Citrus Sinensis ID: 031506
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 158 | ||||||
| 356495346 | 203 | PREDICTED: methyltransferase-like protei | 0.765 | 0.596 | 0.701 | 4e-46 | |
| 255580627 | 238 | conserved hypothetical protein [Ricinus | 0.753 | 0.5 | 0.708 | 2e-44 | |
| 449434120 | 242 | PREDICTED: methyltransferase-like protei | 0.746 | 0.487 | 0.686 | 2e-44 | |
| 356540836 | 212 | PREDICTED: methyltransferase-like protei | 0.727 | 0.542 | 0.720 | 4e-44 | |
| 449517136 | 242 | PREDICTED: methyltransferase-like protei | 0.746 | 0.487 | 0.677 | 5e-44 | |
| 225431332 | 236 | PREDICTED: methyltransferase-like protei | 0.759 | 0.508 | 0.672 | 4e-42 | |
| 357483907 | 212 | hypothetical protein MTR_5g022860 [Medic | 0.759 | 0.566 | 0.639 | 4e-40 | |
| 297836997 | 194 | predicted protein [Arabidopsis lyrata su | 0.670 | 0.546 | 0.728 | 2e-39 | |
| 42571989 | 196 | Putative methyltransferase family protei | 0.702 | 0.566 | 0.687 | 7e-37 | |
| 30696907 | 159 | Putative methyltransferase family protei | 0.702 | 0.698 | 0.687 | 1e-36 |
| >gi|356495346|ref|XP_003516539.1| PREDICTED: methyltransferase-like protein 23-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 189 bits (479), Expect = 4e-46, Method: Compositional matrix adjust.
Identities = 87/124 (70%), Positives = 106/124 (85%), Gaps = 3/124 (2%)
Query: 1 MRDVGSDKDEDEMTDKHMTTVSQHYFVDESDKPSFSIAIIENMKEEYGLFVWPCSVILAE 60
M D ++ +D +T MTTVSQH+F D+S+ PSFSI+IIENMKE+YGLFVWPCSV+LAE
Sbjct: 1 MEDWNDEQCDDTLT---MTTVSQHFFGDDSETPSFSISIIENMKEDYGLFVWPCSVVLAE 57
Query: 61 YVWQQRYRFSGANVVELGAGTSLPGLVAAKVGSNVTLTDDSNRIEVLKNMRRVCEMNKLN 120
Y+WQ ++RFSGA VVELGAGTSLPGLVAAK+G+ VTLTDDS R+EVL NMRRVC++NKL
Sbjct: 58 YIWQHKHRFSGATVVELGAGTSLPGLVAAKLGARVTLTDDSTRLEVLDNMRRVCDLNKLE 117
Query: 121 CRLL 124
C +L
Sbjct: 118 CNVL 121
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255580627|ref|XP_002531136.1| conserved hypothetical protein [Ricinus communis] gi|223529249|gb|EEF31221.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449434120|ref|XP_004134844.1| PREDICTED: methyltransferase-like protein 23-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356540836|ref|XP_003538890.1| PREDICTED: methyltransferase-like protein 23-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449517136|ref|XP_004165602.1| PREDICTED: methyltransferase-like protein 23-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225431332|ref|XP_002277720.1| PREDICTED: methyltransferase-like protein 23 [Vitis vinifera] gi|296084695|emb|CBI25837.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357483907|ref|XP_003612240.1| hypothetical protein MTR_5g022860 [Medicago truncatula] gi|355513575|gb|AES95198.1| hypothetical protein MTR_5g022860 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297836997|ref|XP_002886380.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297332221|gb|EFH62639.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42571989|ref|NP_974085.1| Putative methyltransferase family protein [Arabidopsis thaliana] gi|332196036|gb|AEE34157.1| Putative methyltransferase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|30696907|ref|NP_850970.1| Putative methyltransferase family protein [Arabidopsis thaliana] gi|26452591|dbj|BAC43379.1| unknown protein [Arabidopsis thaliana] gi|117958334|gb|ABK59663.1| At1g63855 [Arabidopsis thaliana] gi|332196037|gb|AEE34158.1| Putative methyltransferase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 158 | ||||||
| TAIR|locus:504956172 | 196 | AT1G63855 "AT1G63855" [Arabido | 0.664 | 0.535 | 0.716 | 3.9e-37 | |
| MGI|MGI:1921569 | 253 | Mettl23 "methyltransferase lik | 0.702 | 0.438 | 0.366 | 1.8e-16 | |
| RGD|1306284 | 225 | Mettl23 "methyltransferase lik | 0.683 | 0.48 | 0.366 | 9.8e-16 | |
| UNIPROTKB|Q86XA0 | 190 | METTL23 "Methyltransferase-lik | 0.531 | 0.442 | 0.435 | 5.4e-15 | |
| ZFIN|ZDB-GENE-060825-19 | 223 | mettl21d "methyltransferase li | 0.620 | 0.439 | 0.347 | 5.8e-11 | |
| UNIPROTKB|A4FV42 | 218 | METTL21A "Protein-lysine methy | 0.373 | 0.270 | 0.457 | 1.2e-08 | |
| RGD|1311824 | 218 | Mettl21a "methyltransferase li | 0.373 | 0.270 | 0.423 | 3.5e-08 | |
| UNIPROTKB|A6QP81 | 257 | METTL21C "Protein-lysine methy | 0.506 | 0.311 | 0.352 | 3.9e-08 | |
| MGI|MGI:2685837 | 244 | Mettl21e "methyltransferase li | 0.531 | 0.344 | 0.351 | 4.2e-08 | |
| UNIPROTKB|Q8WXB1 | 218 | METTL21A "Protein-lysine methy | 0.373 | 0.270 | 0.423 | 4.6e-08 |
| TAIR|locus:504956172 AT1G63855 "AT1G63855" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 399 (145.5 bits), Expect = 3.9e-37, P = 3.9e-37
Identities = 76/106 (71%), Positives = 89/106 (83%)
Query: 19 TTVSQHYFVDESDKPSFSIAIIENMKEEYGLFVWPCSVILAEYVWQQRYRFSGANVVELG 78
TT+SQH F D + I+IIEN+KEEYGLFVWPCSVILAEYVWQ R RF ++++ELG
Sbjct: 7 TTISQHNFYGAGDSET-CISIIENLKEEYGLFVWPCSVILAEYVWQHRSRFRDSSILELG 65
Query: 79 AGTSLPGLVAAKVGSNVTLTDDSNRIEVLKNMRRVCEMNKLNCRLL 124
AGTSLPGLVAAKVG+NVTLTDD+ + EVL NMRRVCE+NKLNC +L
Sbjct: 66 AGTSLPGLVAAKVGANVTLTDDATKPEVLDNMRRVCELNKLNCNVL 111
|
|
| MGI|MGI:1921569 Mettl23 "methyltransferase like 23" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1306284 Mettl23 "methyltransferase like 23" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86XA0 METTL23 "Methyltransferase-like protein 23" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060825-19 mettl21d "methyltransferase like 21D" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4FV42 METTL21A "Protein-lysine methyltransferase METTL21A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1311824 Mettl21a "methyltransferase like 21A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QP81 METTL21C "Protein-lysine methyltransferase METTL21C" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2685837 Mettl21e "methyltransferase like 21E" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WXB1 METTL21A "Protein-lysine methyltransferase METTL21A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| pfam10294 | 170 | pfam10294, Methyltransf_16, Putative methyltransfe | 4e-11 |
| >gnl|CDD|220679 pfam10294, Methyltransf_16, Putative methyltransferase | Back alignment and domain information |
|---|
Score = 57.7 bits (140), Expect = 4e-11
Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 6/83 (7%)
Query: 32 KPSFSIAIIENMKEEYGLFVWPCSVILAEYVWQ----QRYRFSGANVVELGAGTSLPGLV 87
S + I E+ G VW +V+L++Y+ SG NV+ELG+GT L G+
Sbjct: 2 LDSPELKIEEDTGNGIGGHVWDAAVVLSKYLEMKITPGGNNLSGLNVLELGSGTGLVGIA 61
Query: 88 AAKV--GSNVTLTDDSNRIEVLK 108
A + G++VT+TD IE++K
Sbjct: 62 VALLLPGASVTITDLEEAIELMK 84
|
Length = 170 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 99.94 | |
| COG3897 | 218 | Predicted methyltransferase [General function pred | 99.72 | |
| KOG3201 | 201 | consensus Uncharacterized conserved protein [Funct | 99.7 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 99.67 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 99.66 | |
| KOG2793 | 248 | consensus Putative N2,N2-dimethylguanosine tRNA me | 99.63 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 99.61 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 99.56 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 99.47 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 99.45 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 99.44 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 99.44 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 99.43 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 99.43 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 99.42 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 99.41 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 99.39 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 99.38 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 99.38 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 99.38 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 99.37 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 99.35 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 99.34 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 99.33 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 99.32 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 99.31 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 99.3 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 99.3 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 99.29 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 99.29 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 99.28 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 99.27 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 99.27 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 99.26 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 99.26 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 99.25 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 99.24 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 99.24 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 99.23 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 99.2 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 99.2 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 99.2 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 99.2 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 99.19 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 99.19 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 99.18 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 99.18 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 99.17 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 99.17 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 99.17 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.17 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 99.17 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 99.17 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 99.17 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 99.17 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 99.16 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 99.16 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 99.15 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 99.15 | |
| KOG1499 | 346 | consensus Protein arginine N-methyltransferase PRM | 99.15 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 99.14 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 99.14 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 99.14 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 99.13 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 99.13 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 99.12 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 99.12 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 99.11 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 99.1 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 99.1 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 99.1 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 99.09 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 99.09 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 99.09 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 99.07 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 99.06 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 99.06 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 99.06 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 99.04 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 99.03 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 99.02 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 99.02 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 99.01 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 99.0 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 99.0 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 99.0 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 99.0 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 98.99 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 98.99 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 98.99 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 98.99 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 98.99 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 98.98 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.98 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 98.97 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 98.97 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 98.97 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 98.97 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.95 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 98.94 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 98.94 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 98.94 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 98.93 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 98.93 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 98.92 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 98.91 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 98.91 | |
| KOG1500 | 517 | consensus Protein arginine N-methyltransferase CAR | 98.91 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 98.91 | |
| PRK04266 | 226 | fibrillarin; Provisional | 98.89 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 98.88 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 98.88 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 98.86 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 98.85 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 98.85 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 98.84 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 98.84 | |
| KOG2920 | 282 | consensus Predicted methyltransferase [General fun | 98.83 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 98.81 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 98.79 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 98.78 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 98.78 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.77 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 98.77 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 98.75 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 98.75 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 98.73 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 98.73 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 98.73 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 98.72 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 98.7 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 98.69 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 98.69 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 98.69 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 98.67 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 98.65 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 98.63 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 98.63 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 98.62 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 98.61 | |
| KOG3191 | 209 | consensus Predicted N6-DNA-methyltransferase [Tran | 98.6 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 98.59 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 98.58 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 98.58 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 98.58 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 98.58 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 98.57 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 98.54 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 98.54 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 98.53 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 98.53 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 98.51 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 98.49 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 98.49 | |
| PLN02476 | 278 | O-methyltransferase | 98.47 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 98.43 | |
| KOG3010 | 261 | consensus Methyltransferase [General function pred | 98.4 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 98.4 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 98.39 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 98.38 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 98.38 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 98.37 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 98.36 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 98.36 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 98.34 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 98.33 | |
| PF05971 | 299 | Methyltransf_10: Protein of unknown function (DUF8 | 98.32 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 98.3 | |
| KOG2187 | 534 | consensus tRNA uracil-5-methyltransferase and rela | 98.27 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 98.24 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 98.24 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 98.23 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 98.23 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 98.23 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 98.2 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 98.19 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 98.18 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 98.17 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 98.14 | |
| KOG0820 | 315 | consensus Ribosomal RNA adenine dimethylase [RNA p | 98.1 | |
| PLN02366 | 308 | spermidine synthase | 98.08 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 98.07 | |
| KOG2497 | 262 | consensus Predicted methyltransferase [General fun | 98.06 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 98.04 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 98.03 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 98.03 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 98.01 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 97.96 | |
| PF01861 | 243 | DUF43: Protein of unknown function DUF43; InterPro | 97.94 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 97.94 | |
| PRK11760 | 357 | putative 23S rRNA C2498 ribose 2'-O-ribose methylt | 97.92 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 97.89 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 97.85 | |
| PHA01634 | 156 | hypothetical protein | 97.79 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 97.79 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 97.76 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 97.67 | |
| PLN02823 | 336 | spermine synthase | 97.65 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 97.63 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 97.58 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 97.56 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 97.53 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 97.48 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 97.39 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 97.32 | |
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 97.25 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 97.25 | |
| COG0357 | 215 | GidB Predicted S-adenosylmethionine-dependent meth | 97.2 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 97.17 | |
| KOG1501 | 636 | consensus Arginine N-methyltransferase [General fu | 97.17 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 97.15 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 97.13 | |
| KOG3987 | 288 | consensus Uncharacterized conserved protein DREV/C | 97.1 | |
| KOG2671 | 421 | consensus Putative RNA methylase [Replication, rec | 97.09 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 97.04 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 97.04 | |
| PF04816 | 205 | DUF633: Family of unknown function (DUF633) ; Inte | 96.98 | |
| COG1189 | 245 | Predicted rRNA methylase [Translation, ribosomal s | 96.96 | |
| KOG1661 | 237 | consensus Protein-L-isoaspartate(D-aspartate) O-me | 96.91 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 96.86 | |
| KOG2940 | 325 | consensus Predicted methyltransferase [General fun | 96.84 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 96.8 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 96.62 | |
| COG3129 | 292 | Predicted SAM-dependent methyltransferase [General | 96.6 | |
| COG1568 | 354 | Predicted methyltransferases [General function pre | 96.57 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 96.55 | |
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 96.53 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 96.42 | |
| KOG1663 | 237 | consensus O-methyltransferase [Secondary metabolit | 96.37 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 96.33 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 96.25 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 96.24 | |
| KOG2078 | 495 | consensus tRNA modification enzyme [RNA processing | 96.15 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 95.98 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 95.86 | |
| KOG2915 | 314 | consensus tRNA(1-methyladenosine) methyltransferas | 95.79 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 95.65 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 95.64 | |
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 95.51 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 95.46 | |
| KOG1975 | 389 | consensus mRNA cap methyltransferase [RNA processi | 95.45 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 95.42 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 95.38 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 95.32 | |
| COG1867 | 380 | TRM1 N2,N2-dimethylguanosine tRNA methyltransferas | 95.29 | |
| KOG4058 | 199 | consensus Uncharacterized conserved protein [Funct | 94.94 | |
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 94.91 | |
| COG2384 | 226 | Predicted SAM-dependent methyltransferase [General | 94.86 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 94.7 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 94.67 | |
| PF04445 | 234 | SAM_MT: Putative SAM-dependent methyltransferase; | 94.6 | |
| PRK13699 | 227 | putative methylase; Provisional | 94.55 | |
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 94.52 | |
| PF01269 | 229 | Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr | 94.22 | |
| PF03686 | 127 | UPF0146: Uncharacterised protein family (UPF0146); | 94.19 | |
| COG1255 | 129 | Uncharacterized protein conserved in archaea [Func | 94.15 | |
| KOG1227 | 351 | consensus Putative methyltransferase [General func | 93.99 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 93.87 | |
| KOG1709 | 271 | consensus Guanidinoacetate methyltransferase and r | 93.75 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 93.72 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 93.68 | |
| COG0293 | 205 | FtsJ 23S rRNA methylase [Translation, ribosomal st | 93.03 | |
| PF07091 | 251 | FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: | 93.03 | |
| TIGR00006 | 305 | S-adenosyl-methyltransferase MraW. Genetics paper | 92.94 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 92.75 | |
| COG1565 | 370 | Uncharacterized conserved protein [Function unknow | 92.56 | |
| COG0286 | 489 | HsdM Type I restriction-modification system methyl | 91.78 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 91.58 | |
| KOG2912 | 419 | consensus Predicted DNA methylase [Function unknow | 91.52 | |
| PF11599 | 246 | AviRa: RRNA methyltransferase AviRa; InterPro: IPR | 90.92 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 90.9 | |
| PF01234 | 256 | NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I | 90.84 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 90.67 | |
| PF02636 | 252 | Methyltransf_28: Putative S-adenosyl-L-methionine- | 90.39 | |
| PF02086 | 260 | MethyltransfD12: D12 class N6 adenine-specific DNA | 90.33 | |
| KOG2651 | 476 | consensus rRNA adenine N-6-methyltransferase [RNA | 90.16 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 89.75 | |
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 89.11 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 88.85 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 88.71 | |
| KOG1269 | 364 | consensus SAM-dependent methyltransferases [Lipid | 87.86 | |
| KOG1253 | 525 | consensus tRNA methyltransferase [Translation, rib | 87.6 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 87.02 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 86.48 | |
| PF05206 | 259 | TRM13: Methyltransferase TRM13; InterPro: IPR00787 | 86.46 | |
| PF13578 | 106 | Methyltransf_24: Methyltransferase domain; PDB: 3S | 86.0 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 85.45 | |
| COG5459 | 484 | Predicted rRNA methylase [Translation, ribosomal s | 85.35 | |
| COG3392 | 330 | Adenine-specific DNA methylase [DNA replication, r | 84.92 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 84.76 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 84.46 | |
| PF10237 | 162 | N6-adenineMlase: Probable N6-adenine methyltransfe | 83.28 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 82.24 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 82.12 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 81.79 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 81.52 | |
| COG0863 | 302 | DNA modification methylase [DNA replication, recom | 81.25 | |
| KOG3115 | 249 | consensus Methyltransferase-like protein [General | 80.81 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 80.31 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 80.23 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 80.08 |
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
Probab=99.94 E-value=7.5e-27 Score=176.18 Aligned_cols=121 Identities=33% Similarity=0.473 Sum_probs=79.5
Q ss_pred ceEEEEeccCCCCCceEecchHHHHHHHHHhc------ccCCCCCeEEEeccCCCHHHHHHhhc--CCEEEEEecCChHH
Q 031506 34 SFSIAIIENMKEEYGLFVWPCSVILAEYVWQQ------RYRFSGANVVELGAGTSLPGLVAAKV--GSNVTLTDDSNRIE 105 (158)
Q Consensus 34 ~~~~~i~~~~~~~~g~~vW~~~~~la~~l~~~------~~~~~~~~vLELG~GtGl~~i~~a~~--g~~v~~tD~~~~~~ 105 (158)
..+|.|.|....++|.++||++.+|++|+.++ ...+++++|||||||+|++|+.+++. +.+|++||+++
T Consensus 3 ~~~l~i~e~~~~~~G~~vW~aa~~La~~l~~~~~~~~~~~~~~~~~VLELGaG~Gl~gi~~a~~~~~~~Vv~TD~~~--- 79 (173)
T PF10294_consen 3 NKTLQIEEDWGDGTGGKVWPAALVLARYLLSHSESEFNPELFRGKRVLELGAGTGLPGIAAAKLFGAARVVLTDYNE--- 79 (173)
T ss_dssp --------------------HHHHHHHHHHH-------GGGTTTSEEEETT-TTSHHHHHHHHT-T-SEEEEEE-S----
T ss_pred ccccccccccccCCcEEEechHHHHHHHHHHhcccccchhhcCCceEEEECCccchhHHHHHhccCCceEEEeccch---
Confidence 45689999988899999999999999999984 56778999999999999999999998 56999999986
Q ss_pred HHHHHHHHHHHcC----CcceEEEcCC------------CCcEEE-ecCCCCCccHHHHHHHHHHHhcC
Q 031506 106 VLKNMRRVCEMNK----LNCRLLMTSL------------PPSHIC-SRVLQDQSSLRLIIIEVGIILLS 157 (158)
Q Consensus 106 ~l~~~~~n~~~n~----~~~~~~~~d~------------~fD~Ii-~d~iy~~~~~~~ll~tl~~ll~~ 157 (158)
.+++++.|++.|+ .++.+...+| +||+|+ +||+|+.+.+++|++|+..++..
T Consensus 80 ~l~~l~~Ni~~N~~~~~~~v~v~~L~Wg~~~~~~~~~~~~~D~IlasDv~Y~~~~~~~L~~tl~~ll~~ 148 (173)
T PF10294_consen 80 VLELLRRNIELNGSLLDGRVSVRPLDWGDELDSDLLEPHSFDVILASDVLYDEELFEPLVRTLKRLLKP 148 (173)
T ss_dssp HHHHHHHHHHTT--------EEEE--TTS-HHHHHHS-SSBSEEEEES--S-GGGHHHHHHHHHHHBTT
T ss_pred hhHHHHHHHHhccccccccccCcEEEecCcccccccccccCCEEEEecccchHHHHHHHHHHHHHHhCC
Confidence 7999999999987 2345555554 699999 99999999999999999998864
|
They make up approximately 0.6-1.6% of the genes in the yeast, human, mouse, Drosophila melanogaster, Caenorhabditis elegans, Arabidopsis thaliana, and Escherichia coli genomes []. This entry represents putative nicotinamide N-methyltransferases involved in rDNA silencing and in lifespan determination. ; PDB: 3BZB_A. |
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3201 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2920 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >KOG3010 consensus Methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >KOG2497 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PHA01634 hypothetical protein | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >KOG1501 consensus Arginine N-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] | Back alignment and domain information |
|---|
| >KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2940 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1568 Predicted methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >KOG2078 consensus tRNA modification enzyme [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4058 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] | Back alignment and domain information |
|---|
| >PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown | Back alignment and domain information |
|---|
| >COG1255 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >KOG1227 consensus Putative methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A | Back alignment and domain information |
|---|
| >TIGR00006 S-adenosyl-methyltransferase MraW | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1565 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >KOG2912 consensus Predicted DNA methylase [Function unknown] | Back alignment and domain information |
|---|
| >PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes | Back alignment and domain information |
|---|
| >KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] | Back alignment and domain information |
|---|
| >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3392 Adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0863 DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3115 consensus Methyltransferase-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 2e-20 |
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Length = 281 | Back alignment and structure |
|---|
Score = 83.7 bits (206), Expect = 2e-20
Identities = 24/115 (20%), Positives = 42/115 (36%), Gaps = 3/115 (2%)
Query: 8 KDEDEMTDKHMTTVSQHYFVDESDKPSFSIAIIENMKEE-YGLFVWPCSVILAEYVWQQR 66
+ + + + Y S+ + + + VW + LA+ + Q
Sbjct: 16 GTPPDFYRERQRSRVERYQSPAGAPLQCSVQVQTTQEHPLWTSHVWSGARALADTLCWQP 75
Query: 67 YRFSGANVVELGAGTSLPGLVAAKVG-SNVTLTDDSNRIEVLKNMRRVCEMNKLN 120
+G V ELGAG L +VA G V TD + E+L ++ + N
Sbjct: 76 ELIAGKTVCELGAGAGLVSIVAFLAGADQVVATDYPDP-EILNSLESNIREHTAN 129
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 99.76 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 99.55 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 99.54 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 99.5 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 99.44 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 99.44 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 99.42 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 99.42 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 99.42 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 99.42 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 99.42 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 99.41 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 99.41 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 99.4 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 99.4 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 99.39 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 99.38 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 99.38 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 99.37 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 99.37 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 99.37 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 99.37 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 99.36 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 99.36 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 99.36 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 99.35 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 99.35 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 99.34 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 99.34 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 99.34 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 99.34 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 99.34 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 99.34 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 99.34 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 99.34 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 99.33 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 99.33 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 99.33 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 99.33 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 99.33 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 99.33 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 99.32 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 99.32 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 99.32 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 99.31 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 99.31 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 99.31 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 99.31 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 99.31 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 99.31 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 99.3 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 99.3 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 99.3 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 99.3 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 99.29 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 99.29 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 99.29 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 99.29 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 99.29 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 99.29 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 99.28 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 99.28 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 99.28 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 99.28 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 99.27 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 99.27 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 99.27 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 99.27 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 99.26 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 99.25 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 99.25 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 99.25 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 99.25 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 99.25 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 99.25 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 99.24 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 99.24 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 99.24 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 99.24 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 99.24 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.24 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 99.23 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 99.23 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 99.23 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 99.23 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 99.22 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 99.22 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 99.22 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 99.22 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 99.21 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 99.21 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 99.19 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 99.19 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 99.18 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 99.18 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 99.18 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 99.18 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 99.18 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 99.17 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 99.17 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 99.17 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 99.17 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 99.17 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 99.17 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 99.17 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 99.17 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 99.17 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 99.16 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 99.16 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 99.16 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 99.16 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 99.15 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 99.15 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 99.15 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 99.15 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 99.15 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 99.15 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 99.15 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 99.15 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 99.14 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 99.14 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 99.14 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 99.14 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 99.14 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 99.13 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 99.13 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 99.13 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 99.12 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 99.12 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 99.11 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 99.11 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 99.11 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 99.1 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 99.1 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 99.1 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 99.09 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 99.09 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 99.09 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 99.08 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 99.08 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 99.08 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 99.08 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 99.08 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 99.07 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 99.07 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 99.07 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 99.07 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 99.07 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 99.07 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 99.07 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 99.06 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 99.06 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 99.06 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 99.05 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 99.05 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 99.04 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 99.04 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 99.04 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 99.03 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 99.03 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 99.03 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 99.03 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 99.02 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 99.01 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 99.01 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 99.01 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 99.01 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 99.0 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 99.0 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 99.0 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 99.0 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 99.0 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 99.0 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 99.0 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 98.99 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 98.99 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 98.99 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 98.98 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 98.98 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 98.98 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 98.98 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 98.98 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 98.97 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 98.97 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 98.96 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 98.96 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 98.96 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 98.95 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 98.94 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 98.94 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 98.93 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 98.93 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 98.93 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 98.92 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 98.92 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 98.91 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 98.91 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 98.91 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 98.9 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 98.9 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 98.89 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 98.88 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 98.88 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 98.88 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 98.88 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 98.87 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 98.86 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 98.86 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 98.85 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 98.84 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 98.84 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 98.84 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 98.83 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 98.83 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 98.83 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 98.82 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 98.82 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 98.82 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 98.82 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 98.82 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 98.82 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 98.81 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.81 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 98.81 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 98.8 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 98.79 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 98.78 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 98.78 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 98.77 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 98.76 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 98.76 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 98.76 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 98.75 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 98.75 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 98.75 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 98.74 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 98.73 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 98.73 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 98.71 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 98.69 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 98.69 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 98.69 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 98.67 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 98.67 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 98.66 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 98.66 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 98.65 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 98.65 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 98.65 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 98.64 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 98.63 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 98.62 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 98.6 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 98.53 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 98.51 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 98.48 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 98.44 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 98.39 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 98.39 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 98.39 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 98.39 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 98.39 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 98.37 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 98.37 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 98.34 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 98.32 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 98.27 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 98.25 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 98.25 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 98.23 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 98.21 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 98.2 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 98.2 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 98.18 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 98.15 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 98.13 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 97.98 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 97.95 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 97.92 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 97.8 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 97.8 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 97.69 | |
| 4auk_A | 375 | Ribosomal RNA large subunit methyltransferase M; Y | 97.6 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 97.59 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 97.45 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 97.36 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 97.09 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 97.06 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 96.93 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 96.8 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 96.49 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 96.42 | |
| 2wk1_A | 282 | NOVP; transferase, O-methyltransferase, novobiocin | 96.15 | |
| 3lkz_A | 321 | Non-structural protein 5; flavivirus, methyltransf | 95.8 | |
| 3gcz_A | 282 | Polyprotein; flavivirus, RNA capping, methyltransf | 95.73 | |
| 2py6_A | 409 | Methyltransferase FKBM; YP_546752.1, structural ge | 95.72 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 95.55 | |
| 1eg2_A | 319 | Modification methylase RSRI; rossmann fold, exocyc | 95.51 | |
| 3p8z_A | 267 | Mtase, non-structural protein 5; methyltransferase | 95.33 | |
| 3eld_A | 300 | Methyltransferase; flavivirus, RNA capping, guanyl | 95.25 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 95.15 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 94.87 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 94.56 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 94.45 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 93.89 | |
| 3r24_A | 344 | NSP16, 2'-O-methyl transferase; methyltransferase, | 93.74 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 93.6 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 92.79 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 92.43 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 92.41 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 92.04 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 91.89 | |
| 2px2_A | 269 | Genome polyprotein [contains: capsid protein C (co | 91.63 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 91.35 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 90.54 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 90.49 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 90.41 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 89.71 | |
| 4f3n_A | 432 | Uncharacterized ACR, COG1565 superfamily; structur | 89.56 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 89.45 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 89.22 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 89.2 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 89.16 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 89.05 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 88.52 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 88.32 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 88.25 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 88.17 | |
| 1zkd_A | 387 | DUF185; NESG, RPR58, structural genomics, PSI, pro | 88.13 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 87.99 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 87.98 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 87.89 | |
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 87.88 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 87.84 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 87.78 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 87.75 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 87.73 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 87.7 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 87.68 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 87.03 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 87.03 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 86.71 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 86.69 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 86.5 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 86.29 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 86.21 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 86.08 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 85.91 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 85.9 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 85.82 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 85.8 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 85.76 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 85.76 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 85.74 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 85.42 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 85.36 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 85.31 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 85.31 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 85.16 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 84.72 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 84.42 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 84.4 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 84.29 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 84.05 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 84.04 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 84.0 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 83.94 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 83.89 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 83.65 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 83.58 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 83.42 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 83.35 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 83.29 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 83.24 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 83.07 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 83.03 | |
| 1rjd_A | 334 | PPM1P, carboxy methyl transferase for protein phos | 83.02 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 83.02 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 82.94 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 82.93 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 82.89 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 82.69 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 82.54 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 82.41 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 82.4 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 82.21 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 82.17 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 82.15 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 82.11 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 81.94 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 81.89 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 81.8 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 81.79 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 81.74 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 81.65 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 81.6 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 81.58 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 81.37 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 81.36 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 81.06 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 81.04 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 81.01 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 80.79 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 80.69 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 80.54 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 80.46 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 80.46 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 80.35 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 80.31 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 80.15 |
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
Probab=99.76 E-value=1.1e-17 Score=132.98 Aligned_cols=110 Identities=21% Similarity=0.251 Sum_probs=85.6
Q ss_pred CCCceEecchHHHHHHHHHhcccCCCCCeEEEeccCCCHHHHHHhhcCC-EEEEEec-CChHHHHHHHHHHHH-----Hc
Q 031506 45 EEYGLFVWPCSVILAEYVWQQRYRFSGANVVELGAGTSLPGLVAAKVGS-NVTLTDD-SNRIEVLKNMRRVCE-----MN 117 (158)
Q Consensus 45 ~~~g~~vW~~~~~la~~l~~~~~~~~~~~vLELG~GtGl~~i~~a~~g~-~v~~tD~-~~~~~~l~~~~~n~~-----~n 117 (158)
.-+|..+||++..|++|+.......++++|||||||+|.+++.+++.|+ +|+++|+ ++. +++.+++|+. .+
T Consensus 54 ~~~g~~~~~~~~~l~~~l~~~~~~~~~~~vLDlG~G~G~~~~~~a~~~~~~v~~~D~s~~~--~~~~a~~n~~~N~~~~~ 131 (281)
T 3bzb_A 54 PLWTSHVWSGARALADTLCWQPELIAGKTVCELGAGAGLVSIVAFLAGADQVVATDYPDPE--ILNSLESNIREHTANSC 131 (281)
T ss_dssp --------CHHHHHHHHHHHCGGGTTTCEEEETTCTTSHHHHHHHHTTCSEEEEEECSCHH--HHHHHHHHHHTTCC---
T ss_pred CCCCceeecHHHHHHHHHHhcchhcCCCeEEEecccccHHHHHHHHcCCCEEEEEeCCCHH--HHHHHHHHHHHhhhhhc
Confidence 4578899999999999999876667888999999999999999999887 9999999 754 9999999994 44
Q ss_pred CC------cceEEEc--------------CCCCcEEE-ecCCCCCccHHHHHHHHHHHhc
Q 031506 118 KL------NCRLLMT--------------SLPPSHIC-SRVLQDQSSLRLIIIEVGIILL 156 (158)
Q Consensus 118 ~~------~~~~~~~--------------d~~fD~Ii-~d~iy~~~~~~~ll~tl~~ll~ 156 (158)
++ ++.+... +.+||+|+ +|++|+.+..+.+++++..+|.
T Consensus 132 ~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~fD~Ii~~dvl~~~~~~~~ll~~l~~~Lk 191 (281)
T 3bzb_A 132 SSETVKRASPKVVPYRWGDSPDSLQRCTGLQRFQVVLLADLLSFHQAHDALLRSVKMLLA 191 (281)
T ss_dssp -------CCCEEEECCTTSCTHHHHHHHSCSSBSEEEEESCCSCGGGHHHHHHHHHHHBC
T ss_pred ccccCCCCCeEEEEecCCCccHHHHhhccCCCCCEEEEeCcccChHHHHHHHHHHHHHhc
Confidence 43 2444432 23799999 9999999999999999999887
|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} | Back alignment and structure |
|---|
| >3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} | Back alignment and structure |
|---|
| >3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} | Back alignment and structure |
|---|
| >2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A | Back alignment and structure |
|---|
| >3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* | Back alignment and structure |
|---|
| >3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 99.72 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 99.61 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.59 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 99.58 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 99.58 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.54 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 99.54 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 99.53 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 99.52 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 99.5 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 99.49 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.47 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 99.46 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 99.45 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 99.45 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 99.44 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 99.43 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 99.42 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 99.41 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 99.38 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 99.38 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 99.37 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 99.34 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 99.34 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 99.33 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 99.33 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 99.32 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 99.32 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 99.32 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 99.31 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 99.31 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 99.3 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 99.29 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 99.29 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 99.25 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 99.24 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.22 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 99.22 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 99.22 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 99.21 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 99.18 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.18 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 99.16 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 99.16 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 99.14 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 99.07 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 99.03 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 99.01 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 98.99 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 98.97 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 98.97 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 98.92 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 98.91 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 98.9 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 98.85 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 98.85 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 98.84 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 98.84 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 98.82 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 98.78 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 98.76 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 98.75 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 98.74 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 98.72 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 98.64 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 98.62 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 98.61 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 98.6 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 98.54 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 98.49 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 98.4 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 98.38 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 98.36 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 98.32 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 98.3 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 98.16 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 98.14 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 97.89 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 97.83 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 97.78 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 97.62 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 97.53 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 97.52 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 97.4 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 97.37 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 97.31 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 97.19 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 97.12 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 97.11 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 97.08 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 97.07 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 97.05 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 97.03 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 96.83 | |
| d1i4wa_ | 322 | Transcription factor sc-mtTFB {Baker's yeast (Sacc | 96.79 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 96.65 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 96.46 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 96.27 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 96.19 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 96.14 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 95.79 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 95.47 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 95.19 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 95.06 | |
| d1o9ga_ | 249 | rRNA methyltransferase AviRa {Streptomyces viridoc | 95.02 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 94.91 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 94.65 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 94.59 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 94.32 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 94.09 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 93.85 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 93.48 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 93.28 | |
| d2bm8a1 | 232 | Cephalosporin hydroxylase CmcI {Streptomyces clavu | 93.25 | |
| d2p41a1 | 257 | An RNA cap (nucleoside-2'-O-)-methyltransferase do | 93.21 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 93.2 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 93.12 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 92.98 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 92.95 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 92.65 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 92.53 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 92.48 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 92.4 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 92.18 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 92.1 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 91.99 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 91.78 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 91.62 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 91.5 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 91.27 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 91.17 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 91.1 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 91.02 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 90.89 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 90.82 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 90.6 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 90.57 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 90.29 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 90.14 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 90.11 | |
| d1zkda1 | 365 | Hypothetical protein RPA4359 {Rhodopseudomonas pal | 90.1 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 90.05 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 89.87 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 89.58 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 89.22 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 89.1 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 88.95 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 88.66 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 88.57 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 88.45 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 88.22 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 88.08 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 87.7 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 87.68 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 87.62 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 87.39 | |
| d2py6a1 | 395 | Methyltransferase FkbM {Methylobacillus flagellatu | 87.29 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 87.05 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 87.02 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 86.92 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 86.28 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 86.19 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 85.98 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 85.97 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 85.38 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 85.31 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 85.18 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 84.94 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 84.86 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 83.42 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 82.28 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 81.85 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 81.64 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 81.43 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 81.36 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 81.14 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 81.08 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 81.07 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 80.58 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 80.03 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 80.03 |
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Ribosomal protein L11 methyltransferase PrmA domain: PrmA-like protein TTHA0656 (TT0836) species: Thermus thermophilus [TaxId: 274]
Probab=99.72 E-value=1.5e-17 Score=129.49 Aligned_cols=116 Identities=17% Similarity=0.180 Sum_probs=92.2
Q ss_pred ceEEEEeccCCCCCceEecchHHHHHHHHHhcccCCCCCeEEEeccCCCHHHHHHhhcCCEEEEEecCChHHHHHHHHHH
Q 031506 34 SFSIAIIENMKEEYGLFVWPCSVILAEYVWQQRYRFSGANVVELGAGTSLPGLVAAKVGSNVTLTDDSNRIEVLKNMRRV 113 (158)
Q Consensus 34 ~~~~~i~~~~~~~~g~~vW~~~~~la~~l~~~~~~~~~~~vLELG~GtGl~~i~~a~~g~~v~~tD~~~~~~~l~~~~~n 113 (158)
.+.|.|.+.+..++|.+ |.+..+.+++.+.. .++++|||+|||+|.+++.+++.|++|+++|+++. |++.+++|
T Consensus 88 ~~~i~i~pg~aFGTG~H--~TT~l~l~~l~~~~--~~g~~VLDiGcGsG~l~i~aa~~g~~V~gvDis~~--av~~A~~n 161 (254)
T d2nxca1 88 EIPLVIEPGMAFGTGHH--ETTRLALKALARHL--RPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPM--VLPQAEAN 161 (254)
T ss_dssp SEEEECCCC-----CCS--HHHHHHHHHHHHHC--CTTCEEEEETCTTSHHHHHHHHTTCEEEEEESCGG--GHHHHHHH
T ss_pred ceEEEEccccccCcccc--chhhHHHHHHHhhc--CccCEEEEcccchhHHHHHHHhcCCEEEEEECChH--HHHHHHHH
Confidence 56788877777778776 88999999987643 57899999999999999999999999999999986 99999999
Q ss_pred HHHcCCcceEEEcC-------CCCcEEEecCCCCCccHHHHHHHHHHHhcC
Q 031506 114 CEMNKLNCRLLMTS-------LPPSHICSRVLQDQSSLRLIIIEVGIILLS 157 (158)
Q Consensus 114 ~~~n~~~~~~~~~d-------~~fD~Ii~d~iy~~~~~~~ll~tl~~ll~~ 157 (158)
++.|+++.++...+ .+||+|+++..+ ..+..++..+...|++
T Consensus 162 a~~n~~~~~~~~~d~~~~~~~~~fD~V~ani~~--~~l~~l~~~~~~~Lkp 210 (254)
T d2nxca1 162 AKRNGVRPRFLEGSLEAALPFGPFDLLVANLYA--ELHAALAPRYREALVP 210 (254)
T ss_dssp HHHTTCCCEEEESCHHHHGGGCCEEEEEEECCH--HHHHHHHHHHHHHEEE
T ss_pred HHHcCCceeEEeccccccccccccchhhhcccc--ccHHHHHHHHHHhcCC
Confidence 99999988776654 289999966443 3467777888777654
|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|