and structure |
| >pdb|2WM9|B Chain B, Structure Of The Complex Between Dock9 And Cdc42. Length = 190 | Back alignment and structure |
| >pdb|1AN0|A Chain A, Cdc42hs-Gdp Complex Length = 190 | Back alignment and structure |
| >pdb|4DID|A Chain A, Crystal Structure Of Salmonella Effector N-Terminal Domain Sopb In Complex With Cdc42 Length = 193 | Back alignment and structure |
| >pdb|1KZ7|B Chain B, Crystal Structure Of The DhPH FRAGMENT OF MURINE DBS IN Complex With The Placental Isoform Of Human Cdc42 Length = 188 | Back alignment and structure |
| >pdb|1GZS|A Chain A, Crystal Structure Of The Complex Between The Gef Domain Of The Salmonella Typhimurium Sope Toxin And Human Cdc42 Length = 180 | Back alignment and structure |
| >pdb|1A4R|B Chain B, G12v Mutant Of Human Placental Cdc42 Gtpase In The Gdp Form Length = 191 | Back alignment and structure |
| >pdb|2YC2|C Chain C, Intraflagellar Transport Complex 25-27 From Chlamydomonas Length = 208 | Back alignment and structure |
| >pdb|3GCG|A Chain A, Crystal Structure Of Map And Cdc42 Complex Length = 182 | Back alignment and structure |
| >pdb|1AJE|A Chain A, Cdc42 From Human, Nmr, 20 Structures Length = 194 | Back alignment and structure |
| >pdb|1DOA|A Chain A, Structure Of The Rho Family Gtp-Binding Protein Cdc42 In Complex With The Multifunctional Regulator Rhogdi Length = 191 | Back alignment and structure |
| >pdb|3SBD|A Chain A, Crystal Structure Of Rac1 P29s Mutant Length = 187 | Back alignment and structure |
| >pdb|3I3S|R Chain R, Crystal Structure Of H-Ras With Thr50 Replaced By Isoleucine Length = 166 | Back alignment and structure |
| >pdb|2VRW|A Chain A, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 184 | Back alignment and structure |
| >pdb|1I4D|D Chain D, Crystal Structure Analysis Of Rac1-Gdp Complexed With Arfaptin (P21) Length = 192 | Back alignment and structure |
| >pdb|1HE1|C Chain C, Crystal Structure Of The Complex Between The Gap Domain Of The Pseudomonas Aeruginosa Exos Toxin And Human Rac Length = 176 | Back alignment and structure |
| >pdb|3QBV|A Chain A, Structure Of Designed Orthogonal Interaction Between Cdc42 And Nucleotide Exchange Domains Of Intersectin Length = 178 | Back alignment and structure |
| >pdb|2C5L|A Chain A, Structure Of Plc Epsilon Ras Association Domain With Hras Length = 173 | Back alignment and structure |
| >pdb|1FOE|B Chain B, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 177 | Back alignment and structure |
| >pdb|3SUA|A Chain A, Crystal Structure Of The Intracellular Domain Of Plexin-B1 In Complex With Rac1 Length = 184 | Back alignment and structure |
| >pdb|2FJU|A Chain A, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 178 | Back alignment and structure |
| >pdb|4Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 189 | Back alignment and structure |
| >pdb|3TH5|A Chain A, Crystal Structure Of Wild-Type Rac1 Length = 204 | Back alignment and structure |
| >pdb|4EFM|A Chain A, Crystal Structure Of H-Ras G12v In Complex With Gppnhp (State 1) Length = 171 | Back alignment and structure |
| >pdb|4EFL|A Chain A, Crystal Structure Of H-Ras Wt In Complex With Gppnhp (State 1) Length = 171 | Back alignment and structure |
| >pdb|3V4F|A Chain A, H-Ras Peg 400CACL2, ORDERED OFF Length = 166 | Back alignment and structure |
| >pdb|2YIN|C Chain C, Structure Of The Complex Between Dock2 And Rac1. Length = 196 | Back alignment and structure |
| >pdb|6Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 171 | Back alignment and structure |
| >pdb|2Q21|A Chain A, Crystal Structures At 2.2 Angstroms Resolution Of The Catalytic Domains Of Normal Ras Protein And An Oncogenic Mutant Complexed With Gsp Length = 171 | Back alignment and structure |
| >pdb|1WQ1|R Chain R, Ras-Rasgap Complex Length = 166 | Back alignment and structure |
| >pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 | Back alignment and structure |
| >pdb|2KB0|A Chain A, Cdc42(T35a) Length = 178 | Back alignment and structure |
| >pdb|2ASE|A Chain A, Nmr Structure Of The F28l Mutant Of Cdc42hs Length = 178 | Back alignment and structure |
| >pdb|2X1V|A Chain A, Crystal Structure Of The Activating H-Ras I163f Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 | Back alignment and structure |
| >pdb|1LFD|B Chain B, Crystal Structure Of The Active Ras Protein Complexed With The Ras-interacting Domain Of Ralgds Length = 167 | Back alignment and structure |
| >pdb|221P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 | Back alignment and structure |
| >pdb|3DDC|A Chain A, Crystal Structure Of Nore1a In Complex With Ras Length = 166 | Back alignment and structure |
| >pdb|3VHL|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock8 In Complex With Cdc42 (T17n Mutant) Length = 195 | Back alignment and structure |
| >pdb|3LO5|A Chain A, Crystal Structure Of The Dominant Negative S17n Mutant Of Ras Length = 166 | Back alignment and structure |
| >pdb|2QUZ|A Chain A, Crystal Structure Of The Activating H-Rask117r Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 | Back alignment and structure |
| >pdb|2ATV|A Chain A, The Crystal Structure Of Human Rerg In The Gdp Bound State Length = 196 | Back alignment and structure |
| >pdb|1NF3|A Chain A, Structure Of Cdc42 In A Complex With The Gtpase-Binding Domain Of The Cell Polarity Protein, Par6 Length = 195 | Back alignment and structure |
| >pdb|1CF4|A Chain A, Cdc42ACK GTPASE-Binding Domain Complex Length = 184 | Back alignment and structure |
| >pdb|2GCO|A Chain A, Crystal Structure Of The Human Rhoc-gppnhp Complex Length = 201 | Back alignment and structure |
| >pdb|3KKM|A Chain A, Crystal Structure Of H-Ras T35s In Complex With Gppnhp Length = 172 | Back alignment and structure |
| >pdb|3PIR|A Chain A, Crystal Structure Of M-Rasd41e In Complex With Gppnhp (Type 1) Length = 183 | Back alignment and structure |
| >pdb|3KKP|A Chain A, Crystal Structure Of M-Ras P40d In Complex With Gppnhp Length = 183 | Back alignment and structure |
| >pdb|2GCN|A Chain A, Crystal Structure Of The Human Rhoc-Gdp Complex Length = 201 | Back alignment and structure |
| >pdb|4EPX|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 | Back alignment and structure |
| >pdb|4EPT|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 | Back alignment and structure |
| >pdb|1IAQ|A Chain A, C-H-Ras P21 Protein Mutant With Thr 35 Replaced By Ser (T35s) Complexed With Guanosine-5'-[b,G-Imido] Triphosphate Length = 166 | Back alignment and structure |
| >pdb|2C2H|A Chain A, Crystal Structure Of The Human Rac3 In Complex With Gdp Length = 192 | Back alignment and structure |
| >pdb|2IC5|A Chain A, Crystal Structure Of Human Rac3 Grown In The Presence Of Gpp(Nh)p. Length = 180 | Back alignment and structure |
| >pdb|2G0N|A Chain A, The Crystal Structure Of The Human Rac3 In Complex With Gdp And Chloride Length = 179 | Back alignment and structure |
| >pdb|621P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 | Back alignment and structure |
| >pdb|1S1C|A Chain A, Crystal Structure Of The Complex Between The Human Rhoa And Rho-Binding Domain Of Human Rocki Length = 183 | Back alignment and structure |
| >pdb|4GZM|A Chain A, Crystal Structure Of Rac1 F28l Mutant Length = 204 | Back alignment and structure |
| >pdb|3KZ1|E Chain E, Crystal Structure Of The Complex Of Pdz-Rhogef DhPH DOMAINS WITH GTP- Gamma-S Activated Rhoa Length = 182 | Back alignment and structure |
| >pdb|3LW8|A Chain A, Shigella Ipgb2 In Complex With Human Rhoa, Gdp And Mg2+ (Complex A) Length = 185 | Back alignment and structure |
| >pdb|1LF0|A Chain A, Crystal Structure Of Rasa59g In The Gtp-Bound Form Length = 166 | Back alignment and structure |
| >pdb|1E96|A Chain A, Structure Of The RacP67PHOX COMPLEX Length = 192 | Back alignment and structure |
| >pdb|521P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 | Back alignment and structure |
| >pdb|3TVD|A Chain A, Crystal Structure Of Mouse Rhoa-Gtp Complex Length = 193 | Back alignment and structure |
| >pdb|2RGB|A Chain A, Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 | Back alignment and structure |
| >pdb|1X86|B Chain B, Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-Associated Rhogef In Complex With Rhoa Length = 196 | Back alignment and structure |
| >pdb|4F38|A Chain A, Crystal Structure Of Geranylgeranylated Rhoa In Complex With Rhogdi In Its Active Gppnhp-Bound Form Length = 195 | Back alignment and structure |
| >pdb|3KKO|A Chain A, Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX WITH GP Length = 183 | Back alignment and structure |
| >pdb|1DS6|A Chain A, Crystal Structure Of A Rac-Rhogdi Complex Length = 192 | Back alignment and structure |
| >pdb|3B13|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock2 In Complex With Rac1 (T17n Mutant) Length = 184 | Back alignment and structure |
| >pdb|1I4T|D Chain D, Crystal Structure Analysis Of Rac1-Gmppnp In Complex With Arfaptin Length = 192 | Back alignment and structure |
| >pdb|3K9N|A Chain A, Allosteric Modulation Of H-Ras Gtpase Length = 166 | Back alignment and structure |
| >pdb|1NVV|Q Chain Q, Structural Evidence For Feedback Activation By Rasgtp Of The Ras-specific Nucleotide Exchange Factor Sos Length = 166 | Back alignment and structure |
| >pdb|1LB1|B Chain B, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 192 | Back alignment and structure |
| >pdb|1CXZ|A Chain A, Crystal Structure Of Human Rhoa Complexed With The Effector Domain Of The Protein Kinase PknPRK1 Length = 182 | Back alignment and structure |
| >pdb|3CON|A Chain A, Crystal Structure Of The Human Nras Gtpase Bound With Gdp Length = 190 | Back alignment and structure |
| >pdb|3RYT|C Chain C, The Plexin A1 Intracellular Region In Complex With Rac1 Length = 180 | Back alignment and structure |
| >pdb|1XCM|A Chain A, Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mutant Length = 167 | Back alignment and structure |
| >pdb|1XJ0|A Chain A, Crystal Structure Of The Gdp-Bound Form Of The Rasg60a Mutant Length = 166 | Back alignment and structure |
| >pdb|1X1R|A Chain A, Crystal Structure Of M-Ras In Complex With Gdp Length = 178 | Back alignment and structure |
| >pdb|4GZL|A Chain A, Crystal Structure Of Rac1 Q61l Mutant Length = 204 | Back alignment and structure |
| >pdb|2W2T|A Chain A, Rac2 (G12v) In Complex With Gdp Length = 185 | Back alignment and structure |
| >pdb|1ZW6|A Chain A, Crystal Structure Of The Gtp-Bound Form Of Rasq61g Length = 166 | Back alignment and structure |
| >pdb|3GFT|A Chain A, Human K-Ras In Complex With A Gtp Analogue Length = 187 | Back alignment and structure |
| >pdb|4EFN|A Chain A, Crystal Structure Of H-Ras Q61l In Complex With Gppnhp (State 1) Length = 171 | Back alignment and structure |
| >pdb|2W2V|A Chain A, Rac2 (G12v) In Complex With Gtpgs Length = 184 | Back alignment and structure |
| >pdb|1ZVQ|A Chain A, Structure Of The Q61g Mutant Of Ras In The Gdp-Bound Form Length = 166 | Back alignment and structure |
| >pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 | Back alignment and structure |
| >pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 | Back alignment and structure |
| >pdb|721P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 | Back alignment and structure |
| >pdb|2RGC|A Chain A, Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 | Back alignment and structure |
| >pdb|2RGA|A Chain A, Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 | Back alignment and structure |
| >pdb|1Z2C|A Chain A, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 193 | Back alignment and structure |
| >pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 | Back alignment and structure |
| >pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 | Back alignment and structure |
| >pdb|1TX4|B Chain B, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 | Back alignment and structure |
| >pdb|3MSX|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 180 | Back alignment and structure |
| >pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 | Back alignment and structure |
| >pdb|1XCG|B Chain B, Crystal Structure Of Human Rhoa In Complex With DhPH Fragment Of Pdzrhogef Length = 178 | Back alignment and structure |
| >pdb|1OW3|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 193 | Back alignment and structure |
| >pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 | Back alignment and structure |
| >pdb|1CC0|A Chain A, Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Length = 190 | Back alignment and structure |
| >pdb|2Q3H|A Chain A, The Crystal Structure Of Rhoua In The Gdp-bound State Length = 201 | Back alignment and structure |
| >pdb|2FV8|A Chain A, The Crystal Structure Of Rhob In The Gdp-Bound State Length = 207 | Back alignment and structure |
| >pdb|2CL0|X Chain X, Crystal Structure Analysis Of A Fluorescent Form Of H-Ras P21 In Complex With Gppnhp Length = 166 | Back alignment and structure |
| >pdb|1DPF|A Chain A, Crystal Structure Of A Mg-Free Form Of Rhoa Complexed With Gdp Length = 180 | Back alignment and structure |
| >pdb|3D6T|B Chain B, Structure Of The Roc Domain From The Parkinson's Disease-Associated Leucine-Rich Repeat Kinase 2 Reveals A Dimeric Gtpase Length = 171 | Back alignment and structure |
| >pdb|2ERX|A Chain A, Crystal Structure Of Diras2 In Complex With Gdp And Inorganic Phosphate Length = 172 | Back alignment and structure |
| >pdb|2ZEJ|A Chain A, Structure Of The Roc Domain From The Parkinson's Disease-associated Leucine-rich Repeat Kinase 2 Reveals A Dimeric Gtpase Length = 184 | Back alignment and structure |
| >pdb|3RAP|R Chain R, The Small G Protein Rap2 In A Non Catalytic Complex With Gtp Length = 167 | Back alignment and structure |
| >pdb|1KMQ|A Chain A, Crystal Structure Of A Constitutively Activated Rhoa Mutant (Q63l) Length = 184 | Back alignment and structure |
| >pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 | Back alignment and structure |
| >pdb|1RYF|A Chain A, Alternative Splicing Of Rac1 Generates Rac1b, A Self-Activating Gtpase Length = 203 | Back alignment and structure |
| >pdb|2FN4|A Chain A, The Crystal Structure Of Human Ras-Related Protein, Rras, In The Gdp- Bound State Length = 181 | Back alignment and structure |
| >pdb|1GWN|A Chain A, The Crystal Structure Of The Core Domain Of RhoeRND3 - A Constitutively Activated Small G Protein Length = 205 | Back alignment and structure |
| >pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATIONS Length = 184 | Back alignment and structure |
| >pdb|2V55|B Chain B, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 200 | Back alignment and structure |
| >pdb|2REX|B Chain B, Crystal Structure Of The Effector Domain Of Plxnb1 Bound With Rnd1 Gtpase Length = 197 | Back alignment and structure |
| >pdb|2CLS|A Chain A, The Crystal Structure Of The Human Rnd1 Gtpase In The Active Gtp Bound State Length = 198 | Back alignment and structure |
| >pdb|3A58|B Chain B, Crystal Structure Of Sec3p - Rho1p Complex From Saccharomyces Cerevisiae Length = 188 | Back alignment and structure |
| >pdb|3Q3J|B Chain B, Crystal Structure Of Plexin A2 Rbd In Complex With Rnd1 Length = 214 | Back alignment and structure |
| >pdb|2NZJ|A Chain A, The Crystal Structure Of Rem1 In Complex With Gdp Length = 175 | Back alignment and structure |
| >pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 | Back alignment and structure |
| >pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 | Back alignment and structure |
| >pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 | Back alignment and structure |
| >pdb|3IHW|A Chain A, Crystal Structure Of The Ras-Like Domain Of Centg3 Length = 184 | Back alignment and structure |
| >pdb|3QQ5|A Chain A, Crystal Structure Of The [fefe]-Hydrogenase Maturation Protein Hydf Length = 423 | Back alignment and structure |
| >pdb|4BAS|A Chain A, Structure Of The Arl6 Bbs3 Small Gtpase From Trypanosoma Brucei With Bound Nucleotide Analogue Gppnp Length = 199 | Back alignment and structure |
| >pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 | Back alignment and structure |
| >pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 | Back alignment and structure |
| >pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 | Back alignment and structure |
| >pdb|3RD1|A Chain A, Structure Of An Adp Ribosylation Factor From Entamoeba Histolytica Hm- 1:imss Bound To Mg-Gdp Length = 178 | Back alignment and structure |
| >pdb|4GOJ|A Chain A, The Crystal Structure Of Full Length Arl3gppnhp In Complex With Unc119a Length = 189 | Back alignment and structure |
| >pdb|1FZQ|A Chain A, Crystal Structure Of Murine Arl3-Gdp Length = 181 | Back alignment and structure |
| >pdb|1YZG|A Chain A, Structure Of Human Adp-ribosylation Factor-like 8 Length = 179 | Back alignment and structure |
| >pdb|2GF0|A Chain A, The Crystal Structure Of The Human Diras1 Gtpase In The Inactive Gdp Bound State Length = 199 | Back alignment and structure |
| >pdb|3BH7|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gdp-Alf4 Length = 164 | Back alignment and structure |
| >pdb|1KSG|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 1 Length = 186 | Back alignment and structure |
| >pdb|3DOE|A Chain A, Complex Of Arl2 And Bart, Crystal Form 1 Length = 192 | Back alignment and structure |
| >pdb|1KSH|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Native) Length = 186 | Back alignment and structure |
| >pdb|4AII|A Chain A, Crystal Structure Of The Rat Rem2 Gtpase - G Domain Bound To Gdp Length = 180 | Back alignment and structure |
| >pdb|3C5C|A Chain A, Crystal Structure Of Human Ras-Like, Family 12 Protein In Complex With Gdp Length = 187 | Back alignment and structure |
| >pdb|3LRP|A Chain A, Crystal Structure Of Plasmodium Falciparum Adp-Ribosylation Factor 1 Length = 181 | Back alignment and structure |
| >pdb|3DPU|A Chain A, Roccor Domain Tandem Of Rab Family Protein (Roco) Length = 535 | Back alignment and structure |
| >pdb|1Z6Y|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 Length = 179 | Back alignment and structure |
| >pdb|1ZJ6|A Chain A, Crystal Structure Of Human Arl5 Length = 187 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 1e-84 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 1e-83 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 3e-83 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 2e-68 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 3e-64 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 3e-62 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 6e-61 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 3e-60 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 1e-58 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 2e-57 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 4e-54 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 3e-52 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 9e-52 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 1e-51 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 2e-51 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 2e-51 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 3e-51 | |
| 3bbp_A | 211 | RAB-6, RAS-related protein RAB-6A; golgi complex, | 9e-51 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 1e-50 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 5e-50 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 5e-50 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 7e-50 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 7e-50 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 1e-49 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 1e-49 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 1e-49 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 2e-49 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 2e-49 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 2e-49 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 5e-49 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 6e-49 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 8e-49 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 1e-48 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 1e-48 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 1e-48 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 1e-48 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 1e-48 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 2e-48 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 2e-48 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 3e-48 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 4e-48 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 5e-48 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 8e-48 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 2e-47 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 2e-47 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 4e-47 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 1e-46 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 6e-46 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 6e-46 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 7e-46 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 7e-46 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 7e-45 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 1e-44 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 1e-44 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 1e-44 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 2e-44 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 3e-44 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 4e-44 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 5e-44 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 6e-44 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 3e-43 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 3e-42 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 8e-42 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 2e-41 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 2e-41 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 3e-41 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 5e-41 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 5e-38 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 3e-37 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 2e-36 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 2e-31 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 2e-29 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 9e-29 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 1e-28 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 2e-28 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 2e-28 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 5e-28 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 1e-27 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 2e-27 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 3e-27 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 3e-27 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 9e-27 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 1e-26 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 3e-24 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 2e-15 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 3e-14 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 2e-13 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 5e-13 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 5e-13 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 8e-13 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 1e-12 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 8e-12 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 1e-11 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 1e-11 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 1e-11 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 3e-11 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 1e-10 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 2e-10 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 2e-10 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 2e-10 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 7e-10 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 1e-09 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 1e-09 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 7e-09 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 2e-08 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 2e-05 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 4e-05 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 4e-04 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 8e-04 |
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 | Back alignment and structure |
|---|
Score = 246 bits (631), Expect = 1e-84
Identities = 108/137 (78%), Positives = 122/137 (89%), Gaps = 2/137 (1%)
Query: 1 MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ 60
M SR++ LLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEV +DRL T+Q
Sbjct: 1 MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ 60
Query: 61 IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF 120
IWDTAGQERFQSLGVAFYRGADCCVLV+DV + +F L++WR+EFLIQASP DP+NFPF
Sbjct: 61 IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF 120
Query: 121 VVLGNKIDVDGGNSRVV 137
VVLGNKID++ N +V
Sbjct: 121 VVLGNKIDLE--NRQVA 135
|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 | Back alignment and structure |
|---|
| >3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Length = 255 | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 100.0 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 100.0 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 100.0 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 100.0 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 100.0 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 100.0 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 100.0 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 100.0 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 100.0 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 100.0 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 100.0 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 100.0 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 100.0 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 100.0 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 100.0 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 99.98 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 99.98 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 99.98 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 99.98 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 99.98 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 99.98 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 99.98 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 99.98 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 99.98 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 99.98 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 99.98 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 99.98 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 99.98 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 99.97 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 99.97 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 99.97 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 99.97 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 99.97 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 99.97 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 99.97 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 99.97 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 99.97 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 99.97 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 99.97 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 99.97 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 99.97 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 99.97 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 99.97 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 99.97 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 99.97 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 99.97 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 99.97 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 99.97 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 99.97 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 99.97 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 99.97 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 99.97 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 99.97 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 99.97 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 99.97 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 99.97 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 99.97 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 99.97 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 99.97 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 99.97 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 99.97 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 99.97 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 99.97 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 99.97 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 99.97 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 99.97 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 99.97 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 99.97 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 99.97 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 99.97 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 99.97 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 99.97 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 99.97 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 99.97 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 99.97 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 99.96 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 99.96 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 99.96 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 99.96 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 99.96 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 99.96 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 99.96 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 99.96 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 99.96 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 99.96 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 99.96 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 99.96 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 99.96 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 99.96 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 99.96 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 99.96 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 99.96 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 99.95 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 99.95 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 99.95 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 99.95 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 99.95 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 99.95 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 99.91 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 99.95 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 99.94 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 99.94 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 99.94 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 99.94 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 99.94 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 99.93 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 99.93 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.93 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 99.93 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 99.92 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 99.92 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 99.92 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 99.92 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 99.92 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 99.92 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 99.92 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 99.92 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 99.91 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 99.91 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 99.91 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 99.9 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 99.9 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 99.9 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 99.9 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 99.9 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 99.89 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.89 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 99.88 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 99.88 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 99.88 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 99.87 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.87 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 99.87 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.87 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 99.86 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 99.86 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 99.86 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 99.86 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 99.85 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 99.85 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 99.85 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 99.85 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 99.85 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 99.85 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 99.85 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 99.85 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 99.84 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 99.84 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 99.84 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 99.84 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.84 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 99.84 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 99.84 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 99.83 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 99.83 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 99.83 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.82 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 99.82 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.82 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 99.82 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.82 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 99.81 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 99.81 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 99.81 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 99.81 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 99.81 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 99.81 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 99.8 | |
| 3ohm_A | 327 | Guanine nucleotide-binding protein G(Q) subunit A; | 99.79 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 99.79 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 99.78 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 99.78 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 99.78 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 99.77 | |
| 4fid_A | 340 | G protein alpha subunit; RAS-like domain, all-heli | 99.77 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 99.76 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 99.74 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 99.74 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 99.74 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 99.74 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 99.73 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 99.73 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 99.73 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 99.72 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 99.72 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 99.68 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 99.68 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 99.66 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 99.66 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 99.66 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 99.65 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 99.63 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 99.63 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 99.62 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 99.6 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 99.58 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 99.58 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 99.53 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 99.52 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 99.52 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 99.49 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 99.44 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 99.4 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 99.38 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 99.36 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 99.31 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 99.3 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 99.16 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 99.06 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 99.05 | |
| 3l82_B | 227 | F-box only protein 4; TRFH domain, helix, GTPase d | 99.02 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 99.02 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 99.02 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 98.97 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 98.95 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 98.76 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.75 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 98.67 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 98.62 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 98.6 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 98.45 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 98.43 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 98.38 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 98.35 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 98.27 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 98.25 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 98.14 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 98.08 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 97.84 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 97.81 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 97.81 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.71 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 97.7 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 97.64 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 97.62 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 97.56 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 97.56 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 97.56 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 97.49 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 97.48 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.47 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 97.47 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 97.45 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.44 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 97.44 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.43 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.42 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.41 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 97.41 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 97.36 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 97.36 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 97.34 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 97.34 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.34 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.33 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 97.33 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 97.33 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 97.32 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 97.32 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 97.31 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 97.3 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 97.28 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.28 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 97.28 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.27 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 97.27 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 97.27 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 97.27 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 97.26 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 97.26 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.26 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 97.25 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.24 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 97.22 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.21 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 97.21 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 97.21 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 97.2 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 97.2 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.2 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 97.2 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 97.2 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 97.19 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 97.19 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 97.19 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 97.19 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 97.19 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 97.18 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.18 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 97.18 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 97.18 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 97.18 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 97.16 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 97.16 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 97.16 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.16 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.16 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 97.16 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 97.15 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 97.15 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 97.15 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 97.15 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 97.15 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.15 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 97.14 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 97.14 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 97.14 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 97.14 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 97.13 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 97.13 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.13 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 97.12 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 97.12 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 97.12 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 97.12 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 97.12 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 97.12 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 97.12 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 97.12 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 97.11 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.11 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 97.11 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 97.11 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 97.11 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 97.11 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 97.1 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 97.1 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.08 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 97.07 | |
| 4ido_A | 457 | Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE | 97.07 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 97.07 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 97.07 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 97.06 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 97.06 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 97.06 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 97.06 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.06 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 97.05 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 97.05 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 97.05 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.04 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 97.03 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.03 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.02 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.01 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.01 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 97.0 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 97.0 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.0 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 96.99 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 96.98 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 96.98 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 96.98 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.97 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.97 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.96 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 96.95 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 96.94 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 96.94 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.93 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 96.93 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.92 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 96.92 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 96.92 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 96.92 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 96.92 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 96.92 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 96.92 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 96.91 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.91 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 96.9 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 96.9 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.9 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 96.9 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 96.9 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 96.88 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 96.88 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 96.88 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 96.87 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.87 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 96.87 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.87 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 96.86 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 96.86 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 96.86 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 96.85 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.83 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 96.82 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 96.82 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.82 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 96.81 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 96.81 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 96.8 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.78 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.78 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 96.78 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.78 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.78 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 96.77 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 96.75 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.73 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.72 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.71 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 96.7 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 96.7 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.69 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 96.66 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.63 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.62 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.62 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 96.62 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 96.61 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.61 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 96.6 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.6 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.59 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 96.59 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.58 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 96.58 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.58 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 96.57 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 96.56 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.54 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 96.54 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.53 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.53 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.53 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 96.52 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 96.49 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 96.49 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 96.48 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.47 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 96.46 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 96.45 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 96.43 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.43 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 96.42 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 96.39 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.38 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 96.37 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 96.36 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 96.35 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 96.35 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.35 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 96.35 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.34 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 96.34 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.33 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 96.31 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 96.31 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.31 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 96.3 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 96.29 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.27 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.26 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.25 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 96.25 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 96.25 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 96.24 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 96.24 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 96.23 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.22 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.2 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 96.18 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 96.17 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 96.17 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 96.17 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.16 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.15 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 96.13 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 96.12 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 96.12 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.1 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 96.09 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 96.09 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 96.08 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 96.06 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.06 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 96.05 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 96.05 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 96.05 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 96.05 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 96.04 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 96.04 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.04 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 96.04 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.03 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 96.01 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 96.01 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 96.0 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 95.98 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 95.98 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.98 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 95.98 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.97 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 95.97 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.96 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.96 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 95.95 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 95.95 |
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=9.2e-37 Score=212.82 Aligned_cols=153 Identities=33% Similarity=0.589 Sum_probs=128.0
Q ss_pred ceeeEEEEEcCCCCChHHHHHHHhcCCCCCCCCCceeeeEEEEEEEECCeEEEEEEEeCCCccccccchhhccccccEEE
Q 031126 6 RTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCV 85 (165)
Q Consensus 6 ~~~~~i~i~G~~~~GKSsli~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~g~~~~~~~~~~~~~~~~~~i 85 (165)
.+.+||+|+|++|+|||||+++|..+.|...+.++.+.++.......++..+.+.+|||+|++.|+.++..+++.+++++
T Consensus 11 ~k~~KivlvGd~~VGKTsLi~r~~~~~f~~~~~~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~~~~~~~a~~~i 90 (216)
T 4dkx_A 11 LRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIPSYIRDSAAAV 90 (216)
T ss_dssp --CEEEEEECSTTSSHHHHHHHHHHSCCC----------CEEEEEECSSCEEEEEEECCSCTTTCGGGHHHHHTTCSEEE
T ss_pred CCcEEEEEECcCCcCHHHHHHHHHhCCCCCCcCCccceEEEEEEEEecceEEEEEEEECCCchhhhhHHHHHhccccEEE
Confidence 45689999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEeCCChhhHHHHHHHHHHHHHHcCCCCCCCCcEEEEEeCCCCCCCCCchhc-hhHHhhhhcceeceeeeccccccCCC
Q 031126 86 LVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVC-IFCDVFSSIITLSHTHTHGHTNTHSN 164 (165)
Q Consensus 86 ~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~~~~piilv~nK~Dl~~~~~~~~~-~~~~~~~~~~~i~~~~~s~~~~~~~~ 164 (165)
+|||++++.+|+.+..|+..+...... ++|++|||||+|+.+. +.+. +.++.+.....+.++++||++|.|++
T Consensus 91 lv~di~~~~Sf~~i~~~~~~i~~~~~~----~~piilVgNK~Dl~~~--r~V~~~e~~~~a~~~~~~~~e~SAktg~nV~ 164 (216)
T 4dkx_A 91 VVYDITNVNSFQQTTKWIDDVRTERGS----DVIIMLVGNKTDLADK--RQVSIEEGERKAKELNVMFIETSAKAGYNVK 164 (216)
T ss_dssp EEEETTCHHHHHTHHHHHHHHHHHHTT----SSEEEEEEECTTCGGG--CCSCHHHHHHHHHHHTCEEEEEBTTTTBSHH
T ss_pred EEeecchhHHHHHHHHHHHHHHHhcCC----CCeEEEEeeccchHhc--CcccHHHHhhHHHHhCCeeEEEeCCCCcCHH
Confidence 999999999999999999999877653 7899999999999765 4444 56667777777889999999999875
|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 165 | ||||
| d1g16a_ | 166 | c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye | 2e-36 | |
| d2fu5c1 | 173 | c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta | 1e-34 | |
| d2bcgy1 | 194 | c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac | 5e-34 | |
| d2ew1a1 | 171 | c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta | 3e-32 | |
| d3raba_ | 169 | c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI | 4e-30 | |
| d2f9la1 | 175 | c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T | 4e-30 | |
| d2g6ba1 | 170 | c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T | 1e-27 | |
| d1x3sa1 | 177 | c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta | 7e-27 | |
| d1z0fa1 | 166 | c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta | 2e-26 | |
| d2bmea1 | 174 | c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta | 1e-25 | |
| d1wmsa_ | 174 | c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: | 2e-25 | |
| d2f7sa1 | 186 | c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T | 2e-25 | |
| d1vg8a_ | 184 | c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId | 2e-24 | |
| d2ngra_ | 191 | c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: | 9e-24 | |
| d2a5ja1 | 173 | c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta | 2e-23 | |
| d1ky3a_ | 175 | c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y | 7e-23 | |
| d1yzqa1 | 164 | c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta | 3e-22 | |
| d1z08a1 | 167 | c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T | 4e-22 | |
| d1mh1a_ | 183 | c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 | 6e-21 | |
| d1kaoa_ | 167 | c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: | 1e-20 | |
| d1u8za_ | 168 | c.37.1.8 (A:) Ras-related protein RalA {Cotton-top | 2e-20 | |
| d1ek0a_ | 170 | c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces | 3e-20 | |
| d1r2qa_ | 170 | c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: | 4e-20 | |
| d2atxa1 | 185 | c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax | 4e-20 | |
| d2fh5b1 | 207 | c.37.1.8 (B:63-269) Signal recognition particle re | 4e-20 | |
| d1z06a1 | 165 | c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) | 7e-20 | |
| d1kmqa_ | 177 | c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 | 3e-19 | |
| d1ctqa_ | 166 | c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi | 6e-19 | |
| d1c1ya_ | 167 | c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: | 6e-19 | |
| d1z0ja1 | 167 | c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ | 6e-18 | |
| d1m7ba_ | 179 | c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T | 1e-17 | |
| d2erya1 | 171 | c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ | 2e-17 | |
| d1r8sa_ | 160 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 3e-17 | |
| d1z2aa1 | 164 | c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta | 4e-17 | |
| d2fn4a1 | 173 | c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T | 4e-17 | |
| d1zcba2 | 200 | c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub | 2e-15 | |
| d1x1ra1 | 169 | c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa | 3e-15 | |
| d1azta2 | 221 | c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub | 5e-15 | |
| d1ksha_ | 165 | c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus | 9e-15 | |
| d1i2ma_ | 170 | c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 | 3e-14 | |
| d2qtvb1 | 166 | c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom | 4e-14 | |
| d2atva1 | 168 | c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro | 4e-14 | |
| d1moza_ | 182 | c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea | 4e-14 | |
| d2erxa1 | 171 | c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ | 8e-14 | |
| d2bcjq2 | 200 | c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub | 9e-14 | |
| d1e0sa_ | 173 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 1e-13 | |
| d1svsa1 | 195 | c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub | 1e-13 | |
| d2bmja1 | 175 | c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H | 2e-13 | |
| d1zd9a1 | 164 | c.37.1.8 (A:18-181) ADP-ribosylation factor {Human | 6e-13 | |
| d1fzqa_ | 176 | c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus | 1e-12 | |
| d1nrjb_ | 209 | c.37.1.8 (B:) Signal recognition particle receptor | 6e-12 | |
| d1xtqa1 | 167 | c.37.1.8 (A:3-169) GTP-binding protein RheB {Human | 2e-10 | |
| d1upta_ | 169 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 2e-10 | |
| d1zj6a1 | 177 | c.37.1.8 (A:2-178) ADP-ribosylation factor {Human | 8e-10 | |
| d1f6ba_ | 186 | c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr | 4e-09 | |
| d2g3ya1 | 172 | c.37.1.8 (A:73-244) GTP-binding protein GEM {Human | 8e-09 | |
| d2gjsa1 | 168 | c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax | 2e-08 | |
| d1tq4a_ | 400 | c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( | 2e-07 | |
| d1udxa2 | 180 | c.37.1.8 (A:157-336) Obg GTP-binding protein middl | 4e-06 | |
| d2gj8a1 | 161 | c.37.1.8 (A:216-376) Probable tRNA modification GT | 3e-05 | |
| d1xzpa2 | 160 | c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog | 4e-05 | |
| d1svia_ | 195 | c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti | 4e-04 | |
| d1h65a_ | 257 | c.37.1.8 (A:) Chloroplast protein translocon GTPas | 4e-04 | |
| d1egaa1 | 179 | c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { | 0.002 | |
| d1lnza2 | 185 | c.37.1.8 (A:158-342) Obg GTP-binding protein middl | 0.002 | |
| d1puia_ | 188 | c.37.1.8 (A:) Probable GTPase EngB {Escherichia co | 0.002 | |
| d1htwa_ | 158 | c.37.1.18 (A:) Hypothetical protein HI0065 {Haemop | 0.002 | |
| d2cxxa1 | 184 | c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc | 0.002 | |
| d1wf3a1 | 178 | c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { | 0.002 | |
| d1mkya2 | 186 | c.37.1.8 (A:173-358) Probable GTPase Der, N-termin | 0.004 |
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Rab-related protein Sec4 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 121 bits (305), Expect = 2e-36
Identities = 44/109 (40%), Positives = 69/109 (63%)
Query: 7 TLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAG 66
+++K++++GDSGVGK+ L+ ++V KF+ + TIG DF K V + LQIWDTAG
Sbjct: 1 SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQIWDTAG 60
Query: 67 QERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDP 115
QERF+++ A+YRGA +LVYD+ ++F N+ W + A+
Sbjct: 61 QERFRTITTAYYRGAMGIILVYDITDERTFTNIKQWFKTVNEHANDEAQ 109
|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Length = 158 | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 100.0 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 100.0 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 100.0 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 100.0 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 100.0 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 100.0 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 100.0 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 100.0 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 100.0 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 100.0 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 100.0 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 100.0 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 100.0 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 99.98 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 99.98 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 99.98 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 99.98 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 99.98 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 99.98 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 99.98 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 99.97 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 99.97 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 99.97 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.97 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 99.96 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 99.96 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 99.95 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 99.95 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 99.94 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.91 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.9 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 99.9 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.89 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 99.89 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 99.87 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 99.87 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 99.86 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 99.86 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.86 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 99.86 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 99.85 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 99.84 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 99.84 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.84 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 99.83 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 99.83 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 99.82 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.82 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.82 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 99.81 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.81 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.81 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 99.8 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 99.8 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 99.79 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 99.76 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 99.75 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 99.73 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 99.73 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 99.72 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 99.7 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 99.69 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 99.64 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 99.63 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 99.6 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 99.28 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 99.17 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 99.13 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 99.09 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 99.08 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 99.06 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 98.83 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 98.8 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 98.73 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 98.32 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 98.14 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 98.1 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.09 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 98.02 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.91 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 97.88 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.87 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.85 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.84 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.82 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 97.75 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 97.74 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.73 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.71 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.71 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 97.69 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 97.67 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 97.62 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.6 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.58 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 97.57 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.53 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.53 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 97.53 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 97.52 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 97.49 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 97.48 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.47 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 97.47 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 97.46 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 97.45 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 97.43 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.42 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.39 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.39 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.38 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.37 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 97.36 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 97.36 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 97.36 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.35 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.34 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.33 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 97.32 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 97.32 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.31 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 97.31 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 97.3 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 97.3 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.29 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 97.29 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.24 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.23 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.22 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 97.21 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.19 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 97.19 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 97.19 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 97.16 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.15 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 97.14 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 97.12 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.1 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.1 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 97.09 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 97.07 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 97.06 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 97.05 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.04 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 97.03 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.02 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 97.01 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 97.01 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 96.99 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.97 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.96 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 96.94 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.93 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 96.93 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.92 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 96.9 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 96.89 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.89 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.84 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.83 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.82 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.81 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.78 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.75 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.73 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 96.71 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 96.7 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.7 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.56 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.52 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 96.52 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.51 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.5 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.47 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 96.47 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 96.45 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 96.41 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.41 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.38 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 96.37 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 96.29 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.28 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 96.27 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.27 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.25 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.25 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.22 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 96.21 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.21 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 96.13 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.08 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.01 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 96.01 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.01 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 95.98 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 95.93 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 95.89 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 95.86 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 95.84 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.81 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 95.78 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.78 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.77 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 95.71 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 95.7 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 95.7 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 95.68 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.61 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 95.59 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.59 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 95.54 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 95.53 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 95.37 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.37 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 95.35 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 95.32 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 95.13 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.1 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 95.03 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.88 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 94.84 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 94.74 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 94.56 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 94.48 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 94.4 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 94.3 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 93.65 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 93.45 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 93.08 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 92.83 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 92.48 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 92.11 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 92.11 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 92.03 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 91.88 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 91.39 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 91.31 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 91.27 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 91.09 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 90.84 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 90.5 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 90.37 | |
| d1j3ba1 | 318 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 90.12 | |
| d1ii2a1 | 323 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 89.68 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 89.64 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 89.56 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 89.18 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 88.97 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 87.82 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 87.72 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 87.3 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 87.18 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 87.01 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 86.7 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 86.59 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 86.33 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 86.32 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 86.16 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 85.48 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 85.32 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 84.36 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 84.0 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 83.67 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 81.74 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 81.63 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 81.1 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 80.21 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 80.01 |
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Rab23 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=9.1e-35 Score=193.29 Aligned_cols=149 Identities=32% Similarity=0.664 Sum_probs=134.0
Q ss_pred eEEEEEcCCCCChHHHHHHHhcCCCCCCCCCceeeeEEEEEEEECCeEEEEEEEeCCCccccccchhhccccccEEEEEE
Q 031126 9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVY 88 (165)
Q Consensus 9 ~~i~i~G~~~~GKSsli~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~g~~~~~~~~~~~~~~~~~~i~v~ 88 (165)
+||+++|++|+|||||+++|.++.+...+.++.+.+.........+..+.+.+||++|++.+......+++.++++++||
T Consensus 3 iKv~liG~~~vGKSsLi~rl~~~~~~~~~~~ti~~~~~~~~~~~~~~~~~~~i~d~~g~~~~~~~~~~~~~~~~~~i~v~ 82 (164)
T d1z2aa1 3 IKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVF 82 (164)
T ss_dssp EEEEEECSTTSSHHHHHHHHHHCCCCCCSSCCCSSSEEEEEEEETTEEEEEEEECCTTGGGTTCCCHHHHTTCCEEEEEE
T ss_pred EEEEEECCCCcCHHHHHHHHHhCCCCcccccccccccceeeeeecCceeeeeeeccCCccchhhhhhhhhccCceEEEEE
Confidence 79999999999999999999999998888888888888888889999999999999999999999999999999999999
Q ss_pred eCCChhhHHHHHHHHHHHHHHcCCCCCCCCcEEEEEeCCCCCCCCCchhc-hhHHhhhhcceeceeeeccccccCCC
Q 031126 89 DVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVC-IFCDVFSSIITLSHTHTHGHTNTHSN 164 (165)
Q Consensus 89 d~~~~~s~~~~~~~~~~~~~~~~~~~~~~~piilv~nK~Dl~~~~~~~~~-~~~~~~~~~~~i~~~~~s~~~~~~~~ 164 (165)
|++++.+++.+..|+.++..... +.|+++||||+|+.+. +.+. +.++.+.+...+.++++||++|.|++
T Consensus 83 d~~~~~s~~~~~~~~~~i~~~~~-----~~~iilVgnK~Dl~~~--~~v~~~~~~~~~~~~~~~~~e~Sak~g~~v~ 152 (164)
T d1z2aa1 83 STTDRESFEAISSWREKVVAEVG-----DIPTALVQNKIDLLDD--SCIKNEEAEGLAKRLKLRFYRTSVKEDLNVS 152 (164)
T ss_dssp ETTCHHHHHTHHHHHHHHHHHHC-----SCCEEEEEECGGGGGG--CSSCHHHHHHHHHHHTCEEEECBTTTTBSSH
T ss_pred eccchhhhhhcccccccccccCC-----CceEEEeeccCCcccc--eeeeehhhHHHHHHcCCEEEEeccCCCcCHH
Confidence 99999999999999999987765 7899999999999765 3333 45566667777789999999999975
|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|