Citrus Sinensis ID: 031269
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| 356516937 | 216 | PREDICTED: BAH and coiled-coil domain-co | 1.0 | 0.75 | 0.913 | 3e-86 | |
| 255543795 | 216 | phd finger transcription factor, putativ | 1.0 | 0.75 | 0.913 | 9e-86 | |
| 351726182 | 216 | uncharacterized protein LOC100526926 [Gl | 1.0 | 0.75 | 0.907 | 5e-85 | |
| 449461597 | 216 | PREDICTED: BAH and coiled-coil domain-co | 1.0 | 0.75 | 0.888 | 2e-84 | |
| 224077882 | 215 | ebs-bah-phd domain-containing protein [P | 1.0 | 0.753 | 0.907 | 4e-84 | |
| 224105329 | 215 | predicted protein [Populus trichocarpa] | 1.0 | 0.753 | 0.895 | 2e-82 | |
| 225427692 | 224 | PREDICTED: chromatin structure-remodelin | 0.993 | 0.718 | 0.882 | 3e-82 | |
| 297744763 | 215 | unnamed protein product [Vitis vinifera] | 0.993 | 0.748 | 0.882 | 3e-82 | |
| 289540938 | 292 | zinc-mediated transcriptional activator | 1.0 | 0.554 | 0.870 | 7e-82 | |
| 357467401 | 218 | Ebs-bah-phd domain-containing protein [M | 1.0 | 0.743 | 0.871 | 4e-81 |
| >gi|356516937|ref|XP_003527148.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 322 bits (825), Expect = 3e-86, Method: Compositional matrix adjust.
Identities = 148/162 (91%), Positives = 158/162 (97%)
Query: 1 MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVH 60
MAKPKAPRRTLESY+VK ISKTI+ GDC+LMRPS+PSKPSYVA+IERIE+DARGANVK+H
Sbjct: 1 MAKPKAPRRTLESYSVKHISKTIRAGDCILMRPSDPSKPSYVARIERIEADARGANVKIH 60
Query: 61 VRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDF 120
VRWYYRPEESIGGRRQFHGSKEVFLSDH D+QSADTIE KCTVHSFKSYTKLDAVGNDDF
Sbjct: 61 VRWYYRPEESIGGRRQFHGSKEVFLSDHFDVQSADTIEAKCTVHSFKSYTKLDAVGNDDF 120
Query: 121 FCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSD 162
FCRFEYNSS+GAFNPDRVAVYCKCEMPYNPDDLMVQCEGC+D
Sbjct: 121 FCRFEYNSSTGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCTD 162
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255543795|ref|XP_002512960.1| phd finger transcription factor, putative [Ricinus communis] gi|223547971|gb|EEF49463.1| phd finger transcription factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|351726182|ref|NP_001236094.1| uncharacterized protein LOC100526926 [Glycine max] gi|255631163|gb|ACU15947.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449461597|ref|XP_004148528.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] gi|449516389|ref|XP_004165229.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224077882|ref|XP_002305450.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222848414|gb|EEE85961.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224105329|ref|XP_002313771.1| predicted protein [Populus trichocarpa] gi|222850179|gb|EEE87726.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225427692|ref|XP_002263493.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297744763|emb|CBI38025.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|289540938|gb|ADD09609.1| zinc-mediated transcriptional activator [Trifolium repens] | Back alignment and taxonomy information |
|---|
| >gi|357467401|ref|XP_003603985.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|355493033|gb|AES74236.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|388498190|gb|AFK37161.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| TAIR|locus:2120252 | 228 | SHL1 "short life" [Arabidopsis | 1.0 | 0.710 | 0.777 | 1.8e-69 | |
| TAIR|locus:2120693 | 234 | EBS "EARLY BOLTING IN SHORT DA | 0.987 | 0.683 | 0.701 | 1.4e-64 | |
| TAIR|locus:2137256 | 193 | AT4G04260 [Arabidopsis thalian | 0.759 | 0.637 | 0.677 | 7.1e-45 | |
| UNIPROTKB|F1NFN2 | 473 | BAHD1 "Uncharacterized protein | 0.635 | 0.217 | 0.373 | 1e-10 | |
| UNIPROTKB|F1PKB9 | 776 | BAHD1 "Uncharacterized protein | 0.635 | 0.132 | 0.383 | 3.7e-10 | |
| UNIPROTKB|F1M074 | 1123 | F1M074 "Uncharacterized protei | 0.654 | 0.094 | 0.333 | 1.2e-09 | |
| MGI|MGI:2139371 | 772 | Bahd1 "bromo adjacent homology | 0.635 | 0.133 | 0.381 | 2e-09 | |
| RGD|1563127 | 772 | Bahd1 "bromo adjacent homology | 0.635 | 0.133 | 0.381 | 2e-09 | |
| UNIPROTKB|F1SSR6 | 778 | BAHD1 "Uncharacterized protein | 0.635 | 0.132 | 0.381 | 2.1e-09 | |
| UNIPROTKB|F1MSG4 | 779 | BAHD1 "Uncharacterized protein | 0.635 | 0.132 | 0.381 | 2.1e-09 |
| TAIR|locus:2120252 SHL1 "short life" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 704 (252.9 bits), Expect = 1.8e-69, P = 1.8e-69
Identities = 126/162 (77%), Positives = 144/162 (88%)
Query: 1 MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVH 60
M K KAPR+ L+SY +K I+K+I+ GD VLMR SEP KPSYVA++E IE+DARG++ KV
Sbjct: 1 MPKQKAPRKQLKSYKLKHINKSIQEGDAVLMRSSEPGKPSYVARVEAIETDARGSHAKVR 60
Query: 61 VRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDF 120
VRWYYRPEESIGGRRQFHG+KEVFLSDH D QSADTIEGKC VHSF SYTKLD+VGNDDF
Sbjct: 61 VRWYYRPEESIGGRRQFHGAKEVFLSDHFDFQSADTIEGKCKVHSFSSYTKLDSVGNDDF 120
Query: 121 FCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSD 162
FCRFEYNS++GAF+PDRV V+CKCEMPYNPDDLMVQCE CS+
Sbjct: 121 FCRFEYNSTTGAFDPDRVTVFCKCEMPYNPDDLMVQCEECSE 162
|
|
| TAIR|locus:2120693 EBS "EARLY BOLTING IN SHORT DAYS" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2137256 AT4G04260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NFN2 BAHD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PKB9 BAHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M074 F1M074 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2139371 Bahd1 "bromo adjacent homology domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1563127 Bahd1 "bromo adjacent homology domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SSR6 BAHD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MSG4 BAHD1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 162 | |||
| cd04714 | 121 | cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo | 1e-47 | |
| smart00439 | 121 | smart00439, BAH, Bromo adjacent homology domain | 9e-38 | |
| pfam01426 | 120 | pfam01426, BAH, BAH domain | 2e-35 | |
| cd04370 | 123 | cd04370, BAH, BAH, or Bromo Adjacent Homology doma | 6e-26 | |
| cd04717 | 121 | cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom | 1e-17 | |
| cd04713 | 146 | cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol | 3e-12 | |
| cd04721 | 130 | cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homol | 4e-09 | |
| cd04718 | 148 | cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol | 2e-08 | |
| cd04712 | 130 | cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homolog | 2e-08 | |
| cd04709 | 164 | cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology | 7e-07 | |
| cd04710 | 135 | cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Hom | 1e-06 | |
| cd04760 | 124 | cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homol | 3e-05 | |
| cd04720 | 179 | cd04720, BAH_Orc1p_Yeast, BAH, or Bromo Adjacent H | 5e-05 | |
| cd04719 | 128 | cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent | 0.002 | |
| cd04716 | 122 | cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Ho | 0.002 |
| >gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
Score = 150 bits (380), Expect = 1e-47
Identities = 54/136 (39%), Positives = 68/136 (50%), Gaps = 17/136 (12%)
Query: 22 TIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSK 81
I+ GDCVL + YVA+IE + D G N+ V V+WYYRPEE+ GGR+ HG K
Sbjct: 3 IIRVGDCVLFKSPGRPSLPYVARIESLWEDPEG-NMVVRVKWYYRPEETKGGRKPNHGEK 61
Query: 82 EVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVY 141
E+F SDH D S TIE KC V +F Y +L V P +
Sbjct: 62 ELFASDHQDENSVQTIEHKCYVLTFAEYERLARVKK----------------KPQDGVDF 105
Query: 142 CKCEMPYNPDDLMVQC 157
C YNPD M++C
Sbjct: 106 YYCAGTYNPDTGMLKC 121
|
BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 121 |
| >gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|216495 pfam01426, BAH, BAH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >gnl|CDD|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240072 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240063 cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 | Back alignment and domain information |
|---|
| >gnl|CDD|240060 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240061 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains | Back alignment and domain information |
|---|
| >gnl|CDD|240107 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240071 cd04720, BAH_Orc1p_Yeast, BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p | Back alignment and domain information |
|---|
| >gnl|CDD|240070 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p | Back alignment and domain information |
|---|
| >gnl|CDD|240067 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| cd04714 | 121 | BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, | 100.0 | |
| cd04713 | 146 | BAH_plant_3 BAH, or Bromo Adjacent Homology domain | 100.0 | |
| cd04717 | 121 | BAH_polybromo BAH, or Bromo Adjacent Homology doma | 100.0 | |
| cd04716 | 122 | BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom | 99.98 | |
| PF01426 | 119 | BAH: BAH domain; InterPro: IPR001025 The BAH (brom | 99.97 | |
| smart00439 | 120 | BAH Bromo adjacent homology domain. | 99.97 | |
| cd04370 | 123 | BAH BAH, or Bromo Adjacent Homology domain (also c | 99.97 | |
| cd04721 | 130 | BAH_plant_1 BAH, or Bromo Adjacent Homology domain | 99.97 | |
| cd04709 | 164 | BAH_MTA BAH, or Bromo Adjacent Homology domain, as | 99.97 | |
| cd04715 | 159 | BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom | 99.96 | |
| cd04710 | 135 | BAH_fungalPHD BAH, or Bromo Adjacent Homology doma | 99.96 | |
| cd04712 | 130 | BAH_DCM_I BAH, or Bromo Adjacent Homology domain, | 99.95 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 99.95 | |
| cd04720 | 179 | BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do | 99.94 | |
| cd04760 | 124 | BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain | 99.94 | |
| cd04708 | 202 | BAH_plantDCM_II BAH, or Bromo Adjacent Homology do | 99.94 | |
| cd04719 | 128 | BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d | 99.91 | |
| KOG1886 | 464 | consensus BAH domain proteins [Transcription] | 99.9 | |
| cd04711 | 137 | BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai | 99.88 | |
| KOG1827 | 629 | consensus Chromatin remodeling complex RSC, subuni | 99.76 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 99.06 | |
| KOG1632 | 345 | consensus Uncharacterized PHD Zn-finger protein [G | 94.14 | |
| PF09926 | 53 | DUF2158: Uncharacterized small protein (DUF2158); | 92.78 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 92.41 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 91.39 | |
| cd05834 | 83 | HDGF_related The PWWP domain is an essential part | 89.04 | |
| cd05835 | 87 | Dnmt3b_related The PWWP domain is an essential com | 88.92 | |
| PF10383 | 139 | Clr2: Transcription-silencing protein Clr2 ; Inter | 88.69 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 88.08 | |
| COG5475 | 60 | Uncharacterized small protein [Function unknown] | 85.89 | |
| cd06080 | 80 | MUM1_like Mutated melanoma-associated antigen 1 (M | 85.84 | |
| PRK10708 | 62 | hypothetical protein; Provisional | 85.43 | |
| PF11302 | 75 | DUF3104: Protein of unknown function (DUF3104); In | 85.37 | |
| PF10781 | 62 | DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR | 85.23 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 83.91 | |
| smart00293 | 63 | PWWP domain with conserved PWWP motif. conservatio | 80.94 | |
| PF08940 | 58 | DUF1918: Domain of unknown function (DUF1918); Int | 80.54 | |
| cd05162 | 87 | PWWP The PWWP domain, named for a conserved Pro-Tr | 80.04 |
| >cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.5e-36 Score=211.49 Aligned_cols=120 Identities=44% Similarity=0.819 Sum_probs=109.2
Q ss_pred cEEccCCEEEEecCCCCCCCeEEEEeEEEecCCCCeEEEEEEEeecccccCCcccccCCCCeeEEecceecCccCcEEee
Q 031269 21 KTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGK 100 (162)
Q Consensus 21 ~~~~vGD~V~v~~~~~~~~~~Ig~I~~i~~~~~g~~~~v~v~Wfyrp~e~~~~~~~~~~~~Elf~s~~~d~~~~~~I~gk 100 (162)
++|++||+|+|.+++++.++|||+|++||++.+|+ ++++|+|||||+||.++++..++++|||+|++.|.+|+++|+||
T Consensus 2 ~~~~vGD~V~v~~~~~~~~pyIgrI~~i~e~~~g~-~~~~v~WfyrPeEt~~~~~~~~~~~EvF~S~~~d~~~~~~I~gk 80 (121)
T cd04714 2 EIIRVGDCVLFKSPGRPSLPYVARIESLWEDPEGN-MVVRVKWYYRPEETKGGRKPNHGEKELFASDHQDENSVQTIEHK 80 (121)
T ss_pred CEEEcCCEEEEeCCCCCCCCEEEEEEEEEEcCCCC-EEEEEEEEEcHHHccCcccccCCCCceEecCCcccccHHHhCcc
Confidence 49999999999998755789999999999998888 99999999999999999887789999999999999999999999
Q ss_pred eEEEecccccccCCCCCCeEEEeeeeccCcceeccCCCceeeecCCCCCCCcceeec
Q 031269 101 CTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQC 157 (162)
Q Consensus 101 c~V~~~~~~~~~~~~~~~~f~cr~~yd~~~~~f~p~~~~~~C~c~~~~npd~~~~~C 157 (162)
|.|++.++|.++.+..+ .+.++...|+|..++||+..||||
T Consensus 81 c~V~~~~ey~~~~~~~~----------------~~~~~~d~~~Ce~~yn~~~~~~~c 121 (121)
T cd04714 81 CYVLTFAEYERLARVKK----------------KPQDGVDFYYCAGTYNPDTGMLKC 121 (121)
T ss_pred cEEEehhHheecccccC----------------CCCcCCCEEEEeccCCCCcCcccC
Confidence 99999999998764322 556778899999999999999998
|
BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. |
| >cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation | Back alignment and domain information |
|---|
| >smart00439 BAH Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins | Back alignment and domain information |
|---|
| >cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins | Back alignment and domain information |
|---|
| >cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains | Back alignment and domain information |
|---|
| >cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p | Back alignment and domain information |
|---|
| >cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p | Back alignment and domain information |
|---|
| >KOG1886 consensus BAH domain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09926 DUF2158: Uncharacterized small protein (DUF2158); InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF | Back alignment and domain information |
|---|
| >cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis | Back alignment and domain information |
|---|
| >PF10383 Clr2: Transcription-silencing protein Clr2 ; InterPro: IPR018839 Clr2 (cryptic loci regulator) is a chromatin silencing protein, one of a quartet of proteins forming the core of SHREC, a multienzyme effector complex that mediates hetero-chromatic transcriptional gene silencing in fission yeast [] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5475 Uncharacterized small protein [Function unknown] | Back alignment and domain information |
|---|
| >cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) | Back alignment and domain information |
|---|
| >PRK10708 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11302 DUF3104: Protein of unknown function (DUF3104); InterPro: IPR021453 This family of proteins with unknown function appears to be restricted to Cyanobacteria | Back alignment and domain information |
|---|
| >PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >smart00293 PWWP domain with conserved PWWP motif | Back alignment and domain information |
|---|
| >PF08940 DUF1918: Domain of unknown function (DUF1918); InterPro: IPR015035 This domain is found in various hypothetical bacterial proteins, and has no known function | Back alignment and domain information |
|---|
| >cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 162 | ||||
| 1w4s_A | 174 | Crystal Structure Of The Proximal Bah Domain Of Pol | 4e-08 |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 162 | |||
| 1w4s_A | 174 | Polybromo, polybromo 1 protein; BAH, bromo-associa | 2e-45 | |
| 4dov_A | 163 | ORC1, origin recognition complex subunit 1; DNA re | 1e-21 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 8e-16 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 6e-11 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 1e-15 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 5e-12 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 1e-09 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 7e-08 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 1e-07 | |
| 2fl7_A | 232 | Regulatory protein SIR3; ORC, silencing, chromatin | 2e-07 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 4e-07 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 4e-05 | |
| 1m4z_A | 238 | Origin recognition complex subunit 1; DNA replicat | 1e-04 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 6e-04 |
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
| >2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Length = 232 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Length = 238 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| 1w4s_A | 174 | Polybromo, polybromo 1 protein; BAH, bromo-associa | 100.0 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.96 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.94 | |
| 4dov_A | 163 | ORC1, origin recognition complex subunit 1; DNA re | 99.93 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.87 | |
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 99.87 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.84 | |
| 2fl7_A | 232 | Regulatory protein SIR3; ORC, silencing, chromatin | 99.72 | |
| 1m4z_A | 238 | Origin recognition complex subunit 1; DNA replicat | 99.72 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 97.73 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 97.2 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 96.81 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.54 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 96.51 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.47 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 96.4 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 96.19 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 95.96 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 95.46 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 94.56 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 91.83 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 89.4 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 88.86 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 88.71 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 88.48 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 87.77 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 87.61 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 86.95 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 86.13 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 84.22 |
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* | Back alignment and structure |
|---|
| >1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 162 | ||||
| d1m4za_ | 217 | b.34.12.1 (A:) Origin-recognition complex protein | 1e-24 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 1e-07 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 3e-04 |
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: BAH domain family: BAH domain domain: Origin-recognition complex protein 120kDa subunit, Orc1p species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 93.1 bits (231), Expect = 1e-24
Identities = 18/157 (11%), Positives = 31/157 (19%), Gaps = 26/157 (16%)
Query: 22 TIKPGDCVLMRPSEPSKPSYVAKIERI----------------------ESDARGANVKV 59
+ GD V+M V I+ + A
Sbjct: 52 KLGRGDSVVMHNEAAGTY-SVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNP 110
Query: 60 HVRWYYRPEESIGGRRQFH-GSKEVFLSDHHDIQSADTIEGKCTVHSFKSY--TKLDAVG 116
RP E++L+ V + K +
Sbjct: 111 DANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDP 170
Query: 117 NDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDL 153
DF R+ + F + P +
Sbjct: 171 ERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREA 207
|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| d1m4za_ | 217 | Origin-recognition complex protein 120kDa subunit, | 99.89 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 97.43 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 95.88 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 94.46 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 93.71 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 84.07 | |
| d1nppa2 | 58 | N-utilization substance G protein NusG, C-terminal | 83.97 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 83.12 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 81.0 |
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: BAH domain family: BAH domain domain: Origin-recognition complex protein 120kDa subunit, Orc1p species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.89 E-value=4.6e-24 Score=160.77 Aligned_cols=139 Identities=14% Similarity=0.090 Sum_probs=113.4
Q ss_pred EEEEcCCCcEEccCCEEEEecCCCCCCCeEEEEeEEEecCCCCeEEEEEEEeecccccC---------------------
Q 031269 13 SYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESI--------------------- 71 (162)
Q Consensus 13 ~~~~~g~~~~~~vGD~V~v~~~~~~~~~~Ig~I~~i~~~~~g~~~~v~v~Wfyrp~e~~--------------------- 71 (162)
++.....+..+++||+|+|.+++. +++|||+|.+|..+..++....-+.||+|..|..
T Consensus 43 ~~~r~~D~~e~~~GD~Vlvk~~~~-~~~~v~iI~ei~~~~~~~~~e~~~~~~lr~~e~~~~~~~~~~~~~~~w~~~p~e~ 121 (217)
T d1m4za_ 43 YLKRSSDGIKLGRGDSVVMHNEAA-GTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNY 121 (217)
T ss_dssp EEEETTTCCEECTTCEEEEEETTT-TEEEEEEEEEEEEETTTTEEEEEEEEEECGGGSCHHHHHHHHCHHHHHSCCCHHH
T ss_pred EEEEecCCeEEecCCEEEEeCCCC-CCceEEEEeeeccCcccchheeeeecccchhhhccchhhhhcccceeeecCchhh
Confidence 333444456999999999998874 7899999999999877765667777777766643
Q ss_pred -Cc-ccccCCCCeeEEecceecCccCcEEeeeEEEecccccccCC--CCCCeEEEeeeeccCcceeccCCCceeeecCCC
Q 031269 72 -GG-RRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDA--VGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMP 147 (162)
Q Consensus 72 -~~-~~~~~~~~Elf~s~~~d~~~~~~I~gkc~V~~~~~~~~~~~--~~~~~f~cr~~yd~~~~~f~p~~~~~~C~c~~~ 147 (162)
.+ .+..+.+||||+|++.+.+|+++|+|||+|++.++|..... ...++||||++||+..+.|++..++..|.+.+.
T Consensus 122 ~~~k~r~~~~~~ElflT~~~d~i~~~~I~~k~~V~s~~ef~~~~~~~~~~~~F~cr~~~D~~~~~f~~id~~~~~~~~~~ 201 (217)
T d1m4za_ 122 YNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKK 201 (217)
T ss_dssp HHHHHHHHSCTTEEEEEEEEEEECGGGEEEEEEEECHHHHHHHGGGCCTTTEEEEEEECCTTSCCCEECCHHHHHHHHTT
T ss_pred hhhccccccCcceeEecCccceeehhheeeeEEEecHHHhcchhhccCCCCeEEEEEEEcCCCCceeeccHHHhhhhccc
Confidence 11 11236789999999999999999999999999999975433 468999999999999999999888999999988
Q ss_pred CCCCc
Q 031269 148 YNPDD 152 (162)
Q Consensus 148 ~npd~ 152 (162)
.||+.
T Consensus 202 ~np~~ 206 (217)
T d1m4za_ 202 VEPRE 206 (217)
T ss_dssp SCHHH
T ss_pred cChHH
Confidence 88865
|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|