Citrus Sinensis ID: 031351


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MEGTTNNVETSMAEQNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESSKATFKFEPRSVEVVGDCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRPPRWEIRVRHERNTLWQSQPRDLARRSLPSLLLTI
ccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccEEEEcccccHHHHHHHcccccccEEEEEEcEEEEEccEEEEEEcccccEEEEEEEEEEEcccEEEEEEEEEEEEEEEEEccccccccccccccccEEEcccccccccccccEEEEc
ccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHEHHcccccHHHHHHHHccccccccEEEEccEEEEEccEEEEEccccccEEEEEEEEEcccccEEEEEEEEEccEEEEEEccccccccccccccccEEEcccccccccccccEEEEc
MEGTTNNVETSMAEQNQEAIVKALYKALANDEMENVAKYLASDLeywfhgpptcQHMVRLLtgesskatfkfeprsvevvgdcviaegwegapaYWVHVWTVNVKDGLITQFREYFNTWltvkdlrpprweirvRHERntlwqsqprdlarrslpslllti
megttnnvetsmaeqNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESSKATFKFEPRSVEVVGDCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREYFNtwltvkdlrpprweirvrherntlwqsqprdlarrslpslllti
MEGTTNNVETSMAEQNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESSKATFKFEPRSVEVVGDCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRPPRWEIRVRHERNTLWQSQPRDLARRSLPSLLLTI
******************AIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESSKATFKFEPRSVEVVGDCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRPPRWEIRVRHERNTLW*******************
*******************IVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESSKATFKFEPRSVEVVGDCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREYFNTWLTVK**********************P***ARRSLPSLLLTI
************AEQNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESSKATFKFEPRSVEVVGDCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRPPRWEIRVRHERNTLWQSQPRDLARRSLPSLLLTI
**************QNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESSKATFKFEPRSVEVVGDCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRPPR*******ERNT*W****RDLARRSLPSLLLTI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGTTNNVETSMAEQNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESSKATFKFEPRSVEVVGDCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRPPRWEIRVRHERNTLWQSQPRDLARRSLPSLLLTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
P20144105 Wound-induced protein 1 O N/A no 0.633 0.971 0.345 2e-09
>sp|P20144|WUN1_SOLTU Wound-induced protein 1 OS=Solanum tuberosum GN=WUN1 PE=2 SV=1 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 59/107 (55%), Gaps = 5/107 (4%)

Query: 58  VRLLTGES--SKATFKFEPRSVEVVGDCVIAEGWEGAPAY-WVHVWTVNVKDGLITQFRE 114
           +++LTG +    A+F+F  ++++V G  V+ EG +   +  WVH WTV   DG+ITQ RE
Sbjct: 1   MQILTGTAKFDNASFQFLHKTIDVFGSVVLVEGCDPTRSITWVHAWTVT--DGVITQVRE 58

Query: 115 YFNTWLTVKDLRPPRWEIRVRHERNTLWQSQPRDLARRSLPSLLLTI 161
           YFNT LTV                 ++W+S   +   +S+P L+L +
Sbjct: 59  YFNTSLTVTRFGKSDISSITTLHCPSVWESSLPNRVGKSVPGLVLAL 105





Solanum tuberosum (taxid: 4113)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
224139286143 predicted protein [Populus trichocarpa] 0.881 0.993 0.712 3e-55
224139284152 predicted protein [Populus trichocarpa] 0.900 0.953 0.651 9e-54
359481188159 PREDICTED: wound-induced protein 1-like 0.944 0.955 0.675 1e-53
357506437151 Wound-induced protein [Medicago truncatu 0.913 0.973 0.673 2e-50
357506445151 Wound-induced protein [Medicago truncatu 0.913 0.973 0.673 2e-50
357506457151 Wound-induced protein [Medicago truncatu 0.913 0.973 0.673 3e-50
357506433151 Wound-induced protein [Medicago truncatu 0.913 0.973 0.666 4e-50
255586276154 Wound-induced protein, putative [Ricinus 0.919 0.961 0.638 4e-49
357506441149 Wound-induced protein [Medicago truncatu 0.906 0.979 0.657 1e-48
449464426168 PREDICTED: wound-induced protein 1-like 0.950 0.910 0.592 1e-48
>gi|224139286|ref|XP_002323037.1| predicted protein [Populus trichocarpa] gi|222867667|gb|EEF04798.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 116/146 (79%), Gaps = 4/146 (2%)

Query: 16  NQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESSKATFKFEPR 75
             + IV ALYK L+N     VAK +ASDLE+WFHGPP CQHM+R+LTGESS   FKFEPR
Sbjct: 2   QNKGIVDALYKGLSNGHTGTVAKLIASDLEWWFHGPPRCQHMMRILTGESSHTKFKFEPR 61

Query: 76  SVEVVGDCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRPPRWEIRVR 135
           S+EVVGDCVIAEGWEGA  YWVHVWT  +KDG+ITQFREYFNTWLTVKD+ P  WEI  R
Sbjct: 62  SIEVVGDCVIAEGWEGAQVYWVHVWT--LKDGVITQFREYFNTWLTVKDISPHGWEI--R 117

Query: 136 HERNTLWQSQPRDLARRSLPSLLLTI 161
           HE +TLWQS PRDL  RSLP L+L I
Sbjct: 118 HENHTLWQSHPRDLFSRSLPGLILGI 143




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224139284|ref|XP_002323036.1| predicted protein [Populus trichocarpa] gi|222867666|gb|EEF04797.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359481188|ref|XP_003632589.1| PREDICTED: wound-induced protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357506437|ref|XP_003623507.1| Wound-induced protein [Medicago truncatula] gi|355498522|gb|AES79725.1| Wound-induced protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357506445|ref|XP_003623511.1| Wound-induced protein [Medicago truncatula] gi|355498526|gb|AES79729.1| Wound-induced protein [Medicago truncatula] gi|388495486|gb|AFK35809.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357506457|ref|XP_003623517.1| Wound-induced protein [Medicago truncatula] gi|355498532|gb|AES79735.1| Wound-induced protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357506433|ref|XP_003623505.1| Wound-induced protein [Medicago truncatula] gi|355498520|gb|AES79723.1| Wound-induced protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255586276|ref|XP_002533790.1| Wound-induced protein, putative [Ricinus communis] gi|223526279|gb|EEF28592.1| Wound-induced protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357506441|ref|XP_003623509.1| Wound-induced protein [Medicago truncatula] gi|355498524|gb|AES79727.1| Wound-induced protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449464426|ref|XP_004149930.1| PREDICTED: wound-induced protein 1-like [Cucumis sativus] gi|449528301|ref|XP_004171143.1| PREDICTED: wound-induced protein 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
TAIR|locus:2181072162 AT5G01740 "AT5G01740" [Arabido 0.962 0.956 0.535 4.6e-41
TAIR|locus:1006230220110 SAG20 "AT3G10985" [Arabidopsis 0.633 0.927 0.401 1e-11
TAIR|locus:2181072 AT5G01740 "AT5G01740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 436 (158.5 bits), Expect = 4.6e-41, P = 4.6e-41
 Identities = 90/168 (53%), Positives = 113/168 (67%)

Query:     1 MEGTTNNVETSMA-EQNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVR 59
             ME     + T +  E   +  ++ LYKAL   +   V K +ASD+E+WFHGP  CQHM+R
Sbjct:     1 MEAHNVEISTRLTPEMKNQGTIELLYKALQQGDTSTVTKVVASDVEWWFHGPHDCQHMMR 60

Query:    60 LLTGESSK-ATFKFEPRSVEVV--G-DCVIAEGWEGAPAYWVHVWTVNVKDGLITQFREY 115
             LLTGE  +  +F+FEP SV+VV  G DCVIAEGWEG+  YWVHVW   +KDG++T+ REY
Sbjct:    61 LLTGEPPRQVSFRFEPSSVQVVVPGHDCVIAEGWEGSRVYWVHVW--KLKDGVVTELREY 118

Query:   116 FNTWLTVKD--LRPPRWEIRVRHERNTLWQSQPRDLARRSLPSLLLTI 161
             FNTWLTV D  L    W++     R T+W+S PRDLAR SLPSLLL I
Sbjct:   119 FNTWLTVTDYSLGAVGWDMG----RCTVWESVPRDLARGSLPSLLLAI 162




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:1006230220 SAG20 "AT3G10985" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XVI001208
hypothetical protein (143 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
pfam07107109 pfam07107, WI12, Wound-induced protein WI12 7e-37
COG3631133 COG3631, COG3631, Ketosteroid isomerase-related pr 3e-07
pfam12680101 pfam12680, SnoaL_2, SnoaL-like domain 1e-04
>gnl|CDD|191688 pfam07107, WI12, Wound-induced protein WI12 Back     alignment and domain information
 Score =  122 bits (307), Expect = 7e-37
 Identities = 51/110 (46%), Positives = 62/110 (56%), Gaps = 9/110 (8%)

Query: 59  RLLTGES-SKATFKFEPRSVEVVGDCVIAEG-WEGAPAYWVHVWTVNVKDGLITQFREYF 116
           RLLTG S S ++F+FEP SV+  G  VIAEG       YWVH WTV   DG+ITQ REYF
Sbjct: 2   RLLTGASPSSSSFRFEPLSVDAFGSTVIAEGCDATRSIYWVHAWTV--GDGVITQVREYF 59

Query: 117 NTWLTVKDLRPP-----RWEIRVRHERNTLWQSQPRDLARRSLPSLLLTI 161
           NT LTV  L                   ++W+S+  D A +SLP L+L I
Sbjct: 60  NTSLTVTRLGLGAAGWDATASAPCSHCCSVWESRLPDRAGKSLPGLVLAI 109


This family consists of several plant wound-induced protein sequences related to WI12 from Mesembryanthemum crystallinum. Wounding, methyl jasmonate, and pathogen infection is known to induce local WI12 expression. WI12 expression is also thought to be developmentally controlled in the placenta and developing seeds. WI12 preferentially accumulates in the cell wall and it has been suggested that it plays a role in the reinforcement of cell wall composition after wounding and during plant development. This family seems partly related to the NTF2-like superfamily. Length = 109

>gnl|CDD|226158 COG3631, COG3631, Ketosteroid isomerase-related protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|221707 pfam12680, SnoaL_2, SnoaL-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
PF07107109 WI12: Wound-induced protein WI12; InterPro: IPR009 99.75
COG3631133 Ketosteroid isomerase-related protein [General fun 99.73
PF07858125 LEH: Limonene-1,2-epoxide hydrolase catalytic doma 99.72
TIGR02096129 conserved hypothetical protein, steroid delta-isom 99.67
PRK08241339 RNA polymerase factor sigma-70; Validated 99.58
TIGR02960324 SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa 99.51
PF07366126 SnoaL: SnoaL-like polyketide cyclase; InterPro: IP 99.51
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 99.47
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 99.44
COG4308130 LimA Limonene-1,2-epoxide hydrolase [Secondary met 99.37
PRK09636293 RNA polymerase sigma factor SigJ; Provisional 99.19
TIGR02957281 SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa 98.92
COG4922129 Uncharacterized protein conserved in bacteria [Fun 98.76
COG5485131 Predicted ester cyclase [General function predicti 98.75
PRK09635290 sigI RNA polymerase sigma factor SigI; Provisional 98.66
COG4538112 Uncharacterized conserved protein [Function unknow 98.44
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 98.19
PF03284162 PHZA_PHZB: Phenazine biosynthesis protein A/B; Int 98.0
TIGR02246128 conserved hypothetical protein. This family consis 97.98
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 97.72
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 97.4
COG4319137 Ketosteroid isomerase homolog [Function unknown] 97.27
PF12893116 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL 97.17
PF07080143 DUF1348: Protein of unknown function (DUF1348); In 96.27
PF13577127 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF 95.19
PF08332128 CaMKII_AD: Calcium/calmodulin dependent protein ki 94.37
PF12870111 Lumazine_bd: Lumazine-binding domain; InterPro: IP 93.85
cd00667160 ring_hydroxylating_dioxygenases_beta Ring hydroxyl 90.15
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 89.45
PF10184113 DUF2358: Uncharacterized conserved protein (DUF235 88.02
PF11533125 DUF3225: Protein of unknown function (DUF3225); In 85.91
TIGR03231155 anthran_1_2_B anthranilate 1,2-dioxygenase, small 84.3
PRK10069183 3-phenylpropionate dioxygenase subunit beta; Provi 83.65
PF05223118 MecA_N: NTF2-like N-terminal transpeptidase domain 82.71
TIGR03232155 benzo_1_2_benB benzoate 1,2-dioxygenase, small sub 80.91
>PF07107 WI12: Wound-induced protein WI12; InterPro: IPR009798 This entry consists of several plant wound-induced protein sequences related to WI12 from Mesembryanthemum crystallinum (Common ice plant) (Q9XES3 from SWISSPROT) Back     alignment and domain information
Probab=99.75  E-value=2e-18  Score=122.23  Aligned_cols=92  Identities=51%  Similarity=0.844  Sum_probs=80.9

Q ss_pred             ceeEEEeeEEEEeCCEEEEEeec-CCCceEEEEEEEEecCCeEEEEEEeeChHHHHHHcCCCc--cc---ccccCcccee
Q 031351           68 ATFKFEPRSVEVVGDCVIAEGWE-GAPAYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRPPR--WE---IRVRHERNTL  141 (161)
Q Consensus        68 ~~~~~~~~~vi~~Gd~Vvv~G~~-~~~~~~v~vf~v~~~DGkI~~~~ey~D~~~l~~alg~~~--~~---~~~~~~~~~~  141 (161)
                      ..|+|.|.++.+-|+.|++||.. ..+.||||+|++  .||+|+++||||||.....-+++..  ++   .-.++....|
T Consensus        12 ~sF~F~P~sV~afG~~ViaEG~~~~~~~yWVHaWTV--~dGiITqlREYFNT~ltVt~l~~~~~~~~~~~~~~~~~~~~v   89 (109)
T PF07107_consen   12 SSFRFVPRSVDAFGSTVIAEGCDETRSVYWVHAWTV--KDGIITQLREYFNTSLTVTRLGPGASGSSSSDSAPSSHCPCV   89 (109)
T ss_pred             CcEEEeccEEEEECCEEEEecccCcCcEEEEEEEEe--cCCEEEeeeeeeeeEEEEEeccccCCcccccccccCCCCCce
Confidence            57999999999999999999944 456999999999  9999999999999998888888543  43   2445777899


Q ss_pred             eeeccccccCCCCCceeeeC
Q 031351          142 WQSQPRDLARRSLPSLLLTI  161 (161)
Q Consensus       142 ~~~~~~~~~~~~~~~~~~~~  161 (161)
                      |||+..+.+++|+|||.|+|
T Consensus        90 WqS~~~d~~~~SlPGLVLAI  109 (109)
T PF07107_consen   90 WQSRLPDRAGKSLPGLVLAI  109 (109)
T ss_pred             ecccccccccCCcCCEEEeC
Confidence            99999999999999999987



Wounding, methyl jasmonate, and pathogen infection is known to induce local WI12 expression. WI12 expression is also thought to be developmentally controlled in the placenta and developing seeds. WI12 preferentially accumulates in the cell wall and it has been suggested that it plays a role in the reinforcement of cell wall composition after wounding and during plant development [].

>COG3631 Ketosteroid isomerase-related protein [General function prediction only] Back     alignment and domain information
>PF07858 LEH: Limonene-1,2-epoxide hydrolase catalytic domain; InterPro: IPR013100 Epoxide hydrolases catalyse the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism Back     alignment and domain information
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family Back     alignment and domain information
>PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>COG4308 LimA Limonene-1,2-epoxide hydrolase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09636 RNA polymerase sigma factor SigJ; Provisional Back     alignment and domain information
>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family Back     alignment and domain information
>COG4922 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5485 Predicted ester cyclase [General function prediction only] Back     alignment and domain information
>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional Back     alignment and domain information
>COG4538 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>PF03284 PHZA_PHZB: Phenazine biosynthesis protein A/B; InterPro: IPR004964 The phenazine biosynthesis proteins A and B are involved in the biosynthesis of this antibiotic Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>COG4319 Ketosteroid isomerase homolog [Function unknown] Back     alignment and domain information
>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C Back     alignment and domain information
>PF07080 DUF1348: Protein of unknown function (DUF1348); InterPro: IPR009783 This family consists of several highly conserved hypothetical proteins of around 150 residues in length Back     alignment and domain information
>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B Back     alignment and domain information
>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF12870 Lumazine_bd: Lumazine-binding domain; InterPro: IPR024267 This entry represents a lumazine-binding domain found in a family of putative lipoproteins from bacteria Back     alignment and domain information
>cd00667 ring_hydroxylating_dioxygenases_beta Ring hydroxylating dioxygenase beta subunit Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>PF10184 DUF2358: Uncharacterized conserved protein (DUF2358); InterPro: IPR018790 This entry represents a family of conserved proteins Back     alignment and domain information
>PF11533 DUF3225: Protein of unknown function (DUF3225); InterPro: IPR024507 This family of proteins has no known function Back     alignment and domain information
>TIGR03231 anthran_1_2_B anthranilate 1,2-dioxygenase, small subunit Back     alignment and domain information
>PRK10069 3-phenylpropionate dioxygenase subunit beta; Provisional Back     alignment and domain information
>PF05223 MecA_N: NTF2-like N-terminal transpeptidase domain; InterPro: IPR007887 The multiple antibiotic resistance of methicillin-resistant strains of Staphylococcus aureus (MRSA) has become a major clinical problem worldwide Back     alignment and domain information
>TIGR03232 benzo_1_2_benB benzoate 1,2-dioxygenase, small subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 2e-20
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 6e-20
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 1e-19
3grd_A134 Uncharacterized NTF2-superfamily protein; NP_97724 1e-16
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 4e-12
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 5e-12
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 3e-11
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 5e-11
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 8e-10
3g8z_A148 Protein of unknown function with cystatin-like FO; 2e-08
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 3e-08
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 9e-05
3f9s_A146 Putative polyketide cyclase; structural genomics, 1e-04
3k0z_A159 Putative polyketide cyclase; structural genomics, 9e-04
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} Length = 135 Back     alignment and structure
 Score = 80.6 bits (199), Expect = 2e-20
 Identities = 24/136 (17%), Positives = 43/136 (31%), Gaps = 23/136 (16%)

Query: 12  MAEQNQEAIVKALYKALANDEMENVAKYLASDLEYWF----------HGPPTCQHMVRLL 61
           M+ Q    IVK  + A+   + + +    A D+E+             G      +++  
Sbjct: 2   MSTQENVQIVKDFFAAMGRGDKKGLLAVSAEDIEWIIPGEWPLAGTHRGHAALAALLQKA 61

Query: 62  TGESSKATFKFEPRSVEVVGDCVIAEGWEGAPA---------YWVHVWTVNVKDGLITQF 112
           +          EP      G+ V+  G+               WV   T  V+   +T  
Sbjct: 62  SEMVE--ISYPEPPEFVAQGERVLVVGFATGRVKSTNRTFEDDWVFAIT--VRKSKVTSI 117

Query: 113 REYFNTWLTVKDLRPP 128
           REY +T    +     
Sbjct: 118 REYIDTLALARATNFN 133


>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Length = 132 Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Length = 140 Back     alignment and structure
>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} Length = 134 Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Length = 149 Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Length = 156 Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Length = 143 Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Length = 149 Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Length = 150 Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Length = 148 Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Length = 163 Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Length = 140 Back     alignment and structure
>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Length = 146 Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Length = 159 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 99.85
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 99.85
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 99.85
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 99.84
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 99.82
3grd_A134 Uncharacterized NTF2-superfamily protein; NP_97724 99.81
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 99.81
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 99.79
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 99.79
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 99.77
3k0z_A159 Putative polyketide cyclase; structural genomics, 99.77
3kkg_A146 Putative snoal-like polyketide cyclase; structural 99.77
3g8z_A148 Protein of unknown function with cystatin-like FO; 99.76
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 99.76
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 99.76
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 99.76
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 99.75
3dmc_A134 NTF2-like protein; structural genomics, joint cent 99.75
2f99_A153 Aklanonic acid methyl ester cyclase, AKNH; anthrac 99.75
3f9s_A146 Putative polyketide cyclase; structural genomics, 99.75
1sjw_A144 Nogalonic acid methyl ester cyclase; anthracycline 99.74
2k54_A123 Protein ATU0742; protein of unknown function, stru 99.74
3f40_A114 Uncharacterized NTF2-like protein; YP_677363.1, NT 99.74
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 99.73
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 99.73
3ehc_A128 Snoal-like polyketide cyclase; structural genomics 99.73
3g16_A156 Uncharacterized protein with cystatin-like fold; Y 99.72
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 99.72
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 99.68
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 99.68
3h3h_A122 Uncharacterized snoal-like protein; structural gen 99.68
3f8h_A150 Putative polyketide cyclase; structural genomics, 99.67
3f7x_A151 Putative polyketide cyclase; structural genomics, 99.67
3g0k_A148 Putative membrane protein; snoal-like polyketide c 99.65
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 99.65
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 99.65
3ff0_A163 Phenazine biosynthesis protein PHZB 2; cystatin-li 99.6
2a15_A139 Hypothetical protein RV0760C; beta-alpha-barrel, s 99.59
3mso_A143 Steroid delta-isomerase; structural genomics, join 99.48
3hk4_A136 MLR7391 protein; NTF2-like protein, structural gen 99.4
3flj_A155 Uncharacterized protein conserved in bacteria WIT 99.38
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 99.37
3rga_A 283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 99.33
3rga_A283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 99.33
3lyg_A120 NTF2-like protein of unknown function; structural 99.33
3f8x_A148 Putative delta-5-3-ketosteroid isomerase; structur 99.29
3dxo_A121 Uncharacterized snoal-like protein; putative isome 99.27
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 98.9
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 98.87
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 98.5
3cu3_A172 Domain of unknown function with A cystatin-like F; 98.34
3rob_A139 Uncharacterized conserved protein; structural geno 98.33
3h51_A156 Putative calcium/calmodulin dependent protein KIN 98.23
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 98.19
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 98.18
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 98.14
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 98.09
3gzb_A154 Putative snoal-like polyketide cyclase; YP_0011826 98.05
3ecf_A130 NTF2-like protein; structural genomics, joint cent 98.03
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 97.91
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 97.84
3bb9_A148 Putative orphan protein; structural genomics, join 97.79
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 97.65
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 97.63
3blz_A128 NTF2-like protein of unknown function; structural 97.6
3a76_A176 Gamma-hexachlorocyclohexane dehydrochlorinase; bar 97.53
2rgq_A144 Domain of unknown function with A cystatin-like F; 97.53
3duk_A125 NTF2-like protein of unknown function; structural 97.49
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 97.48
2r4i_A123 Uncharacterized protein; NTF2-like protein, struct 97.43
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 97.39
3fsd_A134 NTF2-like protein of unknown function in nutrient; 97.34
1tp6_A128 Hypothetical protein PA1314; structural genomics, 97.34
3ke7_A134 Putative ketosteroid isomerase; structural genomic 97.22
3ksp_A129 Calcium/calmodulin-dependent kinase II associatio; 97.04
2f86_B143 Hypothetical protein K11E8.1D; UNC-43, oligomeriza 96.91
3fka_A120 Uncharacterized NTF-2 like protein; structural gen 96.91
2rfr_A155 Uncharacterized protein; structural genomics, join 96.87
3ejv_A179 Uncharacterized protein with cystatin-like fold; s 96.71
2imj_A166 Hypothetical protein DUF1348; alpha beta protein, 96.55
2rcd_A129 Uncharacterized protein; structural genomics, join 96.3
2owp_A129 Hypothetical protein BXE_B1374; cystatin-like fold 96.12
3ef8_A150 Putative scyalone dehydratase; YP_496742.1, struct 95.81
3soy_A145 NTF2-like superfamily protein; structural genomics 95.26
4gb5_A159 Uncharacterized protein; structural genomics, PSI- 95.18
3e99_A164 Benzoate 1,2-dioxygenase beta subunit; structural 93.16
2b1x_B172 Naphthalene dioxygenase small subunit; rieske non- 92.17
2gbw_B174 Biphenyl 2,3-dioxygenase beta subunit; rieske oxyg 91.0
3eby_A163 Beta subunit of A putative aromatic-ring-hydroxyl 90.39
1wql_B186 Ethylbenzene dioxygenase small subunit; biphenyl d 90.14
1uli_B187 Biphenyl dioxygenase small subunit; alpha3 BETA3 h 89.93
3gzx_B186 Biphenyl dioxygenase subunit beta; rieskie, non-he 87.98
1idp_A172 Scytalone dehydratase; lyase, melanine biosynthesi 86.8
2bmo_B194 Oxygenase-beta NBDO; nitrobenzene dioxygenase, nit 86.52
4hyz_A114 Uncharacterized protein; PF13026 family protein, D 85.75
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
Probab=99.85  E-value=4.4e-21  Score=140.48  Aligned_cols=116  Identities=16%  Similarity=0.195  Sum_probs=95.4

Q ss_pred             CccccHHHHHHHHHHHHhCCCHHHHHhhccCCeEEEecCCc----------cHHHHHHHHhccccc-ceeEEEeeEEEEe
Q 031351           12 MAEQNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPP----------TCQHMVRLLTGESSK-ATFKFEPRSVEVV   80 (161)
Q Consensus        12 Ms~~~~~~lV~~f~~A~~~gD~e~l~~lla~Dvv~~~~Gp~----------~~~~v~~~l~~~~~~-~~~~~~~~~vi~~   80 (161)
                      |+++++.+++++||+|+++||.+++.++|+||++|+.+|+.          +.+++.+++...... ...++++..++++
T Consensus         1 m~~~~~~~~v~~~~~a~~~gD~~~l~~l~a~Dv~~~~~g~~~~~p~~g~~~G~~av~~~~~~~~~~~~~~~~~~~~~~~~   80 (143)
T 3dm8_A            1 MTEHSLWRFSRALHRALNDRQTEELATIIDDNIDWAIYGPIDMFPFFGARQGKAAVLEVCRQIADSVRIYRYHRESVMLG   80 (143)
T ss_dssp             CCSCHHHHHHHHHHHHHHHCCCHHHHHHEEEEEEEEEESCTTTCTTCEEEESHHHHHHHHHHHHHHEEEEEEEEEEEEEC
T ss_pred             CCcchHHHHHHHHHHHHHCCCHHHHHHhcCCCeEEEecCCCCcCCCCccccCHHHHHHHHHHHHHhcCcceEEEEEEEEc
Confidence            78889999999999999999999999999999999998742          257777777665443 4668999999999


Q ss_pred             CCEEEEEeecC------CC---ceEEEEEEEEecCCeEEEEEEeeChHHHHHHcCCCc
Q 031351           81 GDCVIAEGWEG------AP---AYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRPPR  129 (161)
Q Consensus        81 Gd~Vvv~G~~~------~~---~~~v~vf~v~~~DGkI~~~~ey~D~~~l~~alg~~~  129 (161)
                      ||.|++.++..      ++   ..+|++|+|  +||||+++++|+|+..+++|+.+.+
T Consensus        81 gd~v~v~~~~~~~~~~tG~~~~~~~~~~~~v--~dGkI~~~r~y~D~~~l~~q~~g~~  136 (143)
T 3dm8_A           81 IDSAASMVRYSLTAAGTNRPISVRMALFTQF--QNGRLTNLRMVLDTFDLVEQALGRP  136 (143)
T ss_dssp             SSEEEEEEEEEEEETTTCCEEEEEEEEEEEE--ETTEEEEEEEEECHHHHHHHHHTC-
T ss_pred             CCeEEEEEEEEEEEeCCCCEEEEEEEEEEEE--ECCEEEEEEEEEcHHHHHHHHhCCC
Confidence            99998764331      22   567999999  9999999999999998888765444



>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Back     alignment and structure
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0 Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 Back     alignment and structure
>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* Back     alignment and structure
>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Back     alignment and structure
>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 Back     alignment and structure
>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Back     alignment and structure
>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Back     alignment and structure
>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Back     alignment and structure
>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans} Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Back     alignment and structure
>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Back     alignment and structure
>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} Back     alignment and structure
>3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea} Back     alignment and structure
>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* Back     alignment and structure
>3ecf_A NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Anabaena variabilis atcc 29413} SCOP: d.17.4.21 Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 Back     alignment and structure
>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} Back     alignment and structure
>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 Back     alignment and structure
>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure
>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 Back     alignment and structure
>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Back     alignment and structure
>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3ksp_A Calcium/calmodulin-dependent kinase II associatio; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG; HET: MSE NHE; 2.59A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7 Back     alignment and structure
>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28 Back     alignment and structure
>2imj_A Hypothetical protein DUF1348; alpha beta protein, structural genomics, PSI-2, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} SCOP: d.17.4.23 Back     alignment and structure
>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Back     alignment and structure
>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 Back     alignment and structure
>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 Back     alignment and structure
>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>4gb5_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, snoal-like domain, unknown function; HET: PGE; 1.55A {Kribbella flavida} Back     alignment and structure
>3e99_A Benzoate 1,2-dioxygenase beta subunit; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Burkholderia mallei atcc 23344} SCOP: d.17.4.4 Back     alignment and structure
>2b1x_B Naphthalene dioxygenase small subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 2b24_B Back     alignment and structure
>2gbw_B Biphenyl 2,3-dioxygenase beta subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_B* 2ckf_B Back     alignment and structure
>3eby_A Beta subunit of A putative aromatic-ring-hydroxyl dioxygenase; YP_001165631.1; 1.75A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.4 Back     alignment and structure
>1wql_B Ethylbenzene dioxygenase small subunit; biphenyl dioxygenase, cumene dioxygenase; 2.20A {Pseudomonas fluorescens} SCOP: d.17.4.4 Back     alignment and structure
>1uli_B Biphenyl dioxygenase small subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 1ulj_B* 3en1_B* 3eqq_B Back     alignment and structure
>3gzx_B Biphenyl dioxygenase subunit beta; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} SCOP: d.17.4.4 PDB: 3gzy_B* 2yfi_B 2xr8_B* 2xrx_B* 2xsh_B 2xso_B 2yfj_B* 2yfl_B* Back     alignment and structure
>1idp_A Scytalone dehydratase; lyase, melanine biosynthesis; 1.45A {Magnaporthe grisea} SCOP: d.17.4.1 PDB: 2std_A* 1std_A* 3std_A* 6std_A* 4std_A* 5std_A* 7std_A* Back     alignment and structure
>2bmo_B Oxygenase-beta NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: d.17.4.4 PDB: 2bmq_B 2bmr_B* 1o7n_B 1ndo_B 1o7g_B* 1o7h_B 1o7m_B 1eg9_B 1o7p_B* 1o7w_B 1uuv_B 1uuw_B 2hmj_B 2hmk_B* 2hml_B* 2hmm_B* 2hmn_B* 2hmo_B* Back     alignment and structure
>4hyz_A Uncharacterized protein; PF13026 family protein, DUF3887, structural genomics, joint for structural genomics, JCSG; 2.25A {Ruminococcus gnavus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d3dmca1133 d.17.4.10 (A:1-133) Uncharacterized protein Ava226 4e-10
d1tuha_131 d.17.4.11 (A:) Hypothetical protein egc068 from a 2e-09
d3dm8a1135 d.17.4.20 (A:1-135) Uncharacterized protein Rpa434 3e-09
d3ec9a1130 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0 3e-09
d1nwwa_145 d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhod 3e-08
d3en8a1127 d.17.4.20 (A:1-127) Uncharacterized protein BxeB20 7e-08
d3ebta1131 d.17.4.9 (A:1-131) Uncharacterized protein BPSS013 1e-06
d2bnga1132 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 5e-06
d1z1sa1129 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 2e-05
d1s5aa_139 d.17.4.10 (A:) Hypothetical protein YesE {Bacillus 2e-05
d2a15a1132 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {M 5e-04
d1oh0a_125 d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, ste 0.001
d1ohpa1125 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase 0.002
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Length = 133 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: PhzA/PhzB-like
domain: Uncharacterized protein Ava2261
species: Anabaena variabilis [TaxId: 1172]
 Score = 52.5 bits (125), Expect = 4e-10
 Identities = 17/128 (13%), Positives = 33/128 (25%), Gaps = 21/128 (16%)

Query: 10  TSMAEQNQE---AIVKALYKALANDEMENVAKYLASDLEYWFHGPPT---------CQHM 57
           T  ++   +      +   + LA  E +     L  D  +WF               +  
Sbjct: 3   THYSDNTLKVAHQGFEFFTQGLATGEWQKFLDMLTEDFTFWFPMGEFHGLNVGKERAKEF 62

Query: 58  VRLLTGESSKATFKFEPRSVEVVGDCVIAEGWEGAPAY-------WVHVWTVNVKDGLIT 110
              ++              V      V+ E  +                + V  +   I 
Sbjct: 63  FTYVSESFHTGIQISSLDRVTSNETTVVFEFRDEGLFLGKPYKNRVAVSFDV--RGDKIC 120

Query: 111 QFREYFNT 118
            +REYF +
Sbjct: 121 SYREYFGS 128


>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Length = 131 Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 135 Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Length = 130 Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 145 Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Length = 127 Back     information, alignment and structure
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Length = 131 Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 132 Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Length = 129 Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Length = 139 Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 132 Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Length = 125 Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d3ebta1131 Uncharacterized protein BPSS0132 {Burkholderia pse 99.84
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 99.84
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 99.83
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 99.83
d3ec9a1130 Uncharacterized protein BTHI0051 {Burkholderia tha 99.81
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 99.79
d2geya1144 Putative hydroxylase AclR {Streptomyces galilaeus 99.79
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 99.78
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 99.77
d1tuha_131 Hypothetical protein egc068 from a soil-derived mo 99.76
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 99.75
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 99.75
d2f99a1140 Aklanonic acid methyl ester cyclase, AknH {Strepto 99.71
d1sjwa_142 Nogalonic acid methyl ester cyclase SnoaL {Strepto 99.71
d2k54a1123 Uncharacterized protein Atu0742 {Agrobacterium tum 99.7
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 99.64
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 99.59
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 99.57
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 99.39
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 98.98
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 98.42
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 98.35
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 98.31
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 98.07
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 97.82
d3blza1124 Uncharacterized protein Sbal0622 {Shewanella balti 97.78
d2f86b1129 Association domain of calcium/calmodulin-dependent 97.64
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 97.64
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 97.63
d2ux0a1135 Association domain of calcium/calmodulin-dependent 97.59
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 97.57
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 97.54
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 97.14
d3b8la1144 Uncharacterized protein Saro3538 {Novosphingobium 96.71
d2chca1167 Uncharacterized protein Rv3472 {Mycobacterium tube 96.7
d2imja1155 Hypothetical protein PFL3262 {Pseudomonas fluoresc 96.13
d3ejva1159 Uncharacterized protein Saro2766 {Novosphingobium 96.05
d3er7a1118 Uncharacterized protein Exig0174 {Exiguobacterium 95.94
d3ef8a1149 Uncharacterized protein Saro1465 {Novosphingobium 95.92
d3e99a1163 Benzoate 1,2-dioxygenase beta subunit BenB {Burkho 95.63
d3ecfa1128 Uncharacterized protein Ava4193 {Anabaena variabil 95.56
d2rfra1153 Uncharacterized protein Saro3722 {Novosphingobium 95.45
d3ebya1157 Putative hydroxylase subunit Saro3860 {Novosphingo 93.18
d1ulib_177 Biphenyl dioxygenase small subunit BphA2 {Rhodococ 91.77
d2b1xb1167 Naphthalene 1,2-dioxygenase beta subunit {Rhodococ 91.59
d1idpa_147 Scytalone dehydratase {Fungus (Magnaporthe grisea) 91.43
d1wqlb1182 Small subunit of cumene dioxygenase CumA2 {Pseudom 90.79
d1gy6a_125 Nuclear transport factor-2 (NTF2) {Rat (Rattus nor 85.27
d1tp6a_126 Hypothetical protein PA1314 {Pseudomonas aeruginos 80.71
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: SnoaL-like polyketide cyclase
domain: Uncharacterized protein BPSS0132
species: Burkholderia pseudomallei [TaxId: 28450]
Probab=99.84  E-value=1.7e-20  Score=132.47  Aligned_cols=110  Identities=18%  Similarity=0.350  Sum_probs=93.5

Q ss_pred             cHHHHHHHHHHHHhCCCHHHHHhhccCCeEEEecCC-----c-----cHHHHHHHHhccccc-ceeEEEeeEEEEeCCEE
Q 031351           16 NQEAIVKALYKALANDEMENVAKYLASDLEYWFHGP-----P-----TCQHMVRLLTGESSK-ATFKFEPRSVEVVGDCV   84 (161)
Q Consensus        16 ~~~~lV~~f~~A~~~gD~e~l~~lla~Dvv~~~~Gp-----~-----~~~~v~~~l~~~~~~-~~~~~~~~~vi~~Gd~V   84 (161)
                      .|+++|++||+|+++||++++.++++||++|+.|++     .     +.+++..++...... ..+.+++..++++|+.|
T Consensus         3 ~n~~~v~~~~~a~~~~D~~~~~~~~a~D~~~~~~~~~~~~~~~g~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~v   82 (131)
T d3ebta1           3 NNMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLGGTKHGHDEVIAFIRHVPTHIAEMRLAPDEFIESGERI   82 (131)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHTTEEEEEEEEECGGGGGGTCCEEEEHHHHHHHHHHHGGGTEEEEEEEEEEEEEETTEE
T ss_pred             cHHHHHHHHHHHHHcCCHHHHHHHhCcceEEEEcCCCcccCccccccchHHHHHhhhhhccccCcceeeEEEEEeccceE
Confidence            599999999999999999999999999999998752     1     246777777766554 67889999999999999


Q ss_pred             EEEeecC-----C---CceEEEEEEEEecCCeEEEEEEeeChHHHHHHcCC
Q 031351           85 IAEGWEG-----A---PAYWVHVWTVNVKDGLITQFREYFNTWLTVKDLRP  127 (161)
Q Consensus        85 vv~G~~~-----~---~~~~v~vf~v~~~DGkI~~~~ey~D~~~l~~alg~  127 (161)
                      ++.+...     +   ...+|++|+|  +||||+++++|+|+..+++++.+
T Consensus        83 ~~~~~~~~~~~~G~~~~~~~~~~~~~--~dGkI~~~~~y~D~~~~~~~~~a  131 (131)
T d3ebta1          83 VVLGTRRVTAVNGRSATLKFVHVWRF--ENGRAVTFEDHFDTAEMIRLITA  131 (131)
T ss_dssp             EEEEEEEEEETTSCEEEEEEEEEEEE--ETTEEEEEEEECCHHHHHHHHCC
T ss_pred             EEEEEEEEEecCCCeeEEEEEEEEEE--ECCEEEEEEEEECHHHHHHHhcC
Confidence            9885442     1   1566999999  99999999999999999999875



>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2imja1 d.17.4.23 (A:5-159) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]} Back     information, alignment and structure
>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3e99a1 d.17.4.4 (A:1-163) Benzoate 1,2-dioxygenase beta subunit BenB {Burkholderia mallei [TaxId: 13373]} Back     information, alignment and structure
>d3ecfa1 d.17.4.21 (A:2-129) Uncharacterized protein Ava4193 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3ebya1 d.17.4.4 (A:6-162) Putative hydroxylase subunit Saro3860 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d1ulib_ d.17.4.4 (B:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} Back     information, alignment and structure
>d2b1xb1 d.17.4.4 (B:513-679) Naphthalene 1,2-dioxygenase beta subunit {Rhodococcus sp. ncimb12038 [TaxId: 92694]} Back     information, alignment and structure
>d1idpa_ d.17.4.1 (A:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wqlb1 d.17.4.4 (B:5-186) Small subunit of cumene dioxygenase CumA2 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure