Citrus Sinensis ID: 031180

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVFFSEPLDWISLFVGSYGVVILPRVMIW
ccccHHHHHHHHHHHHHHHHccccHHHHccccccccccccccccccccccEEEEEEEEccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHHHHcccccccccccccHHHHHHHHccccccccccccc
ccHHHHHHHHHHHHHHHHccccccHEEEcccccccccccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccHHHHcccHHHHHcccccccccccHHHHHHHHHHcccccccccEEcc
MDCCKFLLVISLHSFLISHAFSQSVIQIFpgriefagdrkiragdelycdswrfsvetndagewdsvpsRCVEFVQKYMtgehylsdseivsgyslkhaksanvsagdgkdawvfdidetllsnlpyyaahgfgyfvffsepldwISLFVGSYGVVILPRVMIW
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETndagewdsvpSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSAnvsagdgkdAWVFDIDETLLSNLPYYAAHGFGYFVFFSEPLDWISLFVGSYGVVILPRVMIW
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVFFSEPLDWISLFVGSYGVVILPRVMIW
**CCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVFFSEPLDWISLFVGSYGVVILPRVMI*
*DCCKFLLVISLHSFLISHAFSQSVI*********************YCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVFFSEPLDWISLFVGSYGVVILPRVMIW
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVFFSEPLDWISLFVGSYGVVILPRVMIW
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVFFSEPLDWISLFVGSYGVVILPRVMIW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVFFSEPLDWISLFVGSYGVVILPRVMIW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
P27061255 Acid phosphatase 1 OS=Sol N/A no 0.689 0.443 0.422 9e-23
P10742 291 Stem 31 kDa glycoprotein no no 0.689 0.388 0.377 5e-15
P15490254 Stem 28 kDa glycoprotein no no 0.603 0.389 0.398 7e-15
P10743254 Stem 31 kDa glycoprotein no no 0.615 0.397 0.357 9e-13
O82122265 Vegetative storage protei no no 0.518 0.320 0.390 2e-12
O49195270 Vegetative storage protei no no 0.518 0.314 0.390 4e-12
>sp|P27061|PPA1_SOLLC Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1 Back     alignment and function desciption
 Score =  105 bits (263), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 79/123 (64%), Gaps = 10/123 (8%)

Query: 16  LISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFV 75
           L SH F + +I  +P       ++++R  DEL C +WRF VETN+   W ++P  C ++V
Sbjct: 19  LNSHVFPRPLIIEYP-------EKQLR--DELKCTTWRFVVETNNLSPWKTIPEECADYV 69

Query: 76  QKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGY 135
           ++YM G  Y  + + VS  + ++AKS ++   DG+D W+FD+DETLLSNLPYY+ H +G 
Sbjct: 70  KEYMVGPGYKMEIDRVSDEAGEYAKSVDL-GDDGRDVWIFDVDETLLSNLPYYSDHRYGL 128

Query: 136 FVF 138
            VF
Sbjct: 129 EVF 131

Solanum lycopersicum (taxid: 4081)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 2
>sp|P10742|S25K_SOYBN Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2 Back     alignment and function description
>sp|P15490|VSPA_SOYBN Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1 Back     alignment and function description
>sp|P10743|VSPB_SOYBN Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1 Back     alignment and function description
>sp|O82122|VSP2_ARATH Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1 Back     alignment and function description
>sp|O49195|VSP1_ARATH Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
225445051257 PREDICTED: acid phosphatase 1-like [Viti 0.768 0.490 0.587 2e-33
255546271251 Acid phosphatase 1 precursor, putative [ 0.725 0.474 0.569 1e-31
118481785247 unknown [Populus trichocarpa] 0.591 0.392 0.650 3e-31
224091359214 predicted protein [Populus trichocarpa] 0.579 0.443 0.663 6e-31
357500937252 Acid phosphatase-like protein [Medicago 0.609 0.396 0.558 1e-25
388492444252 unknown [Medicago truncatula] 0.609 0.396 0.558 2e-25
413944719 272 stem glycoprotein [Zea mays] 0.658 0.397 0.482 1e-24
226533351 272 stem 28 kDa glycoprotein precursor [Zea 0.658 0.397 0.482 1e-24
413944720 276 hypothetical protein ZEAMMB73_279889 [Ze 0.664 0.394 0.495 2e-24
449446542257 PREDICTED: acid phosphatase 1-like [Cucu 0.713 0.455 0.442 2e-24
>gi|225445051|ref|XP_002283385.1| PREDICTED: acid phosphatase 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/131 (58%), Positives = 91/131 (69%), Gaps = 5/131 (3%)

Query: 19  HAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKY 78
            AFS S+I+I P R       K+   D L+CDSWRF+VETNDAG W SVP RCV++V+ Y
Sbjct: 18  RAFSDSLIRITPDR---RSSTKLSRDDVLFCDSWRFTVETNDAGVWVSVPDRCVQWVKDY 74

Query: 79  MTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVF 138
           MTG+ Y SDSE  +  SL  AK+  + AGDGKD WVFDIDETLLSNLPYYAAHGFG   F
Sbjct: 75  MTGDRYRSDSEFAADDSLSFAKTVQI-AGDGKDVWVFDIDETLLSNLPYYAAHGFGSEAF 133

Query: 139 FSEPLD-WISL 148
                D W++L
Sbjct: 134 DDSTFDEWVNL 144

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546271|ref|XP_002514195.1| Acid phosphatase 1 precursor, putative [Ricinus communis] gi|223546651|gb|EEF48149.1| Acid phosphatase 1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118481785|gb|ABK92831.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224091359|ref|XP_002309231.1| predicted protein [Populus trichocarpa] gi|222855207|gb|EEE92754.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357500937|ref|XP_003620757.1| Acid phosphatase-like protein [Medicago truncatula] gi|355495772|gb|AES76975.1| Acid phosphatase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388492444|gb|AFK34288.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|413944719|gb|AFW77368.1| stem glycoprotein [Zea mays] Back     alignment and taxonomy information
>gi|226533351|ref|NP_001148296.1| stem 28 kDa glycoprotein precursor [Zea mays] gi|195617212|gb|ACG30436.1| stem 28 kDa glycoprotein precursor [Zea mays] Back     alignment and taxonomy information
>gi|413944720|gb|AFW77369.1| hypothetical protein ZEAMMB73_279889 [Zea mays] Back     alignment and taxonomy information
>gi|449446542|ref|XP_004141030.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus] gi|449487983|ref|XP_004157898.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
TAIR|locus:2176267257 AT5G51260 [Arabidopsis thalian 0.823 0.525 0.436 2.8e-27
TAIR|locus:2118314 255 AT4G29260 [Arabidopsis thalian 0.554 0.356 0.546 1.5e-26
TAIR|locus:2117338260 AT4G25150 [Arabidopsis thalian 0.841 0.530 0.425 4.2e-24
TAIR|locus:2118329 256 AT4G29270 [Arabidopsis thalian 0.567 0.363 0.494 4.2e-24
TAIR|locus:2172447272 AT5G44020 [Arabidopsis thalian 0.530 0.319 0.477 1.8e-16
TAIR|locus:2024102271 AT1G04040 [Arabidopsis thalian 0.603 0.365 0.398 9.8e-16
TAIR|locus:2184585270 VSP1 "AT5G24780" [Arabidopsis 0.774 0.470 0.320 8.8e-15
TAIR|locus:2184580265 VSP2 "AT5G24770" [Arabidopsis 0.518 0.320 0.390 1.1e-14
TAIR|locus:2064128251 AT2G38600 [Arabidopsis thalian 0.524 0.342 0.379 1.6e-13
TAIR|locus:2176267 AT5G51260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 306 (112.8 bits), Expect = 2.8e-27, P = 2.8e-27
 Identities = 62/142 (43%), Positives = 87/142 (61%)

Query:     6 FLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWD 65
             FL+V+SL     + AFS S+++ +P  IE    +       L+C +WRF+ E N+   W 
Sbjct:     7 FLVVVSL----FTSAFSDSILE-YPSEIESRHKKAAEEDVNLHCTTWRFAAEMNNLAPWK 61

Query:    66 SVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNL 125
             ++P  C ++V+ Y+ G+ YL+D E VS  +L  A+S   S GDGKD W+FDIDETLLSNL
Sbjct:    62 TIPVECADYVKDYVMGKGYLTDLERVSEEALIFARSIEFS-GDGKDIWIFDIDETLLSNL 120

Query:   126 PYYAAHGFGYFVFFSEPLD-WI 146
             PYY  HGFG  +F     D W+
Sbjct:   121 PYYIDHGFGLELFDHSEFDKWV 142
GO:0003993 "acid phosphatase activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2118314 AT4G29260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117338 AT4G25150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118329 AT4G29270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172447 AT5G44020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024102 AT1G04040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184585 VSP1 "AT5G24780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184580 VSP2 "AT5G24770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064128 AT2G38600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016639001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (307 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
TIGR01675229 TIGR01675, plant-AP, plant acid phosphatase 6e-35
pfam03767213 pfam03767, Acid_phosphat_B, HAD superfamily, subfa 1e-32
TIGR01680 275 TIGR01680, Veg_Stor_Prot, vegetative storage prote 4e-19
>gnl|CDD|130736 TIGR01675, plant-AP, plant acid phosphatase Back     alignment and domain information 
 Score =  121 bits (305), Expect = 6e-35
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 1/95 (1%)

Query: 44  GDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSAN 103
            D  YC SWR  VETN+  +WD+VP+ C ++V+ YMT + Y  D + V   +  +AKS  
Sbjct: 12  IDYAYCRSWRLGVETNNIRDWDTVPAECKDYVEDYMTSKQYKRDVKRVVDEAYFYAKSLA 71

Query: 104 VSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVF 138
           +S GDG DAW+FD+D+TLLSN+PYY  HG+G    
Sbjct: 72  LS-GDGMDAWIFDVDDTLLSNIPYYKKHGYGTEKT 105

This model represents a family of acid phosphatase from plants which are most closely related to the (so called) class B non-specific acid phosphatase OlpA (TIGR01533, which is believed to be a 5'-nucleotide phosphatase) and somewhat more distantly to another class B phosphatase, AphA (TIGR01672). Together these three clades define a subfamily (pfam03767) which corresponds to the IIIB subfamily of the haloacid dehalogenase (HAD) superfamily of aspartate nucleophile hydrolases. It has been reported that the best substrate for this enzyme that could be found was purine 5'-nucleoside phosphates. This is in concordance with the assignment of the H. influenzae hel protein (from TIGR01533) as a 5'-nucleotidase, however there is presently no other evidence to support this specific function for these plant phosphatases. Many genes from this family have been annotated as vegetative storage proteins due to their close homology with these earlier-characterized gene products which are highly expressed in leaves. There are significant differences however, including expression levels and distribution. The most important difference is the lack in authentic VSPs of the nucleophilic aspartate residue, which is instead replaced by serine, glycine or asparagine. Thus these proteins can not be expected to be active phosphatases. This issue was confused by the publication in 1992 of an article claiming activity for the Glycine max VSP. In 1994 this assertion was refuted by the separation of the activity from the VSP. This model explicitly excludes the VSPs which lack the nucleophilc aspartate. The possibility exists, however, that some members of this family may, while containing all of the conserved HAD-superfamily catalytic residues, lack activity and have a function related to the function of the VSPs rather than the acid phosphatases. Length = 229
>gnl|CDD|217719 pfam03767, Acid_phosphat_B, HAD superfamily, subfamily IIIB (Acid phosphatase) Back     alignment and domain information
>gnl|CDD|130741 TIGR01680, Veg_Stor_Prot, vegetative storage protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
TIGR01675229 plant-AP plant acid phosphatase. This model explic 100.0
TIGR01680 275 Veg_Stor_Prot vegetative storage protein. The prot 100.0
PF03767 229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 99.93
TIGR01533 266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 99.41
COG2503 274 Predicted secreted acid phosphatase [General funct 98.58
PRK11009 237 aphA acid phosphatase/phosphotransferase; Provisio 97.97
TIGR01672 237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.13
PRK10725 188 fructose-1-P/6-phosphogluconate phosphatase; Provi 91.2
TIGR01549 154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 89.74
TIGR02009 185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 89.67
TIGR03351 220 PhnX-like phosphonatase-like hydrolase. This clade 89.48
COG0546 220 Gph Predicted phosphatases [General function predi 89.12
PRK10748 238 flavin mononucleotide phosphatase; Provisional 88.96
PRK13223 272 phosphoglycolate phosphatase; Provisional 88.72
PRK13226 229 phosphoglycolate phosphatase; Provisional 88.65
PHA02597 197 30.2 hypothetical protein; Provisional 88.56
TIGR02253 221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 88.22
PRK13222 226 phosphoglycolate phosphatase; Provisional 87.91
PRK13288 214 pyrophosphatase PpaX; Provisional 87.87
PRK11587 218 putative phosphatase; Provisional 87.85
TIGR01428 198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 86.42
COG3700 237 AphA Acid phosphatase (class B) [General function 86.08
COG0637 221 Predicted phosphatase/phosphohexomutase [General f 85.77
PLN02770 248 haloacid dehalogenase-like hydrolase family protei 85.34
TIGR02254 224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 85.09
PRK10563 221 6-phosphogluconate phosphatase; Provisional 84.79
PLN02779 286 haloacid dehalogenase-like hydrolase family protei 84.44
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 84.38
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 83.36
PRK06698 459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 83.25
smart00775 157 LNS2 LNS2 domain. This domain is found in Saccharo 82.73
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 81.36
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 80.57
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information 
Probab=100.00  E-value=1.1e-47  Score=321.64  Aligned_cols=119  Identities=40%  Similarity=0.696  Sum_probs=114.7

Q ss_pred             cCCCCCCcceeeeeeeecCCCcccccCcchHHHHHhhhcCCCCcchHHHHHHHHHHHHhhccccCCCCCceEEEecCccc
Q 031180           42 RAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETL  121 (164)
Q Consensus        42 ~~~~~~yC~Swrl~vE~nNl~~w~tvP~~C~~yV~~Ym~ggqY~rDl~~v~~eA~~Ya~s~~l~~~dg~dAwVfDIDET~  121 (164)
                      .+.+++||+||||+||+||+++|+|||++|++||++||+||||++|+++|+++|++|++++.++ +||+||||||||||+
T Consensus        10 ~~~~~~~c~swr~~ve~~n~~~~~~vp~~c~~~v~~Y~~~~~Y~~D~~~v~~~a~~y~~~~~~~-~dg~~A~V~DIDET~   88 (229)
T TIGR01675        10 LSIDYAYCRSWRLGVETNNIRDWDTVPAECKDYVEDYMTSKQYKRDVKRVVDEAYFYAKSLALS-GDGMDAWIFDVDDTL   88 (229)
T ss_pred             ccCCcCcchhhhhhhhhccccccccCcHHHHHHHHHhhcccccHHHHHHHHHHHHHHHHHhhcc-CCCCcEEEEcccccc
Confidence            4567999999999999999999999999999999999999999999999999999999999999 999999999999999


Q ss_pred             ccChhHHHHcCCCcccCCCCh-HHHHHhhcCCcceeeeecc
Q 031180          122 LSNLPYYAAHGFGYFVFFSEP-LDWISLFVGSYGVVILPRV  161 (164)
Q Consensus       122 LSN~pYy~~~~fG~~~~~~~~-~~Wv~~~~apAv~~~~~~~  161 (164)
                      |||+|||++|+||+++||+++ ++||.+++|||+..++.++
T Consensus        89 LsN~py~~~~~~g~~~~~~~~~~~wv~~~~apaip~al~l~  129 (229)
T TIGR01675        89 LSNIPYYKKHGYGTEKTDPTAFWLWLGKGAAPALPEGLKLY  129 (229)
T ss_pred             ccCHHHHHHhccCCCcCCHHHHHHHHHcCCCCCCHHHHHHH
Confidence            999999999999999999999 9999999999998887664

This model explicitly excludes the VSPs which lack the nucleophilc aspartate. The possibility exists, however, that some members of this family may, while containing all of the conserved HAD-superfamily catalytic residues, lack activity and have a function related to the function of the VSPs rather than the acid phosphatases.
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
2i33_A 258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 6e-07
3pct_A 260 Class C acid phosphatase; hydrolase, outer membran 2e-06
3ocu_A 262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 9e-06
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Length = 258 Back     alignment and structure
 Score = 46.5 bits (109), Expect = 6e-07
 Identities = 17/69 (24%), Positives = 25/69 (36%)

Query: 78  YMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFV 137
           Y T     +              +A     + K A V D+DET+L N P+ A        
Sbjct: 27  YQTAGEMKALYYQGYNTGQLKLDAALAKGTEKKPAIVLDLDETVLDNSPHQAMSVKTGKG 86

Query: 138 FFSEPLDWI 146
           +  +  DWI
Sbjct: 87  YPYKWDDWI 95
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Length = 260 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Length = 262 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
3pct_A 260 Class C acid phosphatase; hydrolase, outer membran 99.48
3ocu_A 262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 99.45
2i33_A 258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.04
1q92_A 197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 93.41
3kbb_A 216 Phosphorylated carbohydrates phosphatase TM_1254; 93.39
2i7d_A 193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 92.9
4gib_A 250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 92.51
3bwv_A 180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 92.18
3nuq_A 282 Protein SSM1, putative nucleotide phosphatase; sup 91.81
3e58_A 214 Putative beta-phosphoglucomutase; structu genomics 91.14
4g9b_A 243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 91.01
3dv9_A 247 Beta-phosphoglucomutase; structural genomics, APC6 90.99
1l7m_A 211 Phosphoserine phosphatase; rossmann fold, four-hel 90.65
2go7_A 207 Hydrolase, haloacid dehalogenase-like family; stru 90.57
2fi1_A 190 Hydrolase, haloacid dehalogenase-like family; stru 90.54
2b82_A 211 APHA, class B acid phosphatase; DDDD acid phosphat 90.53
2ah5_A 210 COG0546: predicted phosphatases; MCSG, structural 90.51
3ddh_A 234 Putative haloacid dehalogenase-like family hydrol; 90.46
2pke_A 251 Haloacid delahogenase-like family hydrolase; NP_63 90.42
2pib_A 216 Phosphorylated carbohydrates phosphatase TM_1254; 90.33
2hdo_A 209 Phosphoglycolate phosphatase; NP_784602.1, structu 90.02
3mc1_A 226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 89.82
1zrn_A 232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 89.79
2hi0_A 240 Putative phosphoglycolate phosphatase; YP_619066.1 89.77
2no4_A 240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 89.69
1te2_A 226 Putative phosphatase; structural genomics, phospha 89.64
3um9_A 230 Haloacid dehalogenase, type II; haloacid dehalogen 89.63
4ex6_A 237 ALNB; modified rossman fold, phosphatase, magnesiu 89.58
2w43_A 201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 89.37
2wf7_A 221 Beta-PGM, beta-phosphoglucomutase; transition stat 89.36
2fdr_A 229 Conserved hypothetical protein; SAD, structural ge 89.29
3vay_A 230 HAD-superfamily hydrolase; rossmann fold, haloacid 89.22
3s6j_A 233 Hydrolase, haloacid dehalogenase-like family; stru 89.19
3d6j_A 225 Putative haloacid dehalogenase-like hydrolase; str 89.16
2hsz_A 243 Novel predicted phosphatase; structural genomics, 89.1
3nas_A 233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 89.0
2hcf_A 234 Hydrolase, haloacid dehalogenase-like family; NP_6 88.92
2p11_A 231 Hypothetical protein; putative haloacid dehalogena 88.86
3qxg_A 243 Inorganic pyrophosphatase; hydrolase, magnesium bi 88.85
2om6_A 235 Probable phosphoserine phosphatase; rossmann fold, 88.76
3qnm_A 240 Haloacid dehalogenase-like hydrolase; structural g 88.66
3cnh_A 200 Hydrolase family protein; NP_295428.1, predicted h 88.65
1qq5_A 253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 88.63
3ed5_A 238 YFNB; APC60080, bacillus subtilis subsp. subtilis 88.57
2hoq_A 241 Putative HAD-hydrolase PH1655; haloacid dehalogena 88.51
3umb_A 233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 88.41
2nyv_A 222 Pgpase, PGP, phosphoglycolate phosphatase; structu 88.41
2gfh_A 260 Haloacid dehalogenase-like hydrolase domain conta; 88.24
3sd7_A 240 Putative phosphatase; structural genomics, haloaci 88.23
3fvv_A 232 Uncharacterized protein; unknown function, structu 87.92
3l5k_A 250 Protein GS1, haloacid dehalogenase-like hydrolase 87.88
3smv_A 240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 87.87
3kd3_A 219 Phosphoserine phosphohydrolase-like protein; csgid 87.73
3umg_A 254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 87.47
3iru_A 277 Phoshonoacetaldehyde hydrolase like protein; phosp 87.4
3umc_A 254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 87.3
3kzx_A 231 HAD-superfamily hydrolase, subfamily IA, variant; 87.28
2b0c_A 206 Putative phosphatase; alpha-D-glucose-1-phosphate, 87.22
3m9l_A 205 Hydrolase, haloacid dehalogenase-like family; HAD 87.08
1nnl_A 225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 87.02
4eek_A 259 Beta-phosphoglucomutase-related protein; hydrolase 86.72
4ap9_A 201 Phosphoserine phosphatase; hydrolase, haloacid deh 86.67
3u26_A 234 PF00702 domain protein; structural genomics, PSI-b 86.61
1swv_A 267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 86.52
2c4n_A 250 Protein NAGD; nucleotide phosphatase, HAD superfam 86.5
2i6x_A 211 Hydrolase, haloacid dehalogenase-like family; HAD 86.41
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 85.54
1rku_A 206 Homoserine kinase; phosphoserine phosphatase, phos 85.43
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 85.36
3m1y_A 217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 84.92
2qlt_A 275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 84.69
3e8m_A 164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 84.66
4dcc_A 229 Putative haloacid dehalogenase-like hydrolase; mag 84.49
2zg6_A 220 Putative uncharacterized protein ST2620, probable 84.32
2pq0_A 258 Hypothetical conserved protein GK1056; hyopthetica 84.14
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 84.13
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 84.03
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 83.84
2ho4_A 259 Haloacid dehalogenase-like hydrolase domain contai 83.62
3gyg_A 289 NTD biosynthesis operon putative hydrolase NTDB; P 83.09
2x4d_A 271 HLHPP, phospholysine phosphohistidine inorganic py 82.88
3pgv_A 285 Haloacid dehalogenase-like hydrolase; structural g 82.84
3qgm_A 268 P-nitrophenyl phosphatase (PHO2); structural genom 82.78
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 82.51
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 82.5
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 82.47
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 82.33
3dao_A 283 Putative phosphatse; structural genomics, joint ce 82.25
3mmz_A 176 Putative HAD family hydrolase; structural genomics 82.02
1yns_A 261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 81.95
2amy_A 246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 81.78
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 81.76
2fea_A 236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 81.57
3r4c_A 268 Hydrolase, haloacid dehalogenase-like hydrolase; h 81.29
3mn1_A 189 Probable YRBI family phosphatase; structural genom 81.07
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 80.89
2rbk_A 261 Putative uncharacterized protein; HAD-like phospha 80.85
3skx_A 280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 80.82
1wr8_A 231 Phosphoglycolate phosphatase; alpha / beta core do 80.61
2g80_A 253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 80.53
3ij5_A 211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 80.37
1yv9_A 264 Hydrolase, haloacid dehalogenase family; hypotheti 80.09
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
Probab=99.48  E-value=2.8e-15  Score=126.42  Aligned_cols=85  Identities=15%  Similarity=0.051  Sum_probs=71.5

Q ss_pred             HHHhhhcCCCCcchHHHHHHHHHHHHhhccccCCCCCceEEEecCcccccChhHHHHcCCCcccCCCCh-HHHHHhhcCC
Q 031180           74 FVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYFVFFSEP-LDWISLFVGS  152 (164)
Q Consensus        74 yV~~Ym~ggqY~rDl~~v~~eA~~Ya~s~~l~~~dg~dAwVfDIDET~LSN~pYy~~~~fG~~~~~~~~-~~Wv~~~~ap  152 (164)
                      -+.=|.++|+|+.|+..+.+.|..|+++.... .+.+||||||||||+|+|.|||..+++++.+|+++. ++|+..+.+|
T Consensus        23 a~~w~q~S~ey~a~~~q~~~~A~~~l~~~~~~-~g~~~avVfDIDgTlldn~~y~~~~~~~~~~f~~~~w~~wv~~g~~~  101 (260)
T 3pct_A           23 GLIWTQQSGEYAALAHQAFNSAKMAFDHAKAK-KGKKKAVVVDLDETMIDNSAYAGWQVQSGQGFSPKTWTKWVDARQSA  101 (260)
T ss_dssp             HHHHHHHCHHHHHHHHHHHHHHHHHHHHCC------CEEEEECCBTTTEECHHHHHHHHHHTCCCCHHHHHHHHHTTCCE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc-CCCCCEEEEECCccCcCChhHHHhhcccCCCCCHHHHHHHHHcCCCC
Confidence            45557799999999999999999999986544 345679999999999999999999999999999999 9999999998


Q ss_pred             cceeeee
Q 031180          153 YGVVILP  159 (164)
Q Consensus       153 Av~~~~~  159 (164)
                      +..-++.
T Consensus       102 ~~pg~~e  108 (260)
T 3pct_A          102 AIPGAVE  108 (260)
T ss_dssp             ECTTHHH
T ss_pred             CCccHHH
Confidence            7765543
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 164
d2b82a1 209 c.108.1.12 (A:4-212) Class B acid phosphatase, Aph 2e-06
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Class B acid phosphatase, AphA
domain: Class B acid phosphatase, AphA
species: Escherichia coli [TaxId: 562]

 Score = 43.4 bits (102), Expect = 2e-06
 Identities = 11/43 (25%), Positives = 18/43 (41%), Gaps = 4/43 (9%)

Query: 107 GDGKDAWVFDIDETLLSNLPYYAAHGFGY----FVFFSEPLDW 145
           G    A  FDID+T+L + P +      +      +   P+ W
Sbjct: 32  GRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFW 74

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d2b82a1 209 Class B acid phosphatase, AphA {Escherichia coli [ 98.4
d2g80a1 225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 94.05
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 93.95
d2go7a1 204 Hypothetical protein SP2064 {Streptococcus pneumon 93.93
d1te2a_ 218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 93.58
d2ah5a1 210 predicted phosphatase SP0104 {Streptococcus pneumo 92.66
d2fdra1 222 Hypothetical protein Atu0790 {Agrobacterium tumefa 92.52
d2amya1 243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 92.29
d1o08a_ 221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 92.08
d2hsza1 224 Phosphoglycolate phosphatase Gph {Haemophilus somn 92.07
d1zs9a1 253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 91.88
d2hdoa1 207 Phosphoglycolate phosphatase {Lactobacillus planta 91.37
d1j97a_ 210 Phosphoserine phosphatase {Archaeon Methanococcus 89.99
d1nnla_ 217 Phosphoserine phosphatase {Human (Homo sapiens) [T 89.74
d2fuea1 244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 87.86
d1zrna_ 220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 87.42
d2fi1a1 187 Putative hydrolase SP0805 {Streptococcus pneumonia 87.16
d1zd3a1 225 Epoxide hydrolase, N-terminal domain {Human (Homo 85.87
d2gfha1 247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 85.71
d1xvia_ 232 Putative mannosyl-3-phosphoglycerate phosphatase M 85.59
d2feaa1 226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 84.35
d1rkua_ 206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 84.27
d1wzca1 243 Putative mannosyl-3-phosphoglycerate phosphatase M 83.7
d1wr8a_ 230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 82.76
d1u7pa_ 164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 81.41
d2hcfa1 228 Hypothetical protein CT1708 {Chlorobium tepidum [T 81.16
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 80.62
d2rbka1 260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 80.45
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 80.18
d1qq5a_ 245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 80.04
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Class B acid phosphatase, AphA
domain: Class B acid phosphatase, AphA
species: Escherichia coli [TaxId: 562]

Probab=98.40  E-value=3.1e-08  Score=79.49  Aligned_cols=44  Identities=23%  Similarity=0.076  Sum_probs=29.0

Q ss_pred             CCCCceEEEecCcccccChhHHHHcC--CC--cc--cCCCCh-HHHHHhhc
Q 031180          107 GDGKDAWVFDIDETLLSNLPYYAAHG--FG--YF--VFFSEP-LDWISLFV  150 (164)
Q Consensus       107 ~dg~dAwVfDIDET~LSN~pYy~~~~--fG--~~--~~~~~~-~~Wv~~~~  150 (164)
                      +..+.|||||||||+|+|.||+..+.  |.  +.  .+++.. +.|+....
T Consensus        32 g~~P~AIifDIDETvLdnspy~~~~~~~~~~~~~~y~~~~~~W~~~~~~~~   82 (209)
T d2b82a1          32 GRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWD   82 (209)
T ss_dssp             TCCCCEEEECCBTTTEECHHHHHHHHHHHCTTSSGGGGCHHHHHHHHTTGG
T ss_pred             CCCCceEEEcchhhhhcCcHHHHhhhhhcCcCcccccCCCcchHHHhcccc
Confidence            33445999999999999999976533  21  12  245556 67766433
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure