Citrus Sinensis ID: 031382

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MKTATTRYKHHPSASASASASEQLSFFLNEFQSANGIQLSSLELESIKESSILELSRSLDQDSKSLGMHMKAAFGSLWKEVLTEGQLLEGKIDPGSPAVLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKNRVNFAGGTPSRLVINC
ccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHcccEEEEccccccccc
ccccccHHcccccccccccHHHHHHHHHHHHHHHccccccEEEHcccccccEEEcccccccccHHHHHHHHHHccHHHHHHcccHHHHHccccccccEEEEEEHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccEEEccccEEEEEc
mktattrykhhpsasasasASEQLSFFLNEFqsangiqlssleleSIKESSILELSRSLDQDSKSLGMHMKAAFGSLWKEVLTegqllegkidpgspavLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKNRVnfaggtpsrlvinc
mktattrykhhpsasasasASEQLSFFLNEFQSANGIQLSSLELESIKESSILELSRSLDQDSKSLGMHMKAAFGSLWKEVLTEGQLLEGKIDPGSPAVLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKnrvnfaggtpsrlvinc
MKTATTRYKHHPsasasasasEQLSFFLNEFQSANGIQlsslelesikessilelsrslDQDSKSLGMHMKAAFGSLWKEVLTEGQLLEGKIDPGSPAVLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKNRVNFAGGTPSRLVINC
*************************FFLN***************************************HMKAAFGSLWKEVLTEGQLLEGKIDPGSPAVLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKNRVNFAG**********
**************************FLNEFQSANGIQLSSLELESIKESSILELSRSLDQDSKSLGMHMKAAFGS***********************LIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKNRVNFAGGTPSRLVINC
*********************EQLSFFLNEFQSANGIQLSSLELESIKESSILELSRSLDQDSKSLGMHMKAAFGSLWKEVLTEGQLLEGKIDPGSPAVLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKNRVNFAGGTPSRLVINC
********************SEQLSFFLNEFQSANGIQLSSLELESIKESSILELSRSLDQDSKSLGMHMKAAFGSLWKEVLTEGQLLEGKIDPGSPAVLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKNRVNFAGGTPSRLVINC
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTATTRYKHHPSASASASASEQLSFFLNEFQSANGIQLSSLELESIKESSILELSRSLDQDSKSLGMHMKAAFGSLWKEVLTEGQLLEGKIDPGSPAVLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKNRVNFAGGTPSRLVINC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query160 2.2.26 [Sep-21-2011]
Q9CZT6276 Protein CMSS1 OS=Mus musc yes no 0.362 0.210 0.474 5e-08
Q2T9Y1279 Uncharacterized protein C yes no 0.362 0.207 0.457 6e-08
Q5FVR6276 Protein CMSS1 OS=Rattus n yes no 0.362 0.210 0.440 1e-07
Q9BQ75279 Protein CMSS1 OS=Homo sap yes no 0.362 0.207 0.457 2e-07
Q5XJK9291 Protein CMSS1 OS=Danio re yes no 0.381 0.209 0.467 2e-07
Q68EV5277 Protein CMSS1 OS=Xenopus N/A no 0.362 0.209 0.389 2e-06
O94465277 Protein cms1 OS=Schizosac yes no 0.387 0.223 0.375 4e-05
>sp|Q9CZT6|CMS1_MOUSE Protein CMSS1 OS=Mus musculus GN=Cmss1 PE=2 SV=1 Back     alignment and function desciption
 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (72%), Gaps = 1/59 (1%)

Query: 99  VLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSLLKNRVNFAG-GTPSRL 156
           +LI+ SSA+R++EL++ L +   +   +KLF+KH+KV+EQV LL+ RV   G GTP R+
Sbjct: 155 MLILCSSAVRALELIRSLTAFKGDAKVMKLFAKHIKVQEQVKLLEKRVIHLGVGTPGRI 213

Mus musculus (taxid: 10090)
>sp|Q2T9Y1|CC026_BOVIN Uncharacterized protein C3orf26 homolog OS=Bos taurus PE=2 SV=1 Back     alignment and function description
>sp|Q5FVR6|CMS1_RAT Protein CMSS1 OS=Rattus norvegicus GN=Cmss1 PE=2 SV=1 Back     alignment and function description
>sp|Q9BQ75|CMS1_HUMAN Protein CMSS1 OS=Homo sapiens GN=CMSS1 PE=1 SV=2 Back     alignment and function description
>sp|Q5XJK9|CMS1_DANRE Protein CMSS1 OS=Danio rerio GN=cmss1 PE=2 SV=1 Back     alignment and function description
>sp|Q68EV5|CMS1_XENLA Protein CMSS1 OS=Xenopus laevis GN=cmss1 PE=2 SV=1 Back     alignment and function description
>sp|O94465|CMS1_SCHPO Protein cms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cms1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
224128910 279 predicted protein [Populus trichocarpa] 0.893 0.512 0.755 1e-55
296089632 273 unnamed protein product [Vitis vinifera] 0.918 0.538 0.662 3e-50
449468740 271 PREDICTED: protein CMSS1-like [Cucumis s 0.943 0.557 0.653 4e-49
297788960 284 hypothetical protein ARALYDRAFT_497422 [ 0.887 0.5 0.647 1e-45
297824287 284 hypothetical protein ARALYDRAFT_483412 [ 0.887 0.5 0.647 1e-45
30689255 288 uncharacterized protein [Arabidopsis tha 0.887 0.493 0.647 2e-45
357445149245 ATP-dependent RNA helicase DDX1 [Medicag 0.868 0.567 0.648 4e-45
343172286 280 hypothetical protein, partial [Silene la 0.868 0.496 0.604 3e-43
343172288 280 hypothetical protein, partial [Silene la 0.868 0.496 0.597 7e-43
147801214 380 hypothetical protein VITISV_002839 [Viti 0.812 0.342 0.641 3e-41
>gi|224128910|ref|XP_002320451.1| predicted protein [Populus trichocarpa] gi|222861224|gb|EEE98766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/143 (75%), Positives = 126/143 (88%)

Query: 14  ASASASASEQLSFFLNEFQSANGIQLSSLELESIKESSILELSRSLDQDSKSLGMHMKAA 73
           AS  ASAS+QLSFF++EFQSANG+QLSS+ELESIKE+   ELS+   QD  +LG HMKAA
Sbjct: 53  ASTPASASQQLSFFISEFQSANGVQLSSIELESIKETCFAELSQESGQDVMALGSHMKAA 112

Query: 74  FGSLWKEVLTEGQLLEGKIDPGSPAVLIISSSALRSIELLKGLRSLTKECHAVKLFSKHM 133
           FG  WK+VL EG+L+EG IDPGSPAVLIIS+SALRS+ELL+G+RSLTKECHA KLFSKHM
Sbjct: 113 FGPSWKQVLCEGKLVEGIIDPGSPAVLIISTSALRSLELLRGVRSLTKECHAAKLFSKHM 172

Query: 134 KVEEQVSLLKNRVNFAGGTPSRL 156
           KVEEQV++LKNRVNFA GTPSR+
Sbjct: 173 KVEEQVAMLKNRVNFASGTPSRV 195

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296089632|emb|CBI39451.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449468740|ref|XP_004152079.1| PREDICTED: protein CMSS1-like [Cucumis sativus] gi|449520825|ref|XP_004167433.1| PREDICTED: protein CMSS1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297788960|ref|XP_002862502.1| hypothetical protein ARALYDRAFT_497422 [Arabidopsis lyrata subsp. lyrata] gi|297308060|gb|EFH38760.1| hypothetical protein ARALYDRAFT_497422 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297824287|ref|XP_002880026.1| hypothetical protein ARALYDRAFT_483412 [Arabidopsis lyrata subsp. lyrata] gi|297325865|gb|EFH56285.1| hypothetical protein ARALYDRAFT_483412 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30689255|ref|NP_850384.1| uncharacterized protein [Arabidopsis thaliana] gi|26452917|dbj|BAC43536.1| unknown protein [Arabidopsis thaliana] gi|114050605|gb|ABI49452.1| At2g43110 [Arabidopsis thaliana] gi|330255116|gb|AEC10210.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357445149|ref|XP_003592852.1| ATP-dependent RNA helicase DDX1 [Medicago truncatula] gi|355481900|gb|AES63103.1| ATP-dependent RNA helicase DDX1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|343172286|gb|AEL98847.1| hypothetical protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|343172288|gb|AEL98848.1| hypothetical protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|147801214|emb|CAN73210.1| hypothetical protein VITISV_002839 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
TAIR|locus:2041011288 AT2G43110 "AT2G43110" [Arabido 0.843 0.468 0.555 2.8e-34
UNIPROTKB|F1NQL6227 CMSS1 "Uncharacterized protein 0.525 0.370 0.372 9.4e-11
UNIPROTKB|F1SKY0245 C3orf26 "Uncharacterized prote 0.525 0.342 0.383 1.3e-09
UNIPROTKB|Q2T9Y1279 Q2T9Y1 "Uncharacterized protei 0.525 0.301 0.383 3.7e-09
MGI|MGI:1913747276 Cmss1 "cms small ribosomal sub 0.381 0.221 0.467 4.6e-09
UNIPROTKB|C9J384225 CMSS1 "Protein CMSS1" [Homo sa 0.525 0.373 0.372 6e-09
UNIPROTKB|E2RB18276 C3orf26 "Uncharacterized prote 0.381 0.221 0.467 6e-09
ZFIN|ZDB-GENE-041010-146292 cmss1 "cms1 ribosomal small su 0.6 0.328 0.373 7.1e-09
UNIPROTKB|G4NJ69274 MGG_12603 "Uncharacterized pro 0.506 0.295 0.406 7.6e-09
UNIPROTKB|E9PHS3261 CMSS1 "Protein CMSS1" [Homo sa 0.525 0.321 0.372 1.1e-08
TAIR|locus:2041011 AT2G43110 "AT2G43110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 372 (136.0 bits), Expect = 2.8e-34, P = 2.8e-34
 Identities = 75/135 (55%), Positives = 94/135 (69%)

Query:    22 EQLSFFLNEFQSANGIQXXXXXXXXXXXXXXXXXXXXXDQDSKSLGMHMKAAFGSLWKEV 81
             EQL++FLN   SA GI+                     DQD  +LG H+K + GS W+E 
Sbjct:    78 EQLNYFLNHLDSAIGIKVSSLELEPIKDTCIVELSQGLDQDVSNLGEHIKLSCGSSWRET 137

Query:    82 LTEGQLLEGKIDPGSPAVLIISSSALRSIELLKGLRSLTKECHAVKLFSKHMKVEEQVSL 141
             L EG+ LE K++PG+P+VL+ISSSALRS+ELL+GL SLTK+C AVKLFSKH+KVEEQVSL
Sbjct:   138 LCEGESLERKVEPGNPSVLVISSSALRSLELLRGLHSLTKQCPAVKLFSKHLKVEEQVSL 197

Query:   142 LKNRVNFAGGTPSRL 156
             LK RVN   GTP+R+
Sbjct:   198 LKKRVNIGSGTPNRI 212
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|F1NQL6 CMSS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKY0 C3orf26 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9Y1 Q2T9Y1 "Uncharacterized protein C3orf26 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1913747 Cmss1 "cms small ribosomal subunit 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|C9J384 CMSS1 "Protein CMSS1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RB18 C3orf26 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-146 cmss1 "cms1 ribosomal small subunit homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G4NJ69 MGG_12603 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|E9PHS3 CMSS1 "Protein CMSS1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00140975
hypothetical protein (279 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 160
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 100.0
KOG3089271 consensus Predicted DEAD-box-containing helicase [ 99.88
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 99.16
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.1
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 98.91
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 98.79
KOG0334 997 consensus RNA helicase [RNA processing and modific 98.76
KOG0347 731 consensus RNA helicase [RNA processing and modific 98.76
KOG0329 387 consensus ATP-dependent RNA helicase [RNA processi 98.76
KOG0341 610 consensus DEAD-box protein abstrakt [RNA processin 98.75
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 98.68
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 98.67
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 98.65
KOG0330 476 consensus ATP-dependent RNA helicase [RNA processi 98.65
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.64
KOG0335 482 consensus ATP-dependent RNA helicase [RNA processi 98.59
KOG0333 673 consensus U5 snRNP-like RNA helicase subunit [RNA 98.58
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 98.56
PTZ00110 545 helicase; Provisional 98.54
KOG0326 459 consensus ATP-dependent RNA helicase [RNA processi 98.53
KOG0328 400 consensus Predicted ATP-dependent RNA helicase FAL 98.46
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 98.43
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 98.42
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 98.42
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 98.39
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 98.39
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 98.38
KOG4284 980 consensus DEAD box protein [Transcription] 98.26
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 98.26
KOG0343 758 consensus RNA Helicase [RNA processing and modific 98.18
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 98.09
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 98.03
KOG0340 442 consensus ATP-dependent RNA helicase [RNA processi 98.0
KOG0350 620 consensus DEAD-box ATP-dependent RNA helicase [RNA 97.96
PTZ00424 401 helicase 45; Provisional 97.84
KOG0346 569 consensus RNA helicase [RNA processing and modific 97.82
PRK09401 1176 reverse gyrase; Reviewed 97.82
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.8
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 97.62
KOG0327 397 consensus Translation initiation factor 4F, helica 97.62
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.44
PRK14701 1638 reverse gyrase; Provisional 97.41
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 97.39
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 97.38
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.29
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 97.17
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 97.1
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 96.82
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 96.81
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 96.72
PRK10689 1147 transcription-repair coupling factor; Provisional 96.69
PRK13767 876 ATP-dependent helicase; Provisional 96.56
PRK09200 790 preprotein translocase subunit SecA; Reviewed 96.43
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 95.91
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.85
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 95.79
PRK05580 679 primosome assembly protein PriA; Validated 95.69
KOG0344 593 consensus ATP-dependent RNA helicase [RNA processi 95.39
PRK12904 830 preprotein translocase subunit SecA; Reviewed 95.34
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 94.91
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 94.8
PHA02558 501 uvsW UvsW helicase; Provisional 94.67
PRK02362 737 ski2-like helicase; Provisional 94.54
PRK00254 720 ski2-like helicase; Provisional 94.54
KOG0332 477 consensus ATP-dependent RNA helicase [RNA processi 94.47
PHA02653 675 RNA helicase NPH-II; Provisional 93.68
PRK01172 674 ski2-like helicase; Provisional 93.61
PRK13107 908 preprotein translocase subunit SecA; Reviewed 92.47
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 92.16
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 92.01
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 91.99
smart00487201 DEXDc DEAD-like helicases superfamily. 91.45
TIGR00595 505 priA primosomal protein N'. All proteins in this f 89.85
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 88.24
PRK13766 773 Hef nuclease; Provisional 87.44
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 87.42
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 86.78
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 84.64
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 82.97
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 82.25
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 80.32
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information 
Probab=100.00  E-value=8.8e-40  Score=275.63  Aligned_cols=138  Identities=37%  Similarity=0.516  Sum_probs=124.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHhhCCCCCccccccccccchhcccccccccccchhhhhhhhhhhhHHHHhhhh--hhccC
Q 031382           13 SASASASASEQLSFFLNEFQSANGIQLSSLELESIKESSILELSRSLDQDSKSLGMHMKAAFGSLWKEVLTEG--QLLEG   90 (160)
Q Consensus        13 ~~~~~~sp~~~a~~l~~~~~~~~~~~LS~lELedl~es~fl~~~~~~~~dt~~l~~~~~~~~~p~~~~~~~~~--~l~k~   90 (160)
                      .+++.++|+.++|||+++++++|+ |||+|||||++      ++++.+.||++|.+++++.++|+|++.||+.  .+.+.
T Consensus        48 ~~~~~~~~~~lad~l~~~~k~~~~-dLS~lELedl~------i~~s~f~dt~~~~~~r~l~nL~~fLk~~~~~~~~l~~~  120 (252)
T PF14617_consen   48 ESIAKMDPELLADYLAQKIKRFNP-DLSSLELEDLY------IPESAFLDTSSFTKPRTLDNLPSFLKQFSPKKKKLSKK  120 (252)
T ss_pred             cccccCCHHHHHHHHHHHHHHhCC-CcCeeeccccc------cCHHhcccccccCCCcccchHHHHHHHhccchhhhhhc
Confidence            467889999999999999999876 99999999972      4555555688999999999999999999863  47888


Q ss_pred             CCCCCCCeEEEEcCchhhHHHHHHHHhhh-hcccchhhhhccCCCHHHHHHHHh-cCCcEEEeCCCcee
Q 031382           91 KIDPGSPAVLIISSSALRSIELLKGLRSL-TKECHAVKLFSKHMKVEEQVSLLK-NRVNFAGGTPSRLV  157 (160)
Q Consensus        91 ~~~~~sP~~lIl~~Sa~ra~dv~r~l~~~-~k~~~v~KLFaKh~Ki~eQi~~Lk-~~v~I~VGTPgRl~  157 (160)
                      +.++|+|++||||+||+||+||+|+|+.| +++|.|+|||||||||+|||++|+ +.++|+|||||||.
T Consensus       121 ~~~~gsP~~lvvs~SalRa~dl~R~l~~~~~k~~~v~KLFaKH~Kl~eqv~~L~~~~~~i~vGTP~Rl~  189 (252)
T PF14617_consen  121 PKEKGSPHVLVVSSSALRAADLIRALRSFKGKDCKVAKLFAKHIKLEEQVKLLKKTRVHIAVGTPGRLS  189 (252)
T ss_pred             ccCCCCCEEEEEcchHHHHHHHHHHHHhhccCCchHHHHHHhhccHHHHHHHHHhCCceEEEeChHHHH
Confidence            89999999999999999999999999999 578999999999999999999999 68999999999984

>KOG3089 consensus Predicted DEAD-box-containing helicase [General function prediction only] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.51
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.5
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 98.45
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.36
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.31
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.3
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.27
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.26
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.22
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.22
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.16
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.15
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.14
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.14
3bor_A237 Human initiation factor 4A-II; translation initiat 98.1
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.02
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.99
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 97.95
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.87
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.84
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.81
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 97.77
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 97.77
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.76
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 97.74
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.7
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 97.69
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.65
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.65
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.61
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.48
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.46
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 97.43
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 97.36
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 97.35
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.25
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 97.24
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.12
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 97.1
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 97.08
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.08
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 96.86
4gl2_A 699 Interferon-induced helicase C domain-containing P; 96.85
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 96.53
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 96.47
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 96.29
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 96.02
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 95.88
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 95.76
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 95.56
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 95.43
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.35
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 95.17
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 94.82
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 94.49
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 94.43
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 94.41
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 94.4
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 94.39
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 94.26
3h1t_A 590 Type I site-specific restriction-modification syst 94.17
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 94.1
1yks_A 440 Genome polyprotein [contains: flavivirin protease 92.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 92.83
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 92.54
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 91.07
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 89.87
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 89.33
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 89.09
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 88.02
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 87.85
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 87.82
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 87.69
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 86.99
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 86.34
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 84.52
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 84.47
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 83.77
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 83.72
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 80.79
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 80.78
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 80.66
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 80.46
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 80.42
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=98.51  E-value=7.2e-08  Score=82.90  Aligned_cols=63  Identities=19%  Similarity=0.284  Sum_probs=54.9

Q ss_pred             CCCCeEEEEcCchhhHHHHHHHHhhhhc--ccchhhhhccCCCHHHHHHHHhcCCcEEEeCCCcee
Q 031382           94 PGSPAVLIISSSALRSIELLKGLRSLTK--ECHAVKLFSKHMKVEEQVSLLKNRVNFAGGTPSRLV  157 (160)
Q Consensus        94 ~~sP~~lIl~~Sa~ra~dv~r~l~~~~k--~~~v~KLFaKh~Ki~eQi~~Lk~~v~I~VGTPgRl~  157 (160)
                      .+.|++|||+||+++|.|+.+.++.|..  ..++.-++++ ....+|.+.++.+++|+||||||+.
T Consensus       127 ~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg-~~~~~~~~~l~~~~~Ivv~Tp~~l~  191 (434)
T 2db3_A          127 LGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGG-TSFRHQNECITRGCHVVIATPGRLL  191 (434)
T ss_dssp             TTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTT-SCHHHHHHHHTTCCSEEEECHHHHH
T ss_pred             cCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECC-CCHHHHHHHhhcCCCEEEEChHHHH
Confidence            4579999999999999999999999853  3566777776 6899999999999999999999984
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.93
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.73
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.72
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.69
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.6
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.34
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.27
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.94
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.59
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 96.42
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 94.58
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 93.68
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 92.14
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 90.97
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 90.88
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 88.38
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 88.11
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 87.96
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 86.58
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 85.6
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 84.97
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 84.27
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 84.24
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 81.48
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.93  E-value=3.8e-10  Score=89.28  Aligned_cols=65  Identities=22%  Similarity=0.345  Sum_probs=55.6

Q ss_pred             CCCCCCeEEEEcCchhhHHHHHHHHhhhhc--ccchhhhhccCCCHHHHHHHHhcCCcEEEeCCCcee
Q 031382           92 IDPGSPAVLIISSSALRSIELLKGLRSLTK--ECHAVKLFSKHMKVEEQVSLLKNRVNFAGGTPSRLV  157 (160)
Q Consensus        92 ~~~~sP~~lIl~~Sa~ra~dv~r~l~~~~k--~~~v~KLFaKh~Ki~eQi~~Lk~~v~I~VGTPgRl~  157 (160)
                      .....|++||++||+|+|.|+.+.++.+.+  +.++..++++ ....+|...|+.+.+|+||||||+.
T Consensus        81 ~~~~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~-~~~~~~~~~l~~~~~Ilv~TPgrl~  147 (222)
T d2j0sa1          81 IQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGG-TNVGEDIRKLDYGQHVVAGTPGRVF  147 (222)
T ss_dssp             TTSCSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTT-SCHHHHHHHHHHCCSEEEECHHHHH
T ss_pred             ccccCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeec-ccchhhHHHhccCCeEEeCCCCcHH
Confidence            345679999999999999999999999954  3456667765 6999999999999999999999973
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure