Citrus Sinensis ID: 031385

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLAV
cEEEEEcccccEEEEEcccccHHHHHHHHHHHHcccccccEEEEEEcccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHccccccccccccccEEEEEEEEEccccc
cEEEEEEcEEEEEEEEcccccHHHHHHHHHHHHcccccccEccEEEcccEEEEccccccccccccccccccHHHcccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHcccEcHHHcEcccEEEEEEEEEEccccc
msvtlhtnlgdikceiacdevpKTAENFLALCAsgyydgtifhRNIKgfmiqggdptgtgkggtsiwgkKFNDEIRESLKHNARGILSmansgpntngsQFFISYakqphlnglYTVFGRVIHGFEVLDLMEKaqtgsgdrplaeirinrvtihanplav
msvtlhtnlgdikceiACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKaqtgsgdrplaeirinrvtihanplav
MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQggdptgtgkggtSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLAV
****LHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEI***********************SQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEK*********LAEIRINRVTI*******
MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLAV
MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLAV
MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLAV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query160 2.2.26 [Sep-21-2011]
P0C1I5170 Peptidyl-prolyl cis-trans N/A no 0.993 0.935 0.722 4e-65
P0CP86167 Peptidyl-prolyl cis-trans yes no 0.993 0.952 0.691 1e-64
P0CP87167 Peptidyl-prolyl cis-trans N/A no 0.993 0.952 0.691 1e-64
Q54E95161 Peptidyl-prolyl cis-trans yes no 0.993 0.987 0.710 2e-62
Q812D3161 Peptidyl-prolyl cis-trans yes no 0.993 0.987 0.675 2e-61
Q9H2H8161 Peptidyl-prolyl cis-trans yes no 0.993 0.987 0.681 2e-61
Q9D6L8161 Peptidyl-prolyl cis-trans yes no 0.993 0.987 0.668 6e-61
Q5ZLV2161 Peptidyl-prolyl cis-trans yes no 1.0 0.993 0.664 1e-60
Q4PCH8168 Peptidyl-prolyl cis-trans N/A no 1.0 0.952 0.625 4e-56
P52017161 Peptidyl-prolyl cis-trans yes no 0.993 0.987 0.610 4e-54
>sp|P0C1I5|PPIL3_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp4 PE=3 SV=1 Back     alignment and function desciption
 Score =  246 bits (628), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 132/166 (79%), Gaps = 7/166 (4%)

Query: 1   MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQ------GG 54
           MSVTLHT+LGDIK E+ C+ VPKTAENFLALCASGYYD   FHRNI GFMIQ       G
Sbjct: 1   MSVTLHTDLGDIKIEVFCEAVPKTAENFLALCASGYYDNNTFHRNIPGFMIQVHEHLHTG 60

Query: 55  DPTGTGKGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGL 114
           DPTGTGKGG SIWGKKFNDEIR +LKHN+RGI+SMANSGPNTNGSQFFI+YAK PHL+  
Sbjct: 61  DPTGTGKGGNSIWGKKFNDEIRSTLKHNSRGIVSMANSGPNTNGSQFFITYAKHPHLDTK 120

Query: 115 YTVFGRVIHGFE-VLDLMEKAQTGSGDRPLAEIRINRVTIHANPLA 159
           YTVFG+VI G +  LD+MEK       RPL E RI  VTIHANP+A
Sbjct: 121 YTVFGKVIDGADSTLDMMEKVPVDEKHRPLQEFRIKSVTIHANPIA 166
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (taxid: 246409)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|P0CP86|PPIL3_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP10 PE=3 SV=1 Back     alignment and function description
>sp|P0CP87|PPIL3_CRYNB Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP10 PE=3 SV=1 Back     alignment and function description
>sp|Q54E95|PPIL3_DICDI Peptidyl-prolyl cis-trans isomerase-like 3 OS=Dictyostelium discoideum GN=ppil3 PE=3 SV=1 Back     alignment and function description
>sp|Q812D3|PPIL3_RAT Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rattus norvegicus GN=Ppil3 PE=2 SV=1 Back     alignment and function description
>sp|Q9H2H8|PPIL3_HUMAN Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens GN=PPIL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9D6L8|PPIL3_MOUSE Peptidyl-prolyl cis-trans isomerase-like 3 OS=Mus musculus GN=Ppil3 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLV2|PPIL3_CHICK Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gallus gallus GN=PPIL3 PE=2 SV=1 Back     alignment and function description
>sp|Q4PCH8|PPIL3_USTMA Peptidyl-prolyl cis-trans isomerase-like 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP10 PE=3 SV=1 Back     alignment and function description
>sp|P52017|CYP10_CAEEL Peptidyl-prolyl cis-trans isomerase 10 OS=Caenorhabditis elegans GN=cyn-10 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
296089083178 unnamed protein product [Vitis vinifera] 0.993 0.893 0.955 8e-87
255541348217 cyclophilin-10, putative [Ricinus commun 0.993 0.732 0.949 9e-87
225453768160 PREDICTED: peptidyl-prolyl cis-trans iso 0.993 0.993 0.955 2e-86
224067787160 predicted protein [Populus trichocarpa] 0.993 0.993 0.949 6e-86
351722629160 uncharacterized protein LOC100306466 [Gl 0.993 0.993 0.937 3e-85
224130030160 predicted protein [Populus trichocarpa] 0.993 0.993 0.943 4e-85
297848310160 peptidyl-prolyl cis-trans isomerase cycl 0.993 0.993 0.930 6e-85
449432231194 PREDICTED: peptidyl-prolyl cis-trans iso 0.993 0.819 0.937 1e-84
358344345160 Peptidyl-prolyl cis-trans isomerase [Med 0.993 0.993 0.937 2e-84
388519353160 unknown [Lotus japonicus] 1.0 1.0 0.937 2e-84
>gi|296089083|emb|CBI38786.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  324 bits (830), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 152/159 (95%), Positives = 157/159 (98%)

Query: 1   MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTG 60
           MSVTLHTNLGDIKCEI+CDEV KTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTG
Sbjct: 19  MSVTLHTNLGDIKCEISCDEVSKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTG 78

Query: 61  KGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGR 120
           KGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFI+YAKQPHLNGLYTVFGR
Sbjct: 79  KGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFITYAKQPHLNGLYTVFGR 138

Query: 121 VIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLA 159
           VIHGFEVLD+MEK QTG+GDRPLAEIR+NRVTIHANPLA
Sbjct: 139 VIHGFEVLDIMEKTQTGAGDRPLAEIRLNRVTIHANPLA 177

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255541348|ref|XP_002511738.1| cyclophilin-10, putative [Ricinus communis] gi|223548918|gb|EEF50407.1| cyclophilin-10, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225453768|ref|XP_002274583.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224067787|ref|XP_002302542.1| predicted protein [Populus trichocarpa] gi|222844268|gb|EEE81815.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351722629|ref|NP_001235459.1| uncharacterized protein LOC100306466 [Glycine max] gi|255628631|gb|ACU14660.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224130030|ref|XP_002320735.1| predicted protein [Populus trichocarpa] gi|222861508|gb|EEE99050.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297848310|ref|XP_002892036.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] gi|297337878|gb|EFH68295.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449432231|ref|XP_004133903.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 3-like [Cucumis sativus] gi|449529754|ref|XP_004171863.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|358344345|ref|XP_003636250.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|358345575|ref|XP_003636852.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|355502185|gb|AES83388.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|355502787|gb|AES83990.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388519353|gb|AFK47738.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
TAIR|locus:2025492160 AT1G01940 [Arabidopsis thalian 0.993 0.993 0.855 4.1e-72
UNIPROTKB|Q9H2H8161 PPIL3 "Peptidyl-prolyl cis-tra 0.993 0.987 0.625 5.1e-51
UNIPROTKB|F2Z5T7161 PPIL3 "Peptidyl-prolyl cis-tra 0.993 0.987 0.625 5.1e-51
RGD|631415161 Ppil3 "peptidylprolyl isomeras 0.993 0.987 0.618 5.1e-51
DICTYBASE|DDB_G0291734161 ppil3 "cyclophilin-type peptid 0.993 0.987 0.654 1.1e-50
UNIPROTKB|J9NZK4160 PPIL3 "Peptidyl-prolyl cis-tra 0.987 0.987 0.622 1.7e-50
UNIPROTKB|H7BZ14180 PPIL3 "Peptidyl-prolyl cis-tra 0.987 0.877 0.622 1.7e-50
MGI|MGI:1917475161 Ppil3 "peptidylprolyl isomeras 0.993 0.987 0.612 2.2e-50
UNIPROTKB|Q5ZLV2161 PPIL3 "Peptidyl-prolyl cis-tra 1.0 0.993 0.602 3.6e-50
UNIPROTKB|J9P7M4161 J9P7M4 "Peptidyl-prolyl cis-tr 0.993 0.987 0.618 9.5e-50
TAIR|locus:2025492 AT1G01940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 729 (261.7 bits), Expect = 4.1e-72, P = 4.1e-72
 Identities = 136/159 (85%), Positives = 144/159 (90%)

Query:     1 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXX 60
             MSVTLHTNLGDIKCEI CDEVPK+AENFLALCASGYYDGTIFHRNIKGFMIQ        
Sbjct:     1 MSVTLHTNLGDIKCEIFCDEVPKSAENFLALCASGYYDGTIFHRNIKGFMIQGGDPKGTG 60

Query:    61 XXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGR 120
                 SIWGKKFNDEIR+SLKHNARG+LSMANSGPNTNGSQFFI+YAKQPHLNGLYT+FG+
Sbjct:    61 KGGTSIWGKKFNDEIRDSLKHNARGMLSMANSGPNTNGSQFFITYAKQPHLNGLYTIFGK 120

Query:   121 VIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLA 159
             VIHGFEVLD+MEK QTG GDRPLAEIR+NRVTIHANPLA
Sbjct:   121 VIHGFEVLDIMEKTQTGPGDRPLAEIRLNRVTIHANPLA 159
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
UNIPROTKB|Q9H2H8 PPIL3 "Peptidyl-prolyl cis-trans isomerase-like 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5T7 PPIL3 "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|631415 Ppil3 "peptidylprolyl isomerase (cyclophilin)-like 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291734 ppil3 "cyclophilin-type peptidylprolyl cis-trans isomerase (PPIase)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZK4 PPIL3 "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H7BZ14 PPIL3 "Peptidyl-prolyl cis-trans isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1917475 Ppil3 "peptidylprolyl isomerase (cyclophilin)-like 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLV2 PPIL3 "Peptidyl-prolyl cis-trans isomerase-like 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7M4 J9P7M4 "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZLV2PPIL3_CHICK5, ., 2, ., 1, ., 80.66451.00.9937yesno
P0C1I5PPIL3_RHIO95, ., 2, ., 1, ., 80.72280.99370.9352N/Ano
P0C1I4PPIL1_RHIO95, ., 2, ., 1, ., 80.55710.8750.8484N/Ano
Q9D6L8PPIL3_MOUSE5, ., 2, ., 1, ., 80.66870.99370.9875yesno
Q4I1Y1PPIL1_GIBZE5, ., 2, ., 1, ., 80.52630.950.9382yesno
Q6MWS8PPIL3_NEUCR5, ., 2, ., 1, ., 80.59030.99370.9520N/Ano
Q54E95PPIL3_DICDI5, ., 2, ., 1, ., 80.71060.99370.9875yesno
Q812D3PPIL3_RAT5, ., 2, ., 1, ., 80.6750.99370.9875yesno
Q9H2H8PPIL3_HUMAN5, ., 2, ., 1, ., 80.68120.99370.9875yesno
Q5ASQ0PPIL1_EMENI5, ., 2, ., 1, ., 80.53640.94370.9320yesno
Q7SF72PPIL1_NEUCR5, ., 2, ., 1, ., 80.52980.94370.9263N/Ano
Q8X191PPIL1_ASPNG5, ., 2, ., 1, ., 80.52980.94370.9320yesno
Q4IPB8PPIL3_GIBZE5, ., 2, ., 1, ., 80.61440.99370.9520yesno
P52017CYP10_CAEEL5, ., 2, ., 1, ., 80.61000.99370.9875yesno
P0CP87PPIL3_CRYNB5, ., 2, ., 1, ., 80.69180.99370.9520N/Ano
P0CP86PPIL3_CRYNJ5, ., 2, ., 1, ., 80.69180.99370.9520yesno
P0CP85PPIL1_CRYNB5, ., 2, ., 1, ., 80.52980.94370.8678N/Ano
Q2U6U0PPIL1_ASPOR5, ., 2, ., 1, ., 80.52310.94370.9378yesno
Q4PCH8PPIL3_USTMA5, ., 2, ., 1, ., 80.62571.00.9523N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.983
4th Layer5.2.1.80.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00026255001
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8;; PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity) (166 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 1e-108
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 4e-83
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 4e-71
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 6e-69
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 1e-65
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 4e-65
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 8e-64
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 2e-58
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 3e-53
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 3e-45
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 2e-44
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 1e-39
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 2e-31
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 1e-28
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 3e-22
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 3e-19
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 3e-10
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information 
 Score =  303 bits (777), Expect = e-108
 Identities = 115/153 (75%), Positives = 129/153 (84%)

Query: 1   MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTG 60
           MSVTLHTNLGDIK E+ CD+ PK  ENFLALCASGYY+G IFHRNIKGFM+Q GDPTGTG
Sbjct: 1   MSVTLHTNLGDIKIELFCDDCPKACENFLALCASGYYNGCIFHRNIKGFMVQTGDPTGTG 60

Query: 61  KGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGR 120
           KGG SIWGKKF DE RE+LKH++RG++SMAN+GPNTNGSQFFI+YAKQPHL+G YTVFG+
Sbjct: 61  KGGESIWGKKFEDEFRETLKHDSRGVVSMANNGPNTNGSQFFITYAKQPHLDGKYTVFGK 120

Query: 121 VIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTI 153
           VI GFE LD +EK       RPL EIRI  VTI
Sbjct: 121 VIDGFETLDTLEKLPVDKKYRPLEEIRIKDVTI 153

Proteins similar to Human cyclophilin-like peptidylprolyl cis- trans isomerase (PPIL3). Members of this family lack a key residue important for cyclosporin binding: the tryptophan residue corresponding to W121 in human hCyP-18a; most members have a histidine at this position. The exact function of the protein is not known. Length = 153
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 160
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
KOG0883518 consensus Cyclophilin type, U box-containing pepti 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PTZ00221249 cyclophilin; Provisional 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
PTZ00060183 cyclophilin; Provisional 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 99.97
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.22
PRK00969 508 hypothetical protein; Provisional 97.55
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 97.55
PRK00969 508 hypothetical protein; Provisional 97.11
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 97.04
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 96.99
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 96.65
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 96.36
PF04126120 Cyclophil_like: Cyclophilin-like; InterPro: IPR007 95.57
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information 
Probab=100.00  E-value=3.3e-53  Score=306.89  Aligned_cols=158  Identities=59%  Similarity=1.072  Sum_probs=152.1

Q ss_pred             EEEEecCeeEEEEECCCCChHHHHHHHHHHhcCCcCCcEEEEeecCcEEEeccCCCCCCCCcccCCCccCccccccCCCC
Q 031385            3 VTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLKHN   82 (160)
Q Consensus         3 v~~~T~~G~i~ieL~~~~aP~~~~nF~~l~~~~~y~g~~~~ri~~~~~i~~G~~~~~~~~~~~~~~~~~~~e~~~~~~~~   82 (160)
                      |+|+|+.|+|+||||++.||++|+||++||+.++|+++.|||++|++++|+|++.+++.++.+.++..+++|..+.++|+
T Consensus         2 v~~~T~~G~i~ieL~~~~aP~t~~nF~~L~~~g~Y~~~~f~rv~~~~~iq~Gd~~~~g~~~~~~~g~~~~~E~~~~~~h~   81 (159)
T cd01923           2 VRLHTNKGDLNLELHCDKAPKACENFIKLCKKGYYDGTIFHRSIRNFMIQGGDPTGTGRGGESIWGKPFKDEFKPNLSHD   81 (159)
T ss_pred             EEEEEccccEEEEEeCCCChHHHHHHHHHHhcCccCCcEEEEEeCCcEEEecccCCCCCCCccccCCccCcccccCcCcC
Confidence            78999999999999999999999999999999999999999999999999999988888888888999999987788999


Q ss_pred             ceeEEEEecCCCCCCCceEEEecCCCCCCCCCceEEEEEecCHHHHHHhhhCcCCCCCCcccceEEEEEEEecCCCCC
Q 031385           83 ARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLAV  160 (160)
Q Consensus        83 ~~G~v~~~~~~~~~~~s~F~I~l~~~~~ld~~~~vfG~Vv~G~~vl~~I~~~~~~~~~~p~~~v~I~~~~i~~~pf~~  160 (160)
                      ++|+|+|+++++++++|||||+++++|+||++|+|||+|++||++|++|++.+++++++|+++|+|.+|.|++|||+.
T Consensus        82 ~~G~v~ma~~~~~s~~sqFfIt~~~~~~Ld~~~~vFG~V~~G~~vl~~I~~~~~~~~~~P~~~i~I~~~~i~~dpf~~  159 (159)
T cd01923          82 GRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTVFGRVVGGLETLEAMENVPDPGTDRPKEEIKIEDTSVFVDPFEE  159 (159)
T ss_pred             CCcEEEEeeCCCCCcccEEEEECCCCcccCCCccEEEEEEcCHHHHHHHHcCCCCCCCCCCCCeEEEEeEEEeCCCCC
Confidence            999999999999999999999999999999999999999999999999999999889999999999999999999973

This group includes the nuclear proteins, Human hCyP-60 and Caenorhabditis elegans MOG-6 which, compared to the archetypal cyclophilin Human cyclophilin A exhibit reduced peptidylprolyl cis- trans isomerase activity and lack a residue important for cyclophilin binding. Human hCyP-60 has been shown to physically interact with the proteinase inhibitor peptide eglin c and; C. elegans MOG-6 to physically interact with MEP-1, a nuclear zinc finger protein. MOG-6 has been shown to function in germline sex determination.
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information
>PF04126 Cyclophil_like: Cyclophilin-like; InterPro: IPR007256 Proteins of this family have no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 5e-55
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 5e-55
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 2e-42
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 3e-42
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 2e-33
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 4e-31
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 4e-31
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 4e-31
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 5e-31
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 7e-29
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 2e-26
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 3e-26
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 3e-25
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 5e-25
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 2e-24
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 2e-24
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 2e-24
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 2e-24
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 2e-24
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 2e-24
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 2e-24
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 2e-24
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 2e-24
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 2e-24
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 2e-24
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 3e-24
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 3e-24
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 3e-24
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 4e-24
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 4e-24
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 6e-24
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 6e-24
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 6e-24
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 9e-24
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 1e-23
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 1e-23
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 1e-23
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 1e-23
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 1e-23
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 1e-23
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 1e-23
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 2e-23
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 3e-23
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 3e-23
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 4e-23
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 1e-22
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 1e-22
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 2e-22
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 3e-22
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 4e-22
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 4e-22
1dyw_A173 Biochemical And Structural Characterization Of A Di 4e-22
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 5e-22
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 5e-22
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 7e-22
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 7e-22
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 7e-22
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 1e-21
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 2e-21
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 2e-21
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 2e-21
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 3e-21
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 4e-21
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 4e-20
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 6e-20
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 7e-19
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 7e-19
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 8e-18
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 5e-17
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 6e-17
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 6e-17
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 6e-16
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 6e-13
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 6e-13
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure 
Iteration: 1

 Score =  209 bits (532), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 100/160 (62%), Positives = 116/160 (72%), Gaps = 1/160 (0%)
Query: 1   MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXX 60
           MSVTLHT++GDIK E+ C+  PKT ENFLALCAS YY+G IFHRNIKGFM+Q        
Sbjct: 7   MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTG 66
Query: 61  XXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGR 120
               SIWGKKF DE  E LKHN RG++SMAN+GPNTNGSQFFI+Y KQPHL+  YTVFG+
Sbjct: 67  RGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGK 126
Query: 121 VIHGFEVLDLMEKAQTGSGD-RPLAEIRINRVTIHANPLA 159
           VI G E LD +EK        RPL ++ I  +TIHANP A
Sbjct: 127 VIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA 166
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 1e-107
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 1e-105
2b71_A196 Cyclophilin-like protein; structural genomics, str 1e-104
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 1e-104
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 1e-103
2hq6_A185 Serologically defined colon cancer antigen 10; pro 1e-103
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 1e-102
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-101
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 1e-101
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 1e-101
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 1e-97
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 2e-85
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 5e-65
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 1e-64
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 1e-64
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 1e-64
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 3e-64
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 4e-63
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 8e-63
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 8e-63
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 3e-62
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 3e-61
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 7e-61
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 9e-61
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 2e-60
1z81_A229 Cyclophilin; structural genomics, structural genom 8e-60
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 9e-60
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 3e-59
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 5e-59
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 6e-59
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 8e-59
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 2e-58
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 3e-58
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 6e-58
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 2e-46
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
 Score =  301 bits (774), Expect = e-107
 Identities = 109/160 (68%), Positives = 126/160 (78%), Gaps = 1/160 (0%)

Query: 1   MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTG 60
           MSVTLHT++GDIK E+ C+  PKT ENFLALCAS YY+G IFHRNIKGFM+Q GDPTGTG
Sbjct: 1   MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTG 60

Query: 61  KGGTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGR 120
           +GG SIWGKKF DE  E LKHN RG++SMAN+GPNTNGSQFFI+Y KQPHL+  YTVFG+
Sbjct: 61  RGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGK 120

Query: 121 VIHGFEVLDLMEKAQTGSG-DRPLAEIRINRVTIHANPLA 159
           VI G E LD +EK        RPL ++ I  +TIHANP A
Sbjct: 121 VIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA 160
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
2nnz_A153 Hypothetical protein; beta-barrel, structural geno 97.08
1zx8_A136 Hypothetical protein TM1367; structural genomics, 96.17
3kop_A188 Uncharacterized protein; protein with A cyclophili 95.25
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
Probab=100.00  E-value=9.2e-58  Score=329.96  Aligned_cols=159  Identities=69%  Similarity=1.163  Sum_probs=155.0

Q ss_pred             CEEEEEecCeeEEEEECCCCChHHHHHHHHHHhcCCcCCcEEEEeecCcEEEeccCCCCCCCCcccCCCccCccccccCC
Q 031385            1 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLK   80 (160)
Q Consensus         1 m~v~~~T~~G~i~ieL~~~~aP~~~~nF~~l~~~~~y~g~~~~ri~~~~~i~~G~~~~~~~~~~~~~~~~~~~e~~~~~~   80 (160)
                      |+|+|+|+.|+|+||||+++||+||+||++||+++||+|+.|||++|++++|+|++.+++.++.++++.++++|..+.++
T Consensus         1 m~v~~~T~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~fhRvi~~f~iQgGd~~~~g~gg~si~g~~~~dE~~~~l~   80 (161)
T 2ok3_A            1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK   80 (161)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCCTTCC
T ss_pred             CEEEEEeCCccEEEEEcCCCCcHHHHHHHHHhhhcccCCCEEEEEECCCEEecCCCCCCCCCCCcccCCccccccCcCcC
Confidence            99999999999999999999999999999999999999999999999999999999988888899999999999887899


Q ss_pred             CCceeEEEEecCCCCCCCceEEEecCCCCCCCCCceEEEEEecCHHHHHHhhhCcCCCC-CCcccceEEEEEEEecCCCC
Q 031385           81 HNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSG-DRPLAEIRINRVTIHANPLA  159 (160)
Q Consensus        81 ~~~~G~v~~~~~~~~~~~s~F~I~l~~~~~ld~~~~vfG~Vv~G~~vl~~I~~~~~~~~-~~p~~~v~I~~~~i~~~pf~  159 (160)
                      |+++|+||||+.++++++|||||+++++|+||++|+|||+|++||+||++|++.+++++ ++|.++|+|.+|+|+.|||+
T Consensus        81 h~~~G~lsma~~gp~s~~SQFfI~~~~~~~Ldg~~tvFG~Vv~G~dvv~~I~~~~~~~~~~~P~~~v~I~~~~i~~~Pf~  160 (161)
T 2ok3_A           81 HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA  160 (161)
T ss_dssp             SCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTCCBCTTTCCBSSCCBEEEEEEECCSCC
T ss_pred             cCCCeEEEEecCCCCCcceEEEEEcCCCCccCCCEeEEEEEeCCHHHHHHHHhCCccCCCCCcCCCeEEEEEEEecCCCC
Confidence            99999999999999999999999999999999999999999999999999999999887 99999999999999999997
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} Back     alignment and structure
>1zx8_A Hypothetical protein TM1367; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: 1PE; 1.90A {Thermotoga maritima} SCOP: b.62.1.3 PDB: 2ka0_A Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 160
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 3e-62
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 7e-58
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 5e-56
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 3e-48
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 8e-47
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-45
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 7e-44
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 7e-41
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 2e-40
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 9e-39
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-38
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 7e-38
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 2e-37
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 3e-37
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 4e-37
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 5e-37
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 6e-37
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 5e-34
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 6e-34
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-32
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 6e-32
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 9e-31
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  187 bits (476), Expect = 3e-62
 Identities = 90/156 (57%), Positives = 111/156 (71%), Gaps = 1/156 (0%)

Query: 3   VTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKG 62
           V LHTN GD+  E+ CD  PKT ENF+ LC   YYDGTIFHR+I+ F+IQGGDPTGTG G
Sbjct: 3   VRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTG 62

Query: 63  GTSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVI 122
           G S WGK F DE R +L H  RGILSMANSGPN+N SQFFI++    +L+  +T+FGRV+
Sbjct: 63  GESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVV 122

Query: 123 HGFEVLDLMEKAQTGS-GDRPLAEIRINRVTIHANP 157
            GF+VL  ME  ++    DRP  EIRI+  T+  +P
Sbjct: 123 GGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDP 158
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1zx8a1124 Hypothetical protein TM1367 {Thermotoga maritima [ 96.64
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin-like protein PPIL3B
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.5e-54  Score=308.49  Aligned_cols=158  Identities=68%  Similarity=1.166  Sum_probs=150.8

Q ss_pred             CEEEEEecCeeEEEEECCCCChHHHHHHHHHHhcCCcCCcEEEEeecCcEEEeccCCCCCCCCcccCCCccCccccccCC
Q 031385            1 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLK   80 (160)
Q Consensus         1 m~v~~~T~~G~i~ieL~~~~aP~~~~nF~~l~~~~~y~g~~~~ri~~~~~i~~G~~~~~~~~~~~~~~~~~~~e~~~~~~   80 (160)
                      |||+|+|+.|+|+||||++.||++|+||++||++++|+|+.|||+.+++++|+|++.....++...++..++.|..+.++
T Consensus         1 msV~~~T~~G~i~ieL~~~~aP~tv~nF~~L~~~g~Y~~~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~e~~~~~~   80 (159)
T d2ok3a1           1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK   80 (159)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCCTTCC
T ss_pred             CEEEEEeCCeEEEEEEcCCCChHHHHHHHHHHhhhcccceeEecccCCeEEEeCCccccCCCCcccCCCccccccccCCC
Confidence            99999999999999999999999999999999999999999999999999999999877777777788888888888899


Q ss_pred             CCceeEEEEecCCCCCCCceEEEecCCCCCCCCCceEEEEEecCHHHHHHhhhCcCCC-CCCcccceEEEEEEEecCCC
Q 031385           81 HNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGS-GDRPLAEIRINRVTIHANPL  158 (160)
Q Consensus        81 ~~~~G~v~~~~~~~~~~~s~F~I~l~~~~~ld~~~~vfG~Vv~G~~vl~~I~~~~~~~-~~~p~~~v~I~~~~i~~~pf  158 (160)
                      |+++|+|||++.++++++|||||++++.|++|++|+|||+|++||++|++|++.++++ +++|.++|+|.+|+|+.|||
T Consensus        81 ~~~~G~lsma~~~~~s~~sqFfIt~~~~p~ld~~~tvFG~V~~G~~vl~~I~~~~~~~~~~~P~~~i~I~~v~i~~~Pf  159 (159)
T d2ok3a1          81 HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF  159 (159)
T ss_dssp             SCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTCCBCTTTCCBSSCCBEEEEEEECCSC
T ss_pred             CCCCeEEEEeeCCCCCcCcceEeeeccCcccccceEEEEecccchHHHHHHHcCcCCCCCCCcCCCcEEEEEEEEeCCC
Confidence            9999999999999999999999999999999999999999999999999999999876 47899999999999999999
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1zx8a1 b.62.1.3 (A:1-124) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure