Citrus Sinensis ID: 031240

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDTATTCSSGDELTILSHHWDYQQHASVAAGKQLYCSEF
ccccccccccccccccccccccccccccccEEccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccHHHHccccEEEccccccccEEccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccc
ccccccEEEccccccccccHHHHccccccEEEcccccHHHHHHHHHHHHccccccccccccHccHHHHHHHHHHHHHcccccHHHcccEEEEEEccccccccEEEEEEEEEccccccccccEEccccccccccccccEEccccccHHHcHHHHHcccEEEccc
mkdkhrcveramhhncpicFEFIFDTmkditvlrcgHTIHLECLKEMEKhyrytcpvcskslWDMSKLWSKIDQEiastpmpamyqNKMVWILCndcganshvQFHVIAHKClscksyntrqtrgdtattcssgdeltilSHHWDYQqhasvaagkqlycsef
mkdkhrcveramhhncpICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDTATTCSSGDELTILSHHWDYQQHASVAAGKQLYCSEF
MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDTATTCSSGDELTILSHHWDYQQHASVAAGKQLYCSEF
******CVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDTATTCSSGDELTILSHHWDYQQHASVAAGKQLY****
***KHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIA**PMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTR******************************************
MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDTATTCSSGDELTILSHHWDYQQHASVAAGKQLYCSEF
***KHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRG**************************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDTATTCSSGDELTILSHHWDYQQHASVAAGKQLYCSEF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query163 2.2.26 [Sep-21-2011]
Q9CR50261 RING finger and CHY zinc yes no 0.760 0.475 0.48 1e-28
Q96PM5261 RING finger and CHY zinc yes no 0.760 0.475 0.472 2e-28
O14099425 Uncharacterized RING fing yes no 0.717 0.275 0.389 5e-21
>sp|Q9CR50|ZN363_MOUSE RING finger and CHY zinc finger domain-containing protein 1 OS=Mus musculus GN=Rchy1 PE=1 SV=1 Back     alignment and function desciption
 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 1   MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSK 60
           ++ KH+C+E     NCPIC E I  +     VL CGH +H  C +EM K   Y CP+C  
Sbjct: 130 LRGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKE-GYRCPLCMH 188

Query: 61  SLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNT 120
           S  DM++ W ++D E+A TPMP+ YQN  V ILCNDC   S VQFH++  KC  C SYNT
Sbjct: 189 SALDMTRYWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNT 248

Query: 121 RQTRG 125
            Q  G
Sbjct: 249 AQAGG 253
Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Increases AR transcription factor activity (By similarity). Contributes to the regulation of CDKN1B and p53/TP53 levels, and thereby contributes to the regulation of the cell cycle progression.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q96PM5|ZN363_HUMAN RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens GN=RCHY1 PE=1 SV=1 Back     alignment and function description
>sp|O14099|YERG_SCHPO Uncharacterized RING finger protein C2F3.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.16 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
255565455 275 zinc finger protein, putative [Ricinus c 0.815 0.483 0.834 4e-65
224106846 291 predicted protein [Populus trichocarpa] 0.815 0.457 0.819 3e-63
147767897211 hypothetical protein VITISV_009522 [Viti 0.822 0.635 0.768 7e-59
225436458 289 PREDICTED: RING finger and CHY zinc fing 0.822 0.463 0.768 1e-58
388513121 299 unknown [Lotus japonicus] 0.815 0.444 0.736 2e-56
225441157 289 PREDICTED: RING finger and CHY zinc fing 0.840 0.474 0.700 5e-55
255645984 298 unknown [Glycine max] 0.815 0.446 0.714 7e-54
356539356 298 PREDICTED: RING finger and CHY zinc fing 0.815 0.446 0.714 7e-54
15237169 291 ring finger and CHY zinc finger domain-c 0.822 0.460 0.711 8e-54
449518555 303 PREDICTED: RING finger and CHY zinc fing 0.865 0.465 0.697 1e-53
>gi|255565455|ref|XP_002523718.1| zinc finger protein, putative [Ricinus communis] gi|223537022|gb|EEF38658.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 126/133 (94%)

Query: 1   MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSK 60
           MKD HRCVERAMHHNCP+CFEF+FDTMKDITVL CGHTIHLEC++EME+HYRY+CPVCSK
Sbjct: 136 MKDAHRCVERAMHHNCPVCFEFLFDTMKDITVLPCGHTIHLECVREMEQHYRYSCPVCSK 195

Query: 61  SLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNT 120
           S+ DMSKLW K+DQEIA+TPMP +YQNKMVWILCNDCGANSHVQFH++AHKCL+CKSYNT
Sbjct: 196 SICDMSKLWRKLDQEIAATPMPEIYQNKMVWILCNDCGANSHVQFHIVAHKCLNCKSYNT 255

Query: 121 RQTRGDTATTCSS 133
           RQTRGD+  +CSS
Sbjct: 256 RQTRGDSTASCSS 268

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106846|ref|XP_002314304.1| predicted protein [Populus trichocarpa] gi|222850712|gb|EEE88259.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147767897|emb|CAN64539.1| hypothetical protein VITISV_009522 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225436458|ref|XP_002274709.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Vitis vinifera] gi|297734901|emb|CBI17135.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388513121|gb|AFK44622.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225441157|ref|XP_002268193.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform 2 [Vitis vinifera] gi|225441159|ref|XP_002268149.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform 1 [Vitis vinifera] gi|297739980|emb|CBI30162.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255645984|gb|ACU23480.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356539356|ref|XP_003538164.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|15237169|ref|NP_197683.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] gi|10177239|dbj|BAB10613.1| PGPD14 protein [Arabidopsis thaliana] gi|15450521|gb|AAK96553.1| AT5g22920/MRN17_15 [Arabidopsis thaliana] gi|27363264|gb|AAO11551.1| At5g22920/MRN17_15 [Arabidopsis thaliana] gi|66865966|gb|AAY57617.1| RING finger family protein [Arabidopsis thaliana] gi|332005714|gb|AED93097.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449518555|ref|XP_004166307.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
TAIR|locus:2172656291 AT5G22920 [Arabidopsis thalian 0.822 0.460 0.711 4.2e-56
TAIR|locus:2180074267 MIEL1 "MYB30-Interacting E3 Li 0.742 0.453 0.537 3.3e-40
TAIR|locus:2099212287 AT3G62970 [Arabidopsis thalian 0.742 0.421 0.459 3.2e-33
TAIR|locus:2179474328 AT5G25560 [Arabidopsis thalian 0.552 0.274 0.655 5.2e-33
UNIPROTKB|F1P5N8190 RCHY1 "Uncharacterized protein 0.742 0.636 0.483 2.6e-31
ZFIN|ZDB-GENE-040801-73264 rchy1 "ring finger and CHY zin 0.895 0.553 0.436 5.4e-31
RGD|1359180261 Rchy1 "ring finger and CHY zin 0.785 0.490 0.472 1.1e-30
UNIPROTKB|F1RYV2232 RCHY1 "Uncharacterized protein 0.760 0.534 0.48 1.4e-30
UNIPROTKB|E7ETW5239 RCHY1 "RING finger and CHY zin 0.760 0.518 0.472 1.8e-30
UNIPROTKB|J3KPI0221 RCHY1 "RING finger and CHY zin 0.760 0.561 0.472 1.8e-30
TAIR|locus:2172656 AT5G22920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 578 (208.5 bits), Expect = 4.2e-56, P = 4.2e-56
 Identities = 96/135 (71%), Positives = 118/135 (87%)

Query:     1 MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSK 60
             M+DKH+CVE AMHHNCP+CFE++FD+ +DITVLRCGHT+HLEC K+M  H RYTCPVCSK
Sbjct:   148 MEDKHQCVEGAMHHNCPVCFEYLFDSTRDITVLRCGHTMHLECTKDMGLHNRYTCPVCSK 207

Query:    61 SLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNT 120
             S+ DMS LW K+D+E+A+ PMP MY+NKMVWILCNDCG+N++V+FH+IAHKC SC SYNT
Sbjct:   208 SICDMSNLWKKLDEEVAAYPMPKMYENKMVWILCNDCGSNTNVRFHLIAHKCSSCGSYNT 267

Query:   121 RQT-RGDTATTCSSG 134
             RQT RG  + +CSSG
Sbjct:   268 RQTQRGSDSHSCSSG 282
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2180074 MIEL1 "MYB30-Interacting E3 Ligase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099212 AT3G62970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179474 AT5G25560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5N8 RCHY1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-73 rchy1 "ring finger and CHY zinc finger domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1359180 Rchy1 "ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYV2 RCHY1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETW5 RCHY1 "RING finger and CHY zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KPI0 RCHY1 "RING finger and CHY zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-05
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-04
smart0018440 smart00184, RING, Ring finger 2e-04
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 0.004
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information 
 Score = 40.1 bits (94), Expect = 1e-05
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 3/47 (6%)

Query: 16 CPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSL 62
          CPIC E   +    + +L CGH     C+ +  K  + TCP+C   +
Sbjct: 2  CPICLEEFRE---PVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTPI 45

Length = 45
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 163
KOG1940276 consensus Zn-finger protein [General function pred 99.95
PF1459961 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A. 99.9
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 99.81
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.4
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.2
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.13
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.13
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.09
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.08
PHA02929238 N1R/p28-like protein; Provisional 99.06
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.05
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.05
PF1463444 zf-RING_5: zinc-RING finger domain 99.04
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.03
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.99
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.98
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.93
PHA02926242 zinc finger-like protein; Provisional 98.88
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.84
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.8
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.75
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.75
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.7
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.68
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.56
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.5
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.45
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.44
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.4
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.34
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.26
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.2
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.15
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.15
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.06
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.02
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.9
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.88
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.87
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.78
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.77
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.74
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.74
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.66
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.59
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 97.48
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.42
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.34
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
KOG1941518 consensus Acetylcholine receptor-associated protei 97.3
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.29
COG52191525 Uncharacterized conserved protein, contains RING Z 97.13
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.11
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 97.09
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.04
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.02
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.01
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.93
COG5152259 Uncharacterized conserved protein, contains RING a 96.71
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.54
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.51
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.42
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.41
KOG2660 331 consensus Locus-specific chromosome binding protei 96.34
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.33
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.19
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.15
PF04641260 Rtf2: Rtf2 RING-finger 96.08
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 96.08
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.01
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.74
KOG4445368 consensus Uncharacterized conserved protein, conta 95.68
KOG3002 299 consensus Zn finger protein [General function pred 95.61
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 95.43
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.41
COG5222427 Uncharacterized conserved protein, contains RING Z 95.4
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 95.37
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.34
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.28
KOG4739233 consensus Uncharacterized protein involved in syna 95.26
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.23
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 95.19
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.81
PHA02862156 5L protein; Provisional 94.79
PHA02825162 LAP/PHD finger-like protein; Provisional 94.69
PF0214863 zf-UBP: Zn-finger in ubiquitin-hydrolases and othe 94.65
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.61
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.24
PHA03096284 p28-like protein; Provisional 94.12
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 93.64
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 93.63
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 93.02
KOG1001674 consensus Helicase-like transcription factor HLTF/ 92.24
KOG4367 699 consensus Predicted Zn-finger protein [Function un 92.21
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 92.16
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 91.25
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 90.28
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 90.2
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 90.08
KOG02981394 consensus DEAD box-containing helicase-like transc 89.12
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 88.99
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 88.38
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 88.31
smart0029050 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like 88.0
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 87.95
KOG03091081 consensus Conserved WD40 repeat-containing protein 87.54
COG5109396 Uncharacterized conserved protein, contains RING Z 87.31
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 86.95
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 86.26
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 85.63
PF10272358 Tmpp129: Putative transmembrane protein precursor; 85.3
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 85.02
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 84.33
PRK1228657 rpmF 50S ribosomal protein L32; Reviewed 83.89
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 83.42
KOG2068327 consensus MOT2 transcription factor [Transcription 83.24
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 81.79
COG0375115 HybF Zn finger protein HypA/HybF (possibly regulat 81.08
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=99.95  E-value=5.8e-29  Score=203.61  Aligned_cols=126  Identities=48%  Similarity=0.970  Sum_probs=119.9

Q ss_pred             CCCCcceecCCCccccccccccccCcCCccEEecCCChhhHHHHHHHHhcCCCCCCCCCCCccchhHHHHhHHHHHhcCC
Q 031240            1 MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTP   80 (163)
Q Consensus         1 ~~~~H~c~e~s~~~~CpIC~e~l~~s~~~~~~L~CGH~fh~~Cl~~~~~~~~~~CPiCr~~~~~~~~~~~~l~~~~~~~~   80 (163)
                      +.++|+|+|++++.+||||.|.||++...+..++|||++|.+|++++...+ |+||+|.+ +.+|+.+|++++.+++.++
T Consensus       146 ~~~~H~c~e~~~~~ncPic~e~l~~s~~~~~~~~CgH~~h~~cf~e~~~~~-y~CP~C~~-~~d~~~~~~~~d~~l~~~~  223 (276)
T KOG1940|consen  146 LSNWHKCVERSSEFNCPICKEYLFLSFEDAGVLKCGHYMHSRCFEEMICEG-YTCPICSK-PGDMSHYFRKLDKELAGSP  223 (276)
T ss_pred             cccccchhhhcccCCCchhHHHhccccccCCccCcccchHHHHHHHHhccC-CCCCcccc-hHHHHHHHHHHHHHHhcCC
Confidence            356799999999999999999999999999999999999999999998866 99999999 9999999999999999999


Q ss_pred             CChhhhcCcceeeCCCCCCCCcccceeeeccCCCCCCCccccccCCCC
Q 031240           81 MPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDTA  128 (163)
Q Consensus        81 ~p~e~~~~~~~i~C~dC~~~~~~~~h~~~~kC~~C~synt~~~~~~~~  128 (163)
                      ||++|++++++|+||||+..++++||++++||+.|+|||||.++.+..
T Consensus       224 ~p~~y~~~~~~i~cndC~~~~~~k~~~l~~kc~~c~~~~~r~~~~~~~  271 (276)
T KOG1940|consen  224 MPEEYKNKTQDILCNDCGSGTNVKYHILYHKCGKCGSYNTRMISDPSK  271 (276)
T ss_pred             CCchhhchhheeeccCCCCCCccceehhhhhCCCcccceeeeccCCCc
Confidence            999999999999999999999999999999999999999999985554

>PF14599 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF02148 zf-UBP: Zn-finger in ubiquitin-hydrolases and other protein; InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
2k2d_A79 Solution Nmr Structure Of C-Terminal Domain Of Huma 3e-16
2jrj_A52 Solution Structure Of The Human Pirh2 Ring-H2 Domai 3e-04
2ecm_A55 Solution Structure Of The Ring Domain Of The Ring F 5e-04
>pdb|2K2D|A Chain A, Solution Nmr Structure Of C-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2c Length = 79 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 44/65 (67%)
Query: 61  SLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNT 120
           S  DM++ W ++D E+A TPMP+ YQN  V ILCNDC   S VQFH++  KC  C+SYNT
Sbjct: 7   SALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNT 66
Query: 121 RQTRG 125
            Q  G
Sbjct: 67  AQAGG 71
>pdb|2JRJ|A Chain A, Solution Structure Of The Human Pirh2 Ring-H2 Domain. Northeast Structural Genomics Consortium Target Ht2b Length = 52 Back     alignment and structure
>pdb|2ECM|A Chain A, Solution Structure Of The Ring Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 55 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
2k2d_A79 Ring finger and CHY zinc finger domain- containing 1e-32
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-15
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 4e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 6e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 9e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-05
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 4e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 7e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-04
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 4e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 4e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 6e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 8e-04
>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Length = 79 Back     alignment and structure
 Score =  109 bits (275), Expect = 1e-32
 Identities = 35/68 (51%), Positives = 44/68 (64%)

Query: 58  CSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKS 117
              S  DM++ W ++D E+A TPMP+ YQN  V ILCNDC   S VQFH++  KC  C+S
Sbjct: 4   MMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICES 63

Query: 118 YNTRQTRG 125
           YNT Q  G
Sbjct: 64  YNTAQAGG 71
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
2k2d_A79 Ring finger and CHY zinc finger domain- containing 99.91
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.49
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.39
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.38
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.38
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.38
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.36
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.35
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.35
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.35
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.34
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.33
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.33
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.33
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.33
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.32
2ect_A78 Ring finger protein 126; metal binding protein, st 99.32
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.31
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.31
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.3
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.3
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.28
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.28
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.27
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.27
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.26
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.26
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.25
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.24
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.21
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.21
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.2
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.2
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.19
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.19
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.18
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.17
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.16
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.16
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.15
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.14
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.14
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.11
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.1
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.08
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.03
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.02
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.01
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.0
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.0
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.0
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.0
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.99
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.97
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.96
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.95
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.94
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.9
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.88
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.82
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.82
2ea5_A68 Cell growth regulator with ring finger domain prot 98.76
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.73
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.72
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.67
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.53
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.51
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.4
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.31
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.29
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.07
3c5k_A109 HD6, histone deacetylase 6; HDAC6, zinc finger, ac 97.14
2i50_A126 Ubiquitin carboxyl-terminal hydrolase 16; alpha/be 96.92
2g45_A129 Ubiquitin carboxyl-terminal hydrolase 5; zinc fing 96.89
3nw0_A238 Non-structural maintenance of chromosomes element 96.88
2uzg_A97 Ubiquitin carboxyl-terminal hydrolase 33; UBL conj 96.33
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.73
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.47
3ihp_A 854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 95.03
2ida_A102 Hypothetical protein; zinc binding protein, struct 92.9
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 90.23
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 89.67
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 88.46
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 87.94
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 86.6
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 85.98
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 85.79
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 84.5
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 84.43
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 81.55
2zjr_Z60 50S ribosomal protein L32; ribosome, large ribosom 80.91
>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
Probab=99.91  E-value=4.3e-26  Score=154.65  Aligned_cols=75  Identities=47%  Similarity=0.836  Sum_probs=40.1

Q ss_pred             CCCCCCCccchhHHHHhHHHHHhcCCCChhhhcCcceeeCCCCCCCCcccceeeeccCCCCCCCccccccCCCCC
Q 031240           55 CPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDTAT  129 (163)
Q Consensus        55 CPiCr~~~~~~~~~~~~l~~~~~~~~~p~e~~~~~~~i~C~dC~~~~~~~~h~~~~kC~~C~synt~~~~~~~~~  129 (163)
                      ||+|++++.||+..|++||++++.++||++|++++++|+||||++++.+.|||+|+||+.|+||||+++++...+
T Consensus         1 ~~~c~ks~~dm~~~~~~lD~~ia~~pmP~~y~~~~v~I~CnDC~~~s~v~~h~lg~kC~~C~SyNTr~~~G~~~~   75 (79)
T 2k2d_A            1 GSHMMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRIS   75 (79)
T ss_dssp             --------------------------------CCEEEEEESSSCCEEEEECCTTCCCCTTTSCCCEEESCCCCCC
T ss_pred             CCcccccHHHHHHHHHHHHHHHHhCCCCHHHhCCEeEEECCCCCCCccCCceeecccCcCCCCcCeEecCCCCCC
Confidence            899999999999999999999999999999999999999999999999999999999999999999999865543
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3c5k_A HD6, histone deacetylase 6; HDAC6, zinc finger, actin-binding, chromatin regulator, cytoplasm, hydrolase, metal-binding, nucleus, phosphoprotein; 1.55A {Homo sapiens} PDB: 3gv4_A 3phd_A Back     alignment and structure
>2i50_A Ubiquitin carboxyl-terminal hydrolase 16; alpha/beta zinc-finger, ring-finger, ZNF-UBP, metalloprotein, ubiquitin-binding protein, USP; NMR {Homo sapiens} Back     alignment and structure
>2g45_A Ubiquitin carboxyl-terminal hydrolase 5; zinc finger, hydrolase; 1.99A {Homo sapiens} SCOP: g.44.1.5 PDB: 2g43_A 2l80_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2ida_A Hypothetical protein; zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} SCOP: g.44.1.5 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2zjr_Z 50S ribosomal protein L32; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: g.41.8.5 PDB: 1j5a_M* 1jzy_M* 1jzz_M* 1k01_M* 1nkw_Z 1ond_Z* 1sm1_Z* 1yl3_5 2b66_5 2b9n_5 2b9p_5 2zjp_Y* 2zjq_Z 1jzx_M 3cf5_Y* 3dll_Y* 3pio_Z* 3pip_Z* 1nwy_Z* 1nwx_Z* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 163
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 7e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-04
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 1e-04
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 4e-04
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 41.9 bits (98), Expect = 2e-06
 Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 4/47 (8%)

Query: 16 CPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSL 62
          C IC E      KD+ +  CGH +   CL   ++     CP C   +
Sbjct: 26 CKICAE----NDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEI 68
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.55
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.46
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.46
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.38
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.35
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.33
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.27
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.27
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.25
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.21
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.14
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.14
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.08
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.02
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.65
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.61
d2uzga195 Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {H 96.22
d2g45a1113 Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Hum 94.93
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 90.33
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 89.81
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 87.33
d2idaa1102 Hypothetical protein RPA1320 {Rhodopseudomonas pal 86.24
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 85.39
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 83.97
d2j015159 Ribosomal protein L32p {Thermus thermophilus [TaxI 80.21
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Not-4 N-terminal RING finger domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.55  E-value=5.1e-16  Score=95.49  Aligned_cols=50  Identities=24%  Similarity=0.469  Sum_probs=41.8

Q ss_pred             cccccccccccCcCCccEEecCCChhhHHHHHHHHhcCCCCCCCCCCCcc
Q 031240           14 HNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLW   63 (163)
Q Consensus        14 ~~CpIC~e~l~~s~~~~~~L~CGH~fh~~Cl~~~~~~~~~~CPiCr~~~~   63 (163)
                      .+||||++.|......+..++|||.||..|+.+|++..+.+||+||+++.
T Consensus         1 leCpICl~~~~~~~~~~~~~~CgH~~c~~C~~~w~~~~~~~CP~CR~~~~   50 (52)
T d1ur6b_           1 VECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYP   50 (52)
T ss_dssp             CEETTTTEECCGGGTTCCSSSSSCCCCHHHHHHHTTTSCCBCTTTCCBCS
T ss_pred             CCCcCCChhhhCCCceEEecCCCCccchHHHHHHHhhcCCCCCccCCcCC
Confidence            37999999875554555667999999999999999876778999999874
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2uzga1 g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g45a1 g.44.1.5 (A:173-285) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2idaa1 g.44.1.5 (A:1-102) Hypothetical protein RPA1320 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure