Citrus Sinensis ID: 031483

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKLGIKDQTRGVGDSPSLTQSQKIQPITDQNANAIIDPCDENTKSYSIDNGTQKAVNVSGSSTQESNTTDESFINSLWNSCDDDLDLGTFFTMKGFVDGYSLI
ccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccc
cHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHcccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEc
mnylspnvnrgnfteeEDDLIIRLHKLLGNRWALIAkrvpgrtdnqvknYWNShlskklgikdqtrgvgdspsltqsqkiqpitdqnanaiidpcdentksysidngtqkavnvsgsstqesnttdESFINSLwnscdddldlgtfftmkgfvdgysli
mnylspnvnrgnfteeEDDLIIRLHKLLGNRWALIakrvpgrtdnqvkNYWNShlskklgikdqTRGVGDSpsltqsqkiqpitdqNANAIIDPCDENTKSYSIDNGTQKAVNVSGSSTQESNTTDESFINSLWNSCDDDLDLGTFFTMkgfvdgysli
MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKLGIKDQTRGVGDSPSLTQSQKIQPITDQNANAIIDPCDENTKSYSIDNGTQKAVNVSGSSTQESNTTDESFINSLWNSCDDDLDLGTFFTMKGFVDGYSLI
*****************DDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLS************************************************************************FINSLWNSCDDDLDLGTFFTMKGFVDGY***
MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHL******************************************************************************WNSCDDDLDLGTFFTMKGFVDGYSLI
MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKLGIKD**************QKIQPITDQNANAIIDPCDENTKSYSIDNGTQKA**************DESFINSLWNSCDDDLDLGTFFTMKGFVDGYSLI
MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKLGI**************************************************************************SCDDDLDLGTFFTMKGFVDGYSLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKLGIKDQTRGVGDSPSLTQSQKIQPITDQNANAIIDPCDENTKSYSIDNGTQKAVNVSGSSTQESNTTDESFINSLWNSCDDDLDLGTFFTMKGFVDGYSLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
Q9SEI0203 Transcription factor WER yes no 0.893 0.699 0.493 8e-34
Q96276219 Transcription factor MYB2 no no 0.949 0.689 0.479 2e-31
Q947R4223 Trichome differentiation no no 0.918 0.654 0.468 4e-28
P27900228 Trichome differentiation no no 0.371 0.258 0.915 2e-27
Q9SZP1282 Transcription repressor M no no 0.698 0.393 0.418 1e-22
Q9S9K9257 Transcription factor MYB3 no no 0.522 0.322 0.556 2e-22
Q38851236 Transcription repressor M no no 0.704 0.474 0.461 2e-22
Q38850249 Transcription repressor M no no 0.408 0.261 0.676 7e-22
P81393232 Myb-related protein 308 O N/A no 0.547 0.375 0.557 8e-22
P81395274 Myb-related protein 330 O N/A no 0.408 0.237 0.632 6e-21
>sp|Q9SEI0|WER_ARATH Transcription factor WER OS=Arabidopsis thaliana GN=WER PE=1 SV=1 Back     alignment and function desciption
 Score =  142 bits (358), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 96/158 (60%), Gaps = 16/158 (10%)

Query: 1   MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKLG 60
           MNYLSPNV RGNFTE+E+DLIIRLHKLLGNRW+LIAKRVPGRTDNQVKNYWN+HLSKKLG
Sbjct: 62  MNYLSPNVKRGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLG 121

Query: 61  IKDQTRGVGDSPSLTQSQKIQPITDQNANAIIDPCDENTKSYSIDNGTQKAVNVSGSSTQ 120
           IKDQ     +   + Q     P        I +  D N              N+ G   Q
Sbjct: 122 IKDQKTKQSNGDIVYQINLPNPTETSEETKISNIVDNN--------------NILGDEIQ 167

Query: 121 ESNTTDESFINSLWNSCDDDLDLGTFFTMKGFVDGYSL 158
           E +    ++++SLW   +D+ +L T   M  F+DG+  
Sbjct: 168 EDHQGS-NYLSSLW-VHEDEFELSTLTNMMDFIDGHCF 203
Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC.
Arabidopsis thaliana (taxid: 3702)
>sp|Q96276|MYB23_ARATH Transcription factor MYB23 OS=Arabidopsis thaliana GN=MYB23 PE=1 SV=1 Back     alignment and function description
>sp|Q947R4|GL1_ARALY Trichome differentiation protein GL1 OS=Arabidopsis lyrata GN=GL1 PE=3 SV=2 Back     alignment and function description
>sp|P27900|GL1_ARATH Trichome differentiation protein GL1 OS=Arabidopsis thaliana GN=GL1 PE=1 SV=2 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
15241488203 transcription factor WER [Arabidopsis th 0.893 0.699 0.493 4e-32
49182289219 myb family transcription factor 109 [Gos 0.955 0.694 0.493 6e-31
297811609203 hypothetical protein ARALYDRAFT_488320 [ 0.893 0.699 0.487 1e-30
34451908218 MYB family transcription factor [Gossypi 0.955 0.697 0.487 2e-30
38091116234 transcription factor myb109 [Gossypium h 0.918 0.623 0.5 2e-30
15242649219 transcription factor MYB23 [Arabidopsis 0.949 0.689 0.479 1e-29
20514371193 werewolf [Cucumis sativus] 0.867 0.715 0.487 1e-29
296087662238 unnamed protein product [Vitis vinifera] 0.930 0.621 0.469 4e-29
326631148197 MYB domain protein 66 [Brassica rapa sub 0.861 0.695 0.481 2e-28
359491528216 PREDICTED: transcription factor WER-like 0.930 0.685 0.497 6e-28
>gi|15241488|ref|NP_196979.1| transcription factor WER [Arabidopsis thaliana] gi|75337113|sp|Q9SEI0.1|WER_ARATH RecName: Full=Transcription factor WER; AltName: Full=Myb-related protein 66; Short=AtMYB66; AltName: Full=Protein WEREWOLF gi|6601337|gb|AAF18939.1|AF126399_1 werewolf [Arabidopsis thaliana] gi|9755743|emb|CAC01874.1| myb transcription factor werewolf (WER)/ MYB66 [Arabidopsis thaliana] gi|41619396|gb|AAS10093.1| MYB transcription factor [Arabidopsis thaliana] gi|111074160|gb|ABH04453.1| At5g14750 [Arabidopsis thaliana] gi|225898913|dbj|BAH30587.1| hypothetical protein [Arabidopsis thaliana] gi|332004690|gb|AED92073.1| transcription factor WER [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 96/158 (60%), Gaps = 16/158 (10%)

Query: 1   MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKLG 60
           MNYLSPNV RGNFTE+E+DLIIRLHKLLGNRW+LIAKRVPGRTDNQVKNYWN+HLSKKLG
Sbjct: 62  MNYLSPNVKRGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLG 121

Query: 61  IKDQTRGVGDSPSLTQSQKIQPITDQNANAIIDPCDENTKSYSIDNGTQKAVNVSGSSTQ 120
           IKDQ     +   + Q     P        I +  D N              N+ G   Q
Sbjct: 122 IKDQKTKQSNGDIVYQINLPNPTETSEETKISNIVDNN--------------NILGDEIQ 167

Query: 121 ESNTTDESFINSLWNSCDDDLDLGTFFTMKGFVDGYSL 158
           E +    ++++SLW   +D+ +L T   M  F+DG+  
Sbjct: 168 EDHQGS-NYLSSLW-VHEDEFELSTLTNMMDFIDGHCF 203

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|49182289|gb|AAT57644.1| myb family transcription factor 109 [Gossypium arboreum] Back     alignment and taxonomy information
>gi|297811609|ref|XP_002873688.1| hypothetical protein ARALYDRAFT_488320 [Arabidopsis lyrata subsp. lyrata] gi|297319525|gb|EFH49947.1| hypothetical protein ARALYDRAFT_488320 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|34451908|gb|AAQ72433.1| MYB family transcription factor [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|38091116|emb|CAD71140.1| transcription factor myb109 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|15242649|ref|NP_198849.1| transcription factor MYB23 [Arabidopsis thaliana] gi|75332916|sp|Q96276.1|MYB23_ARATH RecName: Full=Transcription factor MYB23; AltName: Full=Myb-related protein 23; Short=AtMYB23 gi|1495253|emb|CAA92281.1| myb-related protein [Arabidopsis thaliana] gi|10178143|dbj|BAB11588.1| Myb-related protein [Arabidopsis thaliana] gi|41619432|gb|AAS10101.1| MYB transcription factor [Arabidopsis thaliana] gi|94442501|gb|ABF19038.1| At5g40330 [Arabidopsis thaliana] gi|332007151|gb|AED94534.1| transcription factor MYB23 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|20514371|gb|AAM23006.1| werewolf [Cucumis sativus] Back     alignment and taxonomy information
>gi|296087662|emb|CBI34918.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|326631148|gb|ADZ98866.1| MYB domain protein 66 [Brassica rapa subsp. rapa] Back     alignment and taxonomy information
>gi|359491528|ref|XP_002279128.2| PREDICTED: transcription factor WER-like [Vitis vinifera] gi|297733776|emb|CBI15023.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
TAIR|locus:2185470203 MYB66 "myb domain protein 66" 0.874 0.684 0.522 9.5e-34
TAIR|locus:2170553219 MYB23 "myb domain protein 23" 0.949 0.689 0.479 1.3e-31
TAIR|locus:2086475228 MYB0 "myb domain protein 0" [A 0.930 0.649 0.482 1.9e-28
TAIR|locus:2133677236 MYB6 "myb domain protein 6" [A 0.911 0.614 0.419 2.6e-24
TAIR|locus:2092820249 MYB5 "myb domain protein 5" [A 0.874 0.558 0.409 6.1e-23
TAIR|locus:2121259282 MYB4 "myb domain protein 4" [A 0.886 0.5 0.406 6.1e-23
TAIR|locus:2009452257 MYB3 "myb domain protein 3" [A 0.522 0.322 0.556 1.6e-22
TAIR|locus:2059883269 MYB7 "myb domain protein 7" [A 0.534 0.315 0.533 1.9e-21
TAIR|locus:2131576274 MYB32 "myb domain protein 32" 0.716 0.416 0.45 2.4e-21
TAIR|locus:2139144286 MYB42 "myb domain protein 42" 0.792 0.440 0.401 3e-21
TAIR|locus:2185470 MYB66 "myb domain protein 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 9.5e-34, P = 9.5e-34
 Identities = 82/157 (52%), Positives = 102/157 (64%)

Query:     1 MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKLG 60
             MNYLSPNV RGNFTE+E+DLIIRLHKLLGNRW+LIAKRVPGRTDNQVKNYWN+HLSKKLG
Sbjct:    62 MNYLSPNVKRGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLG 121

Query:    61 IKDQTRGVGDSPSLTQSQKIQPITDQNANAIIDPCDENTK-SYSIDNGTQKAVNVSGSST 119
             IKDQ     +   + Q     P T+ +         E TK S  +DN      N+ G   
Sbjct:   122 IKDQKTKQSNGDIVYQINLPNP-TETS---------EETKISNIVDNN-----NILGDEI 166

Query:   120 QESNTTDESFINSLWNSCDDDLDLGTFFTMKGFVDGY 156
             QE +    ++++SLW   +D+ +L T   M  F+DG+
Sbjct:   167 QEDHQ-GSNYLSSLWVH-EDEFELSTLTNMMDFIDGH 201
GO:0003677 "DNA binding" evidence=IEA;ISS;IPI
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0045165 "cell fate commitment" evidence=IMP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0048765 "root hair cell differentiation" evidence=IMP
GO:0001708 "cell fate specification" evidence=RCA
GO:0009913 "epidermal cell differentiation" evidence=RCA
TAIR|locus:2170553 MYB23 "myb domain protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086475 MYB0 "myb domain protein 0" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092820 MYB5 "myb domain protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131576 MYB32 "myb domain protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139144 MYB42 "myb domain protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 3e-27
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 8e-20
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-19
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 6e-17
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 9e-16
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 2e-10
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 8e-10
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 8e-08
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  102 bits (254), Expect = 3e-27
 Identities = 62/157 (39%), Positives = 89/157 (56%), Gaps = 26/157 (16%)

Query: 1   MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKL- 59
           MNYL P+V RG  T +E+DLI+RLH+LLGNRW+LIA R+PGRTDN++KNYWN+HL KKL 
Sbjct: 69  MNYLRPSVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLL 128

Query: 60  --GIKDQTRGVGDSPSLTQSQK---------IQPITDQNANAIIDPCDENTKSYSIDNGT 108
             GI  QT    D+ ++ + ++         I+PI+  +         ++T     D  +
Sbjct: 129 RQGIDPQTHKPLDANNIHKPEEEVSGGQKYPIEPISSSHT--------DDTTVNGGDGDS 180

Query: 109 QKAVNVSGSSTQES------NTTDESFINSLWNSCDD 139
           + ++NV G            +    SF+NSL N   D
Sbjct: 181 KNSINVFGGEHGYEDFGFCYDDKFSSFLNSLINDDAD 217

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.83
PLN03212249 Transcription repressor MYB5; Provisional 99.82
PLN03091 459 hypothetical protein; Provisional 99.72
PLN03212249 Transcription repressor MYB5; Provisional 99.68
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.65
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.63
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.61
PLN03091 459 hypothetical protein; Provisional 99.58
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.47
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.36
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.29
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.6
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.53
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.48
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.44
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.39
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.17
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.09
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.91
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.71
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.56
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.35
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.25
KOG1279 506 consensus Chromatin remodeling factor subunit and 97.2
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.68
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.5
PRK13923170 putative spore coat protein regulator protein YlbO 96.49
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 96.13
KOG0051607 consensus RNA polymerase I termination factor, Myb 95.72
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 95.14
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 94.31
PLN031421033 Probable chromatin-remodeling complex ATPase chain 93.33
KOG2656 445 consensus DNA methyltransferase 1-associated prote 92.95
KOG4282 345 consensus Transcription factor GT-2 and related pr 91.86
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 91.14
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 90.58
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 90.02
KOG1194 534 consensus Predicted DNA-binding protein, contains 84.44
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 80.01
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information 
Probab=99.83  E-value=4.5e-21  Score=156.85  Aligned_cols=61  Identities=69%  Similarity=1.200  Sum_probs=58.8

Q ss_pred             CCcCCCCCCCCCCCHHHHHHHHHHHHHhCCCchhhhhcCCCCCHHHHHHHHHHhhccccCC
Q 031483            1 MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKLGI   61 (159)
Q Consensus         1 ~NyL~P~lkk~~WT~eED~~L~~lv~~~G~~W~~Ia~~lpgRT~~q~knRw~~~l~~~~~~   61 (159)
                      +|||+|+|+||.||+|||++|+++|..+|++|+.||++|||||+|.|||+|+..|++++..
T Consensus        53 ~NyLrP~ikrg~fT~eEe~~Ii~lH~~~GNrWs~IA~~LPGRTDNeIKN~Wnt~lkkkl~~  113 (238)
T KOG0048|consen   53 TNYLRPDLKRGNFSDEEEDLIIKLHALLGNRWSLIAGRLPGRTDNEVKNHWNTHLKKKLLK  113 (238)
T ss_pred             hcccCCCccCCCCCHHHHHHHHHHHHHHCcHHHHHHhhCCCcCHHHHHHHHHHHHHHHHHH
Confidence            6999999999999999999999999999999999999999999999999999999998743

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 2e-15
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 6e-15
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 1e-14
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 1e-14
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 1e-14
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 1e-12
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 3e-12
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 1e-11
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 9e-10
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 5e-05
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 7e-05
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 3e-04
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/58 (58%), Positives = 46/58 (79%)
Query: 2   NYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKL 59
           N+L+P V + ++TEEED +I   HK+LGNRWA IAK +PGRTDN VKN+WNS + +K+
Sbjct: 51  NHLNPEVKKSSWTEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKV 108
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 5e-38
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 8e-05
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 5e-37
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 9e-05
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 7e-37
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 6e-12
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 5e-34
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 4e-10
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 4e-33
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 4e-09
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-31
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-13
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-08
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-12
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 1e-12
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-12
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 7e-11
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 3e-09
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-08
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 4e-07
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 4e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 6e-07
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 2e-06
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 7e-06
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 2e-05
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 3e-05
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 3e-05
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 6e-05
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 2e-04
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 5e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  125 bits (316), Expect = 5e-38
 Identities = 29/59 (49%), Positives = 43/59 (72%)

Query: 1   MNYLSPNVNRGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLSKKL 59
            N+L P V +  +T EED+ I R +  LG++W++IAK +PGRTDN +KN WNS +SK++
Sbjct: 45  FNHLDPAVVKHAWTPEEDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRI 103
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.86
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.85
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.85
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.83
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.82
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.82
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.81
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.8
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.8
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.8
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.79
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.79
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.79
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.78
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.77
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.76
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.76
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.76
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.76
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.74
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.73
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.73
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.72
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.57
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.72
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.71
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.62
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.59
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.59
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.58
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.53
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.52
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.51
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.5
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.44
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.28
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.11
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.05
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.04
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.93
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.79
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.55
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.54
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.91
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.38
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.12
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.12
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.11
2crg_A70 Metastasis associated protein MTA3; transcription 98.07
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.86
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.54
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 96.44
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.14
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 96.14
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.11
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.04
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 94.39
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.73
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 92.28
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 92.11
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 81.75
2li6_A116 SWI/SNF chromatin-remodeling complex subunit SWI1; 81.58
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.86  E-value=6.6e-22  Score=132.68  Aligned_cols=66  Identities=20%  Similarity=0.358  Sum_probs=60.9

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHhC-CCchhhhhcCCCCCHHHHHHHHHHhhccccCCCccCCCCCCCCCccccCCCCC
Q 031483            4 LSPNVNRGNFTEEEDDLIIRLHKLLG-NRWALIAKRVPGRTDNQVKNYWNSHLSKKLGIKDQTRGVGDSPSLTQSQKIQP   82 (159)
Q Consensus         4 L~P~lkk~~WT~eED~~L~~lv~~~G-~~W~~Ia~~lpgRT~~q~knRw~~~l~~~~~~~~~~~~~~~s~~~~~~~~~~~   82 (159)
                      -.|.+++++||+|||++|+++|.+|| ++|..||.+|||||+.||++||+++|++.+                   ++.+
T Consensus         3 s~~~~k~~~Wt~eED~~L~~~v~~~G~~~W~~Ia~~l~~Rt~~qcr~Rw~~~L~p~i-------------------~~~~   63 (70)
T 2dim_A            3 SGSSGKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSI-------------------KKTE   63 (70)
T ss_dssp             SCSCSTTCCCCHHHHHHHHHHHHHTCSSCHHHHHHHSTTCCHHHHHHHHHHTSCSSS-------------------CCCC
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCcCCHHHHHHHhcCCCHHHHHHHHHHHcCCcc-------------------cCCC
Confidence            36899999999999999999999999 799999999999999999999999999999                   5677


Q ss_pred             CChhhh
Q 031483           83 ITDQNA   88 (159)
Q Consensus        83 ~t~~e~   88 (159)
                      ||.+|+
T Consensus        64 wt~eEd   69 (70)
T 2dim_A           64 WSGPSS   69 (70)
T ss_dssp             SCCSCC
T ss_pred             CChHhc
Confidence            777765
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2li6_A SWI/SNF chromatin-remodeling complex subunit SWI1; ligand binding, DNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 159
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-18
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 1e-16
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-15
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-15
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-14
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-14
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-14
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-11
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-10
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-08
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-08
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-08
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 7e-08
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 4e-06
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 72.2 bits (177), Expect = 1e-18
 Identities = 28/46 (60%), Positives = 37/46 (80%)

Query: 10 RGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHL 55
          + ++TEEED +I + HK LGNRWA IAK +PGRTDN +KN+WNS +
Sbjct: 1  KTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTM 46
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.83
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.82
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.8
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.77
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.69
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.68
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.65
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.59
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.58
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.52
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.49
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.48
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.43
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.43
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.51
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.38
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.76
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.49
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.69
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 96.67
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 93.99
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 92.23
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.83  E-value=2.4e-21  Score=119.69  Aligned_cols=47  Identities=60%  Similarity=0.988  Sum_probs=45.4

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCCchhhhhcCCCCCHHHHHHHHHHhhc
Q 031483           10 RGNFTEEEDDLIIRLHKLLGNRWALIAKRVPGRTDNQVKNYWNSHLS   56 (159)
Q Consensus        10 k~~WT~eED~~L~~lv~~~G~~W~~Ia~~lpgRT~~q~knRw~~~l~   56 (159)
                      |++||+|||++|+++|++||++|+.||++|||||++|||+||+.++|
T Consensus         1 K~~WT~eED~~L~~~v~~~G~~W~~Ia~~~~gRt~~~~knr~~~~lr   47 (47)
T d1gv2a2           1 KTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR   47 (47)
T ss_dssp             CCCCCHHHHHHHHHHHHHHSSCHHHHHTTCTTCCHHHHHHHHHHHTC
T ss_pred             CCCCCHHHHHHHHHHHHHHhhHHHHHHhHcCCCCHHHHHHHHHHHcC
Confidence            57999999999999999999999999999999999999999999875
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure