Citrus Sinensis ID: 031197

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MAKTKPGKKDLDSYNIKGTNKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWIY
ccccccccEEEEEEEEccccEEEEcccEEEEEccccccccEEEEEEEEEEcccccEEEEEEEEEccccccccccccccccEEEEEccEEcccccEEEEEEEEEEEcccccccccccccEEEEEEEEccccccccccccEEEEEcccccccccEEEccccccccc
ccccccccccEcEEEEEcccEEEEcccEEEEEccccccccEEEEEHHEEccccccEEEEEEEEEccccccccccccccccEEEEccccccccccEEcccEEEEEHHHHHHHcccccccEEEEEEEccccccccccccEEEEEEcccccccccEEEccccccccc
maktkpgkkdldsynikgtnkvvrpgdcvlmrpadsdkppyvARVEKIEADHRNNVKVRVRwyyrpeesiggrrqfhgakelflsdhydvqsahtiegkctvhtfknytklenvgaedyfcrfeykaatggftpdrvavyckcempynpddlmvqcegckdwiy
maktkpgkkdldsynikgtnkvvrpgdcvlmrpadsdkppyvarvekieadhrnnvkvrvrwyyrpeesiggrrqFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKaatggftpdRVAVYCKCEMPYNPDDLMVQCEGCKDWIY
MAKTKPGKKDLDSYNIKGTNKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWIY
********************KVVRPGDCVLM*********YVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWI*
************SYNIKGTNKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWIY
*********DLDSYNIKGTNKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWIY
********KDLDSYNIKGTNKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWIY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKTKPGKKDLDSYNIKGTNKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
Q9P2812608 BAH and coiled-coil domai yes no 0.737 0.046 0.314 9e-11
Q3UHR02643 BAH and coiled-coil domai yes no 0.737 0.045 0.322 1e-10
Q90941 1633 Protein polybromo-1 OS=Ga no no 0.689 0.069 0.336 2e-08
Q8BSQ9 1634 Protein polybromo-1 OS=Mu no no 0.689 0.069 0.336 2e-08
Q86U86 1689 Protein polybromo-1 OS=Ho no no 0.689 0.066 0.336 3e-08
O154172968 Trinucleotide repeat-cont no no 0.731 0.040 0.274 4e-08
Q80WC32878 Trinucleotide repeat-cont no no 0.731 0.041 0.274 5e-08
Q3LHL91658 Protein winged eye OS=Dro no no 0.597 0.059 0.339 1e-07
Q8TBE0780 Bromo adjacent homology d no no 0.554 0.116 0.343 2e-05
Q497V6772 Bromo adjacent homology d no no 0.554 0.117 0.343 2e-05
>sp|Q9P281|BAHC1_HUMAN BAH and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=BAHCC1 PE=1 SV=3 Back     alignment and function desciption
 Score = 66.2 bits (160), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 61/127 (48%), Gaps = 6/127 (4%)

Query: 21   KVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAK 80
            + +R GDC +   A     PY+ R+E +     +N+ V+V+W+Y PEE+  G+RQ  G  
Sbjct: 2482 ETLRVGDCAVFLSAGRPNLPYIGRIESMWESWGSNMVVKVKWFYHPEETKLGKRQCDGKN 2541

Query: 81   ELFLSDHYDVQSAHTIEGKCTVHTFKNYTKL-ENVGAED----YFCRFEYKAATGGF-TP 134
             L+ S H D     TI  KC V   + Y ++  +   +D    Y+    Y   TG   T 
Sbjct: 2542 ALYQSCHEDENDVQTISHKCQVVAREQYEQMARSRKCQDRQDLYYLAGTYDPTTGRLVTA 2601

Query: 135  DRVAVYC 141
            D V + C
Sbjct: 2602 DGVPILC 2608

Homo sapiens (taxid: 9606)
>sp|Q3UHR0|BAHC1_MOUSE BAH and coiled-coil domain-containing protein 1 OS=Mus musculus GN=Bahcc1 PE=2 SV=2 Back     alignment and function description
>sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 Back     alignment and function description
>sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 Back     alignment and function description
>sp|O15417|TNC18_HUMAN Trinucleotide repeat-containing gene 18 protein OS=Homo sapiens GN=TNRC18 PE=1 SV=3 Back     alignment and function description
>sp|Q80WC3|TNC18_MOUSE Trinucleotide repeat-containing gene 18 protein OS=Mus musculus GN=Tnrc18 PE=1 SV=2 Back     alignment and function description
>sp|Q3LHL9|WGE_DROME Protein winged eye OS=Drosophila melanogaster GN=wge PE=1 SV=1 Back     alignment and function description
>sp|Q8TBE0|BAHD1_HUMAN Bromo adjacent homology domain-containing 1 protein OS=Homo sapiens GN=BAHD1 PE=1 SV=2 Back     alignment and function description
>sp|Q497V6|BAHD1_MOUSE Bromo adjacent homology domain-containing 1 protein OS=Mus musculus GN=Bahd1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
449453529216 PREDICTED: BAH and coiled-coil domain-co 1.0 0.759 0.957 1e-90
255568693209 phd finger transcription factor, putativ 1.0 0.784 0.957 2e-90
147773160208 hypothetical protein VITISV_022159 [Viti 1.0 0.788 0.957 3e-90
225447109215 PREDICTED: BAH and coiled-coil domain-co 1.0 0.762 0.957 4e-90
224131658216 ebs-bah-phd domain-containing protein [P 1.0 0.759 0.945 7e-90
224064916208 ebs-bah-phd domain-containing protein [P 1.0 0.788 0.926 4e-88
295913466214 transcription factor [Lycoris longituba] 1.0 0.766 0.920 8e-88
340007741162 PHD finger family protein [Populus tremu 0.987 1.0 0.944 8e-88
359494828215 PREDICTED: BAH and coiled-coil domain-co 1.0 0.762 0.926 1e-87
224101129162 ebs-bah-phd domain-containing protein [P 0.987 1.0 0.938 3e-87
>gi|449453529|ref|XP_004144509.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] gi|449493160|ref|XP_004159209.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  337 bits (863), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 157/164 (95%), Positives = 161/164 (98%)

Query: 1   MAKTKPGKKDLDSYNIKGTNKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRV 60
           MAKTKPGKKDLDSY IKGTNK+VR GDCVLMRP+DSDKPPYVARVEKIEADHRNNVKVRV
Sbjct: 1   MAKTKPGKKDLDSYTIKGTNKIVRHGDCVLMRPSDSDKPPYVARVEKIEADHRNNVKVRV 60

Query: 61  RWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYF 120
           RWYYRPEESIGGRRQFHGAKELFLSDH+DVQSAHTIEGKCTVHTFKNYTKLENVGAEDYF
Sbjct: 61  RWYYRPEESIGGRRQFHGAKELFLSDHFDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYF 120

Query: 121 CRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWIY 164
           CRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDW +
Sbjct: 121 CRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFH 164

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255568693|ref|XP_002525318.1| phd finger transcription factor, putative [Ricinus communis] gi|223535377|gb|EEF37051.1| phd finger transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147773160|emb|CAN75916.1| hypothetical protein VITISV_022159 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447109|ref|XP_002273680.1| PREDICTED: BAH and coiled-coil domain-containing protein 1 isoform 1 [Vitis vinifera] gi|359485509|ref|XP_003633285.1| PREDICTED: BAH and coiled-coil domain-containing protein 1 isoform 2 [Vitis vinifera] gi|297739198|emb|CBI28849.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224131658|ref|XP_002321145.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222861918|gb|EEE99460.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224064916|ref|XP_002301607.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222843333|gb|EEE80880.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|295913466|gb|ADG57983.1| transcription factor [Lycoris longituba] Back     alignment and taxonomy information
>gi|340007741|gb|AEK26577.1| PHD finger family protein [Populus tremula] gi|340007743|gb|AEK26578.1| PHD finger family protein [Populus tremula] gi|340007745|gb|AEK26579.1| PHD finger family protein [Populus tremula] gi|340007747|gb|AEK26580.1| PHD finger family protein [Populus tremula] Back     alignment and taxonomy information
>gi|359494828|ref|XP_003634849.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Vitis vinifera] gi|297741765|emb|CBI32994.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224101129|ref|XP_002334305.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222870814|gb|EEF07945.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|339777767|gb|AEK05721.1| early bolting in short days [Populus balsamifera] gi|339777769|gb|AEK05722.1| early bolting in short days [Populus balsamifera] gi|339777771|gb|AEK05723.1| early bolting in short days [Populus balsamifera] gi|339777773|gb|AEK05724.1| early bolting in short days [Populus balsamifera] gi|339777775|gb|AEK05725.1| early bolting in short days [Populus balsamifera] gi|339777777|gb|AEK05726.1| early bolting in short days [Populus balsamifera] gi|339777779|gb|AEK05727.1| early bolting in short days [Populus balsamifera] gi|339777781|gb|AEK05728.1| early bolting in short days [Populus balsamifera] gi|339777783|gb|AEK05729.1| early bolting in short days [Populus balsamifera] gi|339777785|gb|AEK05730.1| early bolting in short days [Populus balsamifera] gi|339777787|gb|AEK05731.1| early bolting in short days [Populus balsamifera] gi|339777789|gb|AEK05732.1| early bolting in short days [Populus balsamifera] gi|339777791|gb|AEK05733.1| early bolting in short days [Populus balsamifera] gi|339777793|gb|AEK05734.1| early bolting in short days [Populus balsamifera] gi|339777795|gb|AEK05735.1| early bolting in short days [Populus balsamifera] gi|339777797|gb|AEK05736.1| early bolting in short days [Populus balsamifera] gi|339777799|gb|AEK05737.1| early bolting in short days [Populus balsamifera] gi|339777801|gb|AEK05738.1| early bolting in short days [Populus balsamifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
TAIR|locus:2120693234 EBS "EARLY BOLTING IN SHORT DA 0.993 0.696 0.871 7.6e-80
TAIR|locus:2120252228 SHL1 "short life" [Arabidopsis 1.0 0.719 0.672 1.2e-60
TAIR|locus:2137256193 AT4G04260 [Arabidopsis thalian 0.75 0.637 0.829 4.3e-54
UNIPROTKB|F1M0741123 F1M074 "Uncharacterized protei 0.762 0.111 0.318 2.4e-11
UNIPROTKB|I3L2T42520 BAHCC1 "BAH and coiled-coil do 0.762 0.049 0.310 3.8e-11
UNIPROTKB|F8WBW82608 BAHCC1 "BAH and coiled-coil do 0.762 0.047 0.310 4e-11
UNIPROTKB|Q9P2812608 BAHCC1 "BAH and coiled-coil do 0.762 0.047 0.310 4e-11
MGI|MGI:26792722643 Bahcc1 "BAH domain and coiled- 0.762 0.047 0.318 6.6e-11
ZFIN|ZDB-GENE-010501-3 1648 pbrm1l "polybromo 1, like" [Da 0.762 0.075 0.330 7.8e-11
UNIPROTKB|F1MM812399 F1MM81 "Uncharacterized protei 0.762 0.052 0.310 1.2e-10
TAIR|locus:2120693 EBS "EARLY BOLTING IN SHORT DAYS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 802 (287.4 bits), Expect = 7.6e-80, P = 7.6e-80
 Identities = 142/163 (87%), Positives = 152/163 (93%)

Query:     2 AKTKPGKKDLDSYNIKGTNKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVR 61
             +K K G+K+LDSY IKGTNKVVR GDCVLMRP+D+ KPPYVARVEKIEAD RNNVKV  R
Sbjct:    10 SKIKTGRKELDSYTIKGTNKVVRAGDCVLMRPSDAGKPPYVARVEKIEADARNNVKVHCR 69

Query:    62 WYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFC 121
             WYYRPEES+GGRRQFHGAKELFLSDH+DVQSAHTIEGKC VHTFKNYT+LENVGAEDY+C
Sbjct:    70 WYYRPEESLGGRRQFHGAKELFLSDHFDVQSAHTIEGKCIVHTFKNYTRLENVGAEDYYC 129

Query:   122 RFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWIY 164
             RFEYKAATG FTPDRVAVYCKCEMPYNPDDLMVQCEGCKDW +
Sbjct:   130 RFEYKAATGAFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWYH 172
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009845 "seed germination" evidence=IMP
GO:0009911 "positive regulation of flower development" evidence=IGI
GO:0006333 "chromatin assembly or disassembly" evidence=RCA
TAIR|locus:2120252 SHL1 "short life" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137256 AT4G04260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1M074 F1M074 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3L2T4 BAHCC1 "BAH and coiled-coil domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8WBW8 BAHCC1 "BAH and coiled-coil domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P281 BAHCC1 "BAH and coiled-coil domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2679272 Bahcc1 "BAH domain and coiled-coil containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010501-3 pbrm1l "polybromo 1, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MM81 F1MM81 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
EBP903
ebs-bah-phd domain-containing protein (217 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
cd04714121 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo 3e-53
smart00439121 smart00439, BAH, Bromo adjacent homology domain 5e-35
pfam01426120 pfam01426, BAH, BAH domain 2e-34
cd04370123 cd04370, BAH, BAH, or Bromo Adjacent Homology doma 6e-23
cd04717121 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom 6e-15
cd04713146 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol 5e-14
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 1e-08
cd04709164 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology 3e-08
cd04710135 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Hom 5e-07
cd04721130 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homol 1e-06
cd04712130 cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homolog 1e-04
cd04760124 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homol 2e-04
cd04716122 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Ho 9e-04
cd04719128 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent 0.004
pfam0062851 pfam00628, PHD, PHD-finger 0.004
>gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information 
 Score =  164 bits (417), Expect = 3e-53
 Identities = 57/135 (42%), Positives = 70/135 (51%), Gaps = 16/135 (11%)

Query: 22  VVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKE 81
           ++R GDCVL +       PYVAR+E +  D   N+ VRV+WYYRPEE+ GGR+  HG KE
Sbjct: 3   IIRVGDCVLFKSPGRPSLPYVARIESLWEDPEGNMVVRVKWYYRPEETKGGRKPNHGEKE 62

Query: 82  LFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYC 141
           LF SDH D  S  TIE KC V TF  Y +L  V                   P     + 
Sbjct: 63  LFASDHQDENSVQTIEHKCYVLTFAEYERLARVKK----------------KPQDGVDFY 106

Query: 142 KCEMPYNPDDLMVQC 156
            C   YNPD  M++C
Sbjct: 107 YCAGTYNPDTGMLKC 121

BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 121
>gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain Back     alignment and domain information
>gnl|CDD|216495 pfam01426, BAH, BAH domain Back     alignment and domain information
>gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>gnl|CDD|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240060 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>gnl|CDD|240061 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>gnl|CDD|240072 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240063 cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>gnl|CDD|240107 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>gnl|CDD|240067 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>gnl|CDD|240070 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
cd04714121 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, 100.0
cd04713146 BAH_plant_3 BAH, or Bromo Adjacent Homology domain 100.0
cd04717121 BAH_polybromo BAH, or Bromo Adjacent Homology doma 100.0
cd04716122 BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom 100.0
PF01426119 BAH: BAH domain; InterPro: IPR001025 The BAH (brom 99.97
smart00439120 BAH Bromo adjacent homology domain. 99.97
cd04370123 BAH BAH, or Bromo Adjacent Homology domain (also c 99.97
cd04709164 BAH_MTA BAH, or Bromo Adjacent Homology domain, as 99.97
cd04721130 BAH_plant_1 BAH, or Bromo Adjacent Homology domain 99.97
cd04715159 BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom 99.97
cd04710135 BAH_fungalPHD BAH, or Bromo Adjacent Homology doma 99.96
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 99.95
cd04708202 BAH_plantDCM_II BAH, or Bromo Adjacent Homology do 99.95
cd04760124 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain 99.95
cd04720179 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do 99.95
cd04712130 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, 99.94
cd04719128 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d 99.93
KOG1886 464 consensus BAH domain proteins [Transcription] 99.92
cd04711137 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai 99.89
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 99.67
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 99.23
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 97.3
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 97.07
KOG1632 345 consensus Uncharacterized PHD Zn-finger protein [G 96.95
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 95.44
KOG1973274 consensus Chromatin remodeling protein, contains P 94.7
KOG2752 345 consensus Uncharacterized conserved protein, conta 94.0
PF0992653 DUF2158: Uncharacterized small protein (DUF2158); 93.94
COG5076371 Transcription factor involved in chromatin remodel 88.87
PRK1070862 hypothetical protein; Provisional 88.49
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 88.4
cd0583483 HDGF_related The PWWP domain is an essential part 88.31
cd0583587 Dnmt3b_related The PWWP domain is an essential com 85.89
PF0894058 DUF1918: Domain of unknown function (DUF1918); Int 84.43
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 83.44
PF1130275 DUF3104: Protein of unknown function (DUF3104); In 83.39
cd0608080 MUM1_like Mutated melanoma-associated antigen 1 (M 83.3
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 82.67
PRK1325175 transcription attenuation protein MtrB; Provisiona 82.53
cd0516287 PWWP The PWWP domain, named for a conserved Pro-Tr 81.64
PF0208175 TrpBP: Tryptophan RNA-binding attenuator protein; 80.99
PF10383139 Clr2: Transcription-silencing protein Clr2 ; Inter 80.86
COG547560 Uncharacterized small protein [Function unknown] 80.51
smart0029363 PWWP domain with conserved PWWP motif. conservatio 80.4
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information 
Probab=100.00  E-value=1.4e-36  Score=214.86  Aligned_cols=121  Identities=47%  Similarity=0.857  Sum_probs=110.1

Q ss_pred             CeEEccCCEEEEccCCCCCCCeEEEEcEEeeccCCcEEEEEEEeeecccccCcccccCCCceeEEeCCeeeeccceEEEe
Q 031197           20 NKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGK   99 (164)
Q Consensus        20 ~~~~~vGD~V~v~~~~~~~~~~ig~I~~i~~~~~g~~~v~v~Wfyrp~e~~~~~~~~~~~~Elf~s~~~d~i~~~~I~gk   99 (164)
                      |++|++||+|+|.++++++++|||+|.+||++.+|+++++|+|||||+||+++++..++++|||+|++.|++|+++|+||
T Consensus         1 ~~~~~vGD~V~v~~~~~~~~pyIgrI~~i~e~~~g~~~~~v~WfyrPeEt~~~~~~~~~~~EvF~S~~~d~~~~~~I~gk   80 (121)
T cd04714           1 KEIIRVGDCVLFKSPGRPSLPYVARIESLWEDPEGNMVVRVKWYYRPEETKGGRKPNHGEKELFASDHQDENSVQTIEHK   80 (121)
T ss_pred             CCEEEcCCEEEEeCCCCCCCCEEEEEEEEEEcCCCCEEEEEEEEEcHHHccCcccccCCCCceEecCCcccccHHHhCcc
Confidence            35999999999999875578999999999999889999999999999999999888889999999999999999999999


Q ss_pred             eEEEeeecccccCCCCcceEEEeeeeecccceecCCCcceeeeecCCCCCCCceEeC
Q 031197          100 CTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQC  156 (164)
Q Consensus       100 c~V~~~~~~~~~~~~~~~~f~cr~~yd~~~~~f~p~~~~~~C~C~~p~~pd~~~~~C  156 (164)
                      |.|+++++|.++.+..+                .+..+...|+|..++|||+.||||
T Consensus        81 c~V~~~~ey~~~~~~~~----------------~~~~~~d~~~Ce~~yn~~~~~~~c  121 (121)
T cd04714          81 CYVLTFAEYERLARVKK----------------KPQDGVDFYYCAGTYNPDTGMLKC  121 (121)
T ss_pred             cEEEehhHheecccccC----------------CCCcCCCEEEEeccCCCCcCcccC
Confidence            99999999998775333                455677899999999999999998

BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation Back     alignment and domain information
>smart00439 BAH Bromo adjacent homology domain Back     alignment and domain information
>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>KOG1886 consensus BAH domain proteins [Transcription] Back     alignment and domain information
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF09926 DUF2158: Uncharacterized small protein (DUF2158); InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>PF08940 DUF1918: Domain of unknown function (DUF1918); InterPro: IPR015035 This domain is found in various hypothetical bacterial proteins, and has no known function Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF11302 DUF3104: Protein of unknown function (DUF3104); InterPro: IPR021453 This family of proteins with unknown function appears to be restricted to Cyanobacteria Back     alignment and domain information
>cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>PRK13251 transcription attenuation protein MtrB; Provisional Back     alignment and domain information
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>PF02081 TrpBP: Tryptophan RNA-binding attenuator protein; InterPro: IPR023558 The tryptophan RNA-binding attenuation protein (TRAP) regulates expression of the tryptophan biosynthetic genes in Bacillus sp Back     alignment and domain information
>PF10383 Clr2: Transcription-silencing protein Clr2 ; InterPro: IPR018839 Clr2 (cryptic loci regulator) is a chromatin silencing protein, one of a quartet of proteins forming the core of SHREC, a multienzyme effector complex that mediates hetero-chromatic transcriptional gene silencing in fission yeast [] Back     alignment and domain information
>COG5475 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>smart00293 PWWP domain with conserved PWWP motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
1w4s_A174 Crystal Structure Of The Proximal Bah Domain Of Pol 3e-10

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 1e-46
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 1e-21
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 6e-15
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 5e-10
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 7e-15
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 1e-08
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 2e-11
3kv5_D 488 JMJC domain-containing histone demethylation prote 1e-09
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 4e-09
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 4e-08
1wem_A76 Death associated transcription factor 1; structura 1e-06
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 3e-05
3o70_A68 PHD finger protein 13; PHF13, structural genomics 3e-05
1wee_A72 PHD finger family protein; structural genomics, PH 5e-05
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 9e-05
1we9_A64 PHD finger family protein; structural genomics, PH 1e-04
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Length = 232 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 100.0
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.95
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 99.95
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.95
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.89
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 99.88
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.85
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 99.71
1m4z_A238 Origin recognition complex subunit 1; DNA replicat 99.71
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 98.72
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 98.47
1we9_A64 PHD finger family protein; structural genomics, PH 98.4
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.39
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 98.35
1wee_A72 PHD finger family protein; structural genomics, PH 98.24
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 98.22
1wem_A76 Death associated transcription factor 1; structura 98.15
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.09
1wew_A78 DNA-binding family protein; structural genomics, P 97.81
3kv5_D 488 JMJC domain-containing histone demethylation prote 97.76
2k16_A75 Transcription initiation factor TFIID subunit 3; p 97.4
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.37
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.2
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 97.19
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.16
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 97.14
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.13
1weu_A91 Inhibitor of growth family, member 4; structural g 97.11
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.0
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 96.92
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 96.05
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 95.13
3zzs_A65 Transcription attenuation protein MTRB; transcript 91.39
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 90.95
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 90.82
2yt5_A66 Metal-response element-binding transcription facto 90.06
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 88.63
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 88.52
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 87.93
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 87.73
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 86.26
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 86.01
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 83.93
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 83.67
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 82.81
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 81.58
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 81.53
1gtf_A74 Trp RNA-binding attenuation protein (trap); RNA bi 81.03
3zte_A78 Tryptophan operon RNA-binding attenuation protein; 80.89
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Back     alignment and structure
>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3zzs_A Transcription attenuation protein MTRB; transcription regulation, protein engineering; HET: TRP; 1.49A {Geobacillus stearothermophilus} SCOP: b.82.5.1 PDB: 3zzq_A* 3zzl_A* Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>1gtf_A Trp RNA-binding attenuation protein (trap); RNA binding protein-RNA complex, transcription attenuation, RNA-binding protein, Trp RNA; HET: TRP; 1.75A {Bacillus stearothermophilus} SCOP: b.82.5.1 PDB: 1c9s_A* 1gtn_A* 1qaw_A* 1utd_A* 1utf_A* 1utv_A* 2zp8_A* 3aqd_A 2zcz_A* 2zp9_A* 2zd0_A* 2ext_A* 2exs_A* 1wap_A* Back     alignment and structure
>3zte_A Tryptophan operon RNA-binding attenuation protein; RNA-binding protein, transcription factors, trinucleotide RE; HET: TRP; 2.41A {Bacillus licheniformis} SCOP: b.82.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 164
d1m4za_217 b.34.12.1 (A:) Origin-recognition complex protein 3e-21
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 1e-08
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 4e-05
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 9e-04
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 0.002
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 83.8 bits (207), Expect = 3e-21
 Identities = 19/155 (12%), Positives = 35/155 (22%), Gaps = 27/155 (17%)

Query: 24  RPGDCVLMRPADSDKPPYVARVEKIEADHRNNV-----------------------KVRV 60
             GD V+M    +     V  ++++  +  NNV                           
Sbjct: 54  GRGDSVVMHNEAAG-TYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDA 112

Query: 61  RWYYRPEESIGGRRQFH-GAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLEN--VGAE 117
               RP               EL+L+                V     +  L+       
Sbjct: 113 NILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPER 172

Query: 118 DYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDL 152
           D+  R+  +     F    +           P + 
Sbjct: 173 DFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREA 207
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d1m4za_217 Origin-recognition complex protein 120kDa subunit, 99.89
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.61
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.04
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.76
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.72
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.1
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 96.87
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 96.66
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 96.63
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 96.33
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 92.9
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 90.37
d1nppa258 N-utilization substance G protein NusG, C-terminal 85.35
d2nlua1100 Hepatoma-derived growth factor, HDGF {Human (Homo 83.34
d2a7ya180 Hypothetical protein Rv2302/MT2359 {Mycobacterium 80.89
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.89  E-value=8.8e-24  Score=159.81  Aligned_cols=142  Identities=15%  Similarity=0.119  Sum_probs=112.0

Q ss_pred             ceeeeEEEcCCCeEEccCCEEEEccCCCCCCCeEEEEcEEeeccCCc-EEEEEEEeeeccccc-----------------
Q 031197            9 KDLDSYNIKGTNKVVRPGDCVLMRPADSDKPPYVARVEKIEADHRNN-VKVRVRWYYRPEESI-----------------   70 (164)
Q Consensus         9 ~~Y~s~~i~g~~~~~~vGD~V~v~~~~~~~~~~ig~I~~i~~~~~g~-~~v~v~Wfyrp~e~~-----------------   70 (164)
                      +...+.....+++++++||+|+|++++ .+..|||+|.+|..+..++ ...-+.||+|..|..                 
T Consensus        39 ~~~~~~~r~~D~~e~~~GD~Vlvk~~~-~~~~~v~iI~ei~~~~~~~~~e~~~~~~lr~~e~~~~~~~~~~~~~~~w~~~  117 (217)
T d1m4za_          39 KTEHYLKRSSDGIKLGRGDSVVMHNEA-AGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNR  117 (217)
T ss_dssp             -CEEEEEETTTCCEECTTCEEEEEETT-TTEEEEEEEEEEEEETTTTEEEEEEEEEECGGGSCHHHHHHHHCHHHHHSCC
T ss_pred             CCcEEEEEecCCeEEecCCEEEEeCCC-CCCceEEEEeeeccCcccchheeeeecccchhhhccchhhhhcccceeeecC
Confidence            333334344467899999999999887 4789999999998876554 456666666665532                 


Q ss_pred             -----Cc-ccccCCCceeEEeCCeeeeccceEEEeeEEEeeecccccCC--CCcceEEEeeeeecccceecCCCcceeee
Q 031197           71 -----GG-RRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLEN--VGAEDYFCRFEYKAATGGFTPDRVAVYCK  142 (164)
Q Consensus        71 -----~~-~~~~~~~~Elf~s~~~d~i~~~~I~gkc~V~~~~~~~~~~~--~~~~~f~cr~~yd~~~~~f~p~~~~~~C~  142 (164)
                           .+ ++..+.+||||+|++.+.|++++|+|||.|++.++|.....  ..+++||||+.||+..+.|++..+...|.
T Consensus       118 p~e~~~~k~r~~~~~~ElflT~~~d~i~~~~I~~k~~V~s~~ef~~~~~~~~~~~~F~cr~~~D~~~~~f~~id~~~~~~  197 (217)
T d1m4za_         118 PLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKA  197 (217)
T ss_dssp             CHHHHHHHHHHHSCTTEEEEEEEEEEECGGGEEEEEEEECHHHHHHHGGGCCTTTEEEEEEECCTTSCCCEECCHHHHHH
T ss_pred             chhhhhhccccccCcceeEecCccceeehhheeeeEEEecHHHhcchhhccCCCCeEEEEEEEcCCCCceeeccHHHhhh
Confidence                 22 22236789999999999999999999999999999975432  45789999999999999999988888899


Q ss_pred             ecCCCCCCC
Q 031197          143 CEMPYNPDD  151 (164)
Q Consensus       143 C~~p~~pd~  151 (164)
                      +....||+.
T Consensus       198 ~~~~~np~~  206 (217)
T d1m4za_         198 YIKKVEPRE  206 (217)
T ss_dssp             HHTTSCHHH
T ss_pred             hccccChHH
Confidence            988888874
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a7ya1 b.34.6.3 (A:1-80) Hypothetical protein Rv2302/MT2359 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure