Citrus Sinensis ID: 031590
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 157 | ||||||
| 162460375 | 576 | chaperonin CPN60-2, mitochondrial precur | 0.796 | 0.217 | 0.398 | 1e-13 | |
| 219884183 | 381 | unknown [Zea mays] | 0.796 | 0.328 | 0.398 | 2e-13 | |
| 326491001 | 574 | predicted protein [Hordeum vulgare subsp | 0.783 | 0.214 | 0.4 | 2e-13 | |
| 413934100 | 382 | chaperonin 1, partial [Zea mays] | 0.936 | 0.384 | 0.354 | 3e-13 | |
| 115450675 | 577 | Os03g0143400 [Oryza sativa Japonica Grou | 0.783 | 0.213 | 0.392 | 5e-13 | |
| 2506275 | 577 | RecName: Full=Chaperonin CPN60-1, mitoch | 0.796 | 0.216 | 0.383 | 6e-13 | |
| 22250 | 576 | mitochondrial chaperonin-60 [Zea mays] | 0.796 | 0.217 | 0.390 | 6e-13 | |
| 309557 | 577 | chaperonin 60 [Zea mays] | 0.796 | 0.216 | 0.383 | 6e-13 | |
| 223974475 | 352 | unknown [Zea mays] | 0.796 | 0.355 | 0.383 | 6e-13 | |
| 162458253 | 577 | chaperonin CPN60-1, mitochondrial precur | 0.796 | 0.216 | 0.383 | 1e-12 |
| >gi|162460375|ref|NP_001105690.1| chaperonin CPN60-2, mitochondrial precursor [Zea mays] gi|2493646|sp|Q43298.1|CH62_MAIZE RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; Flags: Precursor gi|309559|gb|AAA33451.1| chaperonin 60 [Zea mays] gi|309561|gb|AAA33452.1| mitochondrial chaperonin 60 [Zea mays] gi|414871207|tpg|DAA49764.1| TPA: putative TCP-1/cpn60 chaperonin family protein [Zea mays] | Back alignment and taxonomy information |
|---|
Score = 81.6 bits (200), Expect = 1e-13, Method: Composition-based stats.
Identities = 53/133 (39%), Positives = 78/133 (58%), Gaps = 8/133 (6%)
Query: 1 MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQA--DSRPLLIVAE 57
MKL +S YF TN KA+ C LE+P +LI + + + + V + + A RPLLIVAE
Sbjct: 226 MKLDRGYISPYFITNSKAQKCELEDPLILIHDKKVTNMHAVVKVLEMALKKQRPLLIVAE 285
Query: 58 DVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLN---GATNV 114
DVE + +G+LI+ K L+ + + + + KA + DLAILTGG+V+ G
Sbjct: 286 DVESEALGTLIINK--LRAGIKVCAVKAPGFGENRKANLQDLAILTGGEVITEELGMNLE 343
Query: 115 SFMPLMLGSCKEL 127
+ P MLGSCK++
Sbjct: 344 NVEPHMLGSCKKV 356
|
Source: Zea mays Species: Zea mays Genus: Zea Family: Poaceae Order: Poales Class: Liliopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|219884183|gb|ACL52466.1| unknown [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|326491001|dbj|BAK05600.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|413934100|gb|AFW68651.1| chaperonin 1, partial [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|115450675|ref|NP_001048938.1| Os03g0143400 [Oryza sativa Japonica Group] gi|108706134|gb|ABF93929.1| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] gi|113547409|dbj|BAF10852.1| Os03g0143400 [Oryza sativa Japonica Group] gi|215704319|dbj|BAG93753.1| unnamed protein product [Oryza sativa Japonica Group] gi|218192069|gb|EEC74496.1| hypothetical protein OsI_09970 [Oryza sativa Indica Group] gi|222624174|gb|EEE58306.1| hypothetical protein OsJ_09368 [Oryza sativa Japonica Group] gi|284431758|gb|ADB84620.1| chaperonin [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|2506275|sp|P29185.2|CH61_MAIZE RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; Flags: Precursor | Back alignment and taxonomy information |
|---|
| >gi|22250|emb|CAA78101.1| mitochondrial chaperonin-60 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|309557|gb|AAA33450.1| chaperonin 60 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|223974475|gb|ACN31425.1| unknown [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|162458253|ref|NP_001105716.1| chaperonin CPN60-1, mitochondrial precursor [Zea mays] gi|22248|emb|CAA78100.1| mitochondrial chaperonin-60 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 157 | ||||||
| TAIR|locus:2076081 | 577 | HSP60 "heat shock protein 60" | 0.796 | 0.216 | 0.390 | 8.5e-14 | |
| TAIR|locus:2087959 | 572 | HSP60-3A "heat shock protein 6 | 0.796 | 0.218 | 0.398 | 2.3e-13 | |
| TAIR|locus:2046590 | 585 | HSP60-2 "heat shock protein 60 | 0.796 | 0.213 | 0.375 | 6.4e-13 | |
| UNIPROTKB|Q9KNR7 | 544 | groL1 "60 kDa chaperonin 1" [V | 0.630 | 0.181 | 0.367 | 2.2e-10 | |
| TIGR_CMR|VC_2664 | 544 | VC_2664 "chaperonin, 60 Kd sub | 0.630 | 0.181 | 0.367 | 2.2e-10 | |
| TIGR_CMR|CBU_1718 | 552 | CBU_1718 "chaperonin, 60 kDa" | 0.751 | 0.213 | 0.296 | 2.8e-10 | |
| UNIPROTKB|Q9KLC6 | 530 | groL2 "60 kDa chaperonin 2" [V | 0.745 | 0.220 | 0.299 | 9.2e-10 | |
| TIGR_CMR|VC_A0820 | 530 | VC_A0820 "chaperonin, 60 Kd su | 0.745 | 0.220 | 0.299 | 9.2e-10 | |
| TIGR_CMR|BA_0267 | 544 | BA_0267 "chaperonin, 60 kDa" [ | 0.611 | 0.176 | 0.333 | 2e-09 | |
| UNIPROTKB|P0A520 | 540 | groEL2 "60 kDa chaperonin 2" [ | 0.617 | 0.179 | 0.351 | 2.6e-09 |
| TAIR|locus:2076081 HSP60 "heat shock protein 60" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 188 (71.2 bits), Expect = 8.5e-14, P = 8.5e-14
Identities = 52/133 (39%), Positives = 75/133 (56%)
Query: 1 MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQA--DSRPLLIVAE 57
MKL S YF TNQK + C L++P +LI E I S N + + + A RPLLIV+E
Sbjct: 223 MKLDRGYTSPYFITNQKTQKCELDDPLILIHEKKISSINSIVKVLELALKRQRPLLIVSE 282
Query: 58 DVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNG--ATNVS 115
DVE + +LIL K L+ + + + + KA + DLA LTGG+V+ N+
Sbjct: 283 DVESDALATLILNK--LRAGIKVCAIKAPGFGENRKANLQDLAALTGGEVITDELGMNLE 340
Query: 116 FMPL-MLGSCKEL 127
+ L MLG+CK++
Sbjct: 341 KVDLSMLGTCKKV 353
|
|
| TAIR|locus:2087959 HSP60-3A "heat shock protein 60-3A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046590 HSP60-2 "heat shock protein 60-2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KNR7 groL1 "60 kDa chaperonin 1" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2664 VC_2664 "chaperonin, 60 Kd subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1718 CBU_1718 "chaperonin, 60 kDa" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KLC6 groL2 "60 kDa chaperonin 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_A0820 VC_A0820 "chaperonin, 60 Kd subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_0267 BA_0267 "chaperonin, 60 kDa" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A520 groEL2 "60 kDa chaperonin 2" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| 4331590 | T-complex protein, putative, expressed (577 aa) | ||||||||||
(Oryza sativa Japonica) | |||||||||||
| LOC_Os03g25050.1 | • | • | • | • | 0.790 | ||||||
| 4344071 | • | • | • | • | 0.746 | ||||||
| OsJ_01526 | • | 0.668 | |||||||||
| B1172G12.2 | • | • | • | • | 0.567 | ||||||
| 4342497 | • | 0.555 | |||||||||
| GYRB | • | 0.536 | |||||||||
| 4345097 | • | 0.514 | |||||||||
| 4347161 | • | • | • | 0.503 | |||||||
| 4340394 | • | • | • | 0.495 | |||||||
| 4338417 | • | 0.491 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 157 | |||
| cd03344 | 520 | cd03344, GroEL, GroEL_like type I chaperonin | 2e-19 | |
| PRK12849 | 542 | PRK12849, groEL, chaperonin GroEL; Reviewed | 7e-18 | |
| PTZ00114 | 555 | PTZ00114, PTZ00114, Heat shock protein 60; Provisi | 2e-15 | |
| TIGR02348 | 524 | TIGR02348, GroEL, chaperonin GroL | 1e-14 | |
| PRK12850 | 544 | PRK12850, groEL, chaperonin GroEL; Reviewed | 2e-14 | |
| PRK00013 | 542 | PRK00013, groEL, chaperonin GroEL; Reviewed | 5e-13 | |
| CHL00093 | 529 | CHL00093, groEL, chaperonin GroEL | 1e-12 | |
| PRK12851 | 541 | PRK12851, groEL, chaperonin GroEL; Reviewed | 5e-12 | |
| PRK12852 | 545 | PRK12852, groEL, chaperonin GroEL; Reviewed | 2e-10 | |
| PRK14104 | 546 | PRK14104, PRK14104, chaperonin GroEL; Provisional | 2e-08 | |
| PLN03167 | 600 | PLN03167, PLN03167, Chaperonin-60 beta subunit; Pr | 1e-07 | |
| COG0459 | 524 | COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po | 7e-06 | |
| cd00309 | 464 | cd00309, chaperonin_type_I_II, chaperonin families | 7e-04 | |
| pfam00118 | 481 | pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami | 0.001 |
| >gnl|CDD|239460 cd03344, GroEL, GroEL_like type I chaperonin | Back alignment and domain information |
|---|
Score = 83.7 bits (208), Expect = 2e-19
Identities = 39/126 (30%), Positives = 72/126 (57%), Gaps = 10/126 (7%)
Query: 8 VSSYF-TNQKAKDCVLENPFLLILENMIVS-KNIVE--QAIAQADSRPLLIVAEDVEDKL 63
+S YF T+ + + LENP++L+ + I S + ++ + +A+A RPLLI+AEDVE +
Sbjct: 197 LSPYFVTDPEKMEVELENPYILLTDKKISSIQELLPILELVAKA-GRPLLIIAEDVEGEA 255
Query: 64 IGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPL---M 120
+ +L++ K L+ + + + KA+++D+AILTGG V++ + +
Sbjct: 256 LATLVVNK--LRGGLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEELGLKLEDVTLED 313
Query: 121 LGSCKE 126
LG K+
Sbjct: 314 LGRAKK 319
|
Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). With the aid of cochaperonin GroES, GroEL encapsulates non-native substrate proteins inside the cavity of the GroEL-ES complex and promotes folding by using energy derived from ATP hydrolysis. Length = 520 |
| >gnl|CDD|237230 PRK12849, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185455 PTZ00114, PTZ00114, Heat shock protein 60; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233828 TIGR02348, GroEL, chaperonin GroL | Back alignment and domain information |
|---|
| >gnl|CDD|237231 PRK12850, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234573 PRK00013, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL | Back alignment and domain information |
|---|
| >gnl|CDD|171770 PRK12851, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237232 PRK12852, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|172594 PRK14104, PRK14104, chaperonin GroEL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215611 PLN03167, PLN03167, Chaperonin-60 beta subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| KOG0356 | 550 | consensus Mitochondrial chaperonin, Cpn60/Hsp60p [ | 100.0 | |
| PLN03167 | 600 | Chaperonin-60 beta subunit; Provisional | 100.0 | |
| PRK14104 | 546 | chaperonin GroEL; Provisional | 100.0 | |
| PRK12852 | 545 | groEL chaperonin GroEL; Reviewed | 100.0 | |
| PTZ00114 | 555 | Heat shock protein 60; Provisional | 100.0 | |
| CHL00093 | 529 | groEL chaperonin GroEL | 100.0 | |
| PRK12851 | 541 | groEL chaperonin GroEL; Reviewed | 99.97 | |
| TIGR02348 | 524 | GroEL chaperonin GroL. This family consists of Gro | 99.97 | |
| PRK12850 | 544 | groEL chaperonin GroEL; Reviewed | 99.97 | |
| PRK00013 | 542 | groEL chaperonin GroEL; Reviewed | 99.97 | |
| PRK12849 | 542 | groEL chaperonin GroEL; Reviewed | 99.97 | |
| cd03344 | 520 | GroEL GroEL_like type I chaperonin. Chaperonins ar | 99.96 | |
| COG0459 | 524 | GroL Chaperonin GroEL (HSP60 family) [Posttranslat | 99.93 | |
| cd03338 | 515 | TCP1_delta TCP-1 (CTT or eukaryotic type II) chape | 99.54 | |
| TIGR02343 | 532 | chap_CCT_epsi T-complex protein 1, epsilon subunit | 99.54 | |
| cd03339 | 526 | TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha | 99.53 | |
| cd03343 | 517 | cpn60 cpn60 chaperonin family. Chaperonins are inv | 99.49 | |
| TIGR02345 | 522 | chap_CCT_eta T-complex protein 1, eta subunit. Mem | 99.48 | |
| cd03342 | 484 | TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper | 99.47 | |
| TIGR02342 | 517 | chap_CCT_delta T-complex protein 1, delta subunit. | 99.46 | |
| TIGR02346 | 531 | chap_CCT_theta T-complex protein 1, theta subunit. | 99.44 | |
| TIGR02339 | 519 | thermosome_arch thermosome, various subunits, arch | 99.41 | |
| PTZ00212 | 533 | T-complex protein 1 subunit beta; Provisional | 99.38 | |
| TIGR02340 | 536 | chap_CCT_alpha T-complex protein 1, alpha subunit. | 99.35 | |
| cd03335 | 527 | TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape | 99.33 | |
| cd00309 | 464 | chaperonin_type_I_II chaperonin families, type I a | 99.3 | |
| TIGR02341 | 519 | chap_CCT_beta T-complex protein 1, beta subunit. M | 99.29 | |
| TIGR02347 | 531 | chap_CCT_zeta T-complex protein 1, zeta subunit. M | 99.28 | |
| cd03336 | 517 | TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper | 99.28 | |
| cd03333 | 209 | chaperonin_like chaperonin_like superfamily. Chape | 99.26 | |
| cd03341 | 472 | TCP1_theta TCP-1 (CTT or eukaryotic type II) chape | 99.21 | |
| cd03340 | 522 | TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero | 99.17 | |
| PF00118 | 485 | Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon | 99.12 | |
| TIGR02344 | 525 | chap_CCT_gamma T-complex protein 1, gamma subunit. | 98.98 | |
| cd03337 | 480 | TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape | 98.87 | |
| cd03334 | 261 | Fab1_TCP TCP-1 like domain of the eukaryotic phosp | 96.81 | |
| KOG0357 | 400 | consensus Chaperonin complex component, TCP-1 epsi | 90.26 |
| >KOG0356 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.8e-48 Score=349.53 Aligned_cols=151 Identities=28% Similarity=0.394 Sum_probs=148.0
Q ss_pred CccCCccccccc-CCCCCceEEeeCceEEeecccccchHHHHHHH--HhhcCCceEEEecccccchhhhhhcccccCcce
Q 031590 1 MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAI--AQADSRPLLIVAEDVEDKLIGSLILGKTCLQNK 77 (157)
Q Consensus 1 m~fdrGylSpyf-td~~~~~~~le~p~IL~td~kIs~~~~ilp~L--~~~~~rpLlIIAedv~~eaL~tLv~Nk~rg~l~ 77 (157)
|+|||||+|||| |+++++++|||||++|++|+||+++++|+|+| +.+..+||+||||||++|||++||+||++++++
T Consensus 206 mkfdrGyiSPyfi~~~k~~~~e~e~~~~ll~~kki~~v~~ivp~LE~A~~~~~PLliIAeDi~~eaL~tLIlNkLk~glq 285 (550)
T KOG0356|consen 206 MKFDRGYISPYFITSSKKQKVEFENALLLLSEKKISSVQSIVPALELALAKRRPLLIIAEDIDGEALATLVLNKLKGGLQ 285 (550)
T ss_pred ccccccccCccccccchhhhhhhhhhhhhhhhhhhhHHHHHhHHHHHhhhccCceEEEehhcchhHHHHHHhhhhcccee
Confidence 899999999999 99999999999999999999999999999999 778889999999999999999999999999999
Q ss_pred EE-eecCCCCCchhhHhhhhhhhhhhhCcEEeec----cccCCCCCCCCceeeEEEEeCCceEEEcCCCChHHHHHHHHH
Q 031590 78 VS-IAKPHEDDYEKETKAIMDDLAILTGGQVLNG----ATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLKKDVHR 152 (157)
Q Consensus 78 v~-VkaP~~~gfG~~rk~~L~DiAilTGg~vi~~----~~l~~v~~~~LG~a~~v~vtkd~T~i~~g~g~~~~I~~Rv~q 152 (157)
|| ||+| ||||+|++.|+|||++|||+++++ ++|+.+++++||.|.++++|||+|.++.|.+++++++.||+|
T Consensus 286 V~AvKap---gfGdnrk~~l~Diai~Tg~~v~~~e~~~l~le~~~~~dLG~~~evvvtkd~t~ll~g~~~~~~v~~rIeq 362 (550)
T KOG0356|consen 286 VVAVKAP---GFGDNRKNLLKDIAILTGATVFGEELSTLNLEDAKLEDLGEVGEVVVTKDDTMLLKGKGNKAQVEGRIEQ 362 (550)
T ss_pred EEEEecC---CCcchHHHhhhHHHHHhhhhhhccchhhcccccCchhhcCcceeEEEecCcceeeCCCCCHHHHHHHHHH
Confidence 99 9999 999999999999999999999999 788999999999999999999999999999999999999999
Q ss_pred hh
Q 031590 153 FF 154 (157)
Q Consensus 153 i~ 154 (157)
|-
T Consensus 363 ik 364 (550)
T KOG0356|consen 363 IK 364 (550)
T ss_pred HH
Confidence 85
|
|
| >PLN03167 Chaperonin-60 beta subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14104 chaperonin GroEL; Provisional | Back alignment and domain information |
|---|
| >PRK12852 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PTZ00114 Heat shock protein 60; Provisional | Back alignment and domain information |
|---|
| >CHL00093 groEL chaperonin GroEL | Back alignment and domain information |
|---|
| >PRK12851 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >TIGR02348 GroEL chaperonin GroL | Back alignment and domain information |
|---|
| >PRK12850 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK00013 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12849 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03344 GroEL GroEL_like type I chaperonin | Back alignment and domain information |
|---|
| >COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit | Back alignment and domain information |
|---|
| >cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit | Back alignment and domain information |
|---|
| >cd03343 cpn60 cpn60 chaperonin family | Back alignment and domain information |
|---|
| >TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit | Back alignment and domain information |
|---|
| >TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
| >TIGR02339 thermosome_arch thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >PTZ00212 T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >cd00309 chaperonin_type_I_II chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit | Back alignment and domain information |
|---|
| >cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >cd03333 chaperonin_like chaperonin_like superfamily | Back alignment and domain information |
|---|
| >cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
| >PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism | Back alignment and domain information |
|---|
| >TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1 | Back alignment and domain information |
|---|
| >KOG0357 consensus Chaperonin complex component, TCP-1 epsilon subunit (CCT5) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 157 | ||||
| 1srv_A | 145 | Thermus Thermophilus Groel (Hsp60 Class) Fragment ( | 1e-09 | ||
| 1we3_A | 543 | Crystal Structure Of The Chaperonin Complex Cpn60CP | 2e-09 | ||
| 1kid_A | 203 | Groel (Hsp60 Class) Fragment (Apical Domain) Compri | 3e-09 | ||
| 1jon_A | 155 | Groel (Hsp60 Class) Fragment Comprising Residues 19 | 3e-09 | ||
| 1dk7_A | 146 | Crystal Structure Of An Isolated Apical Domain Of G | 3e-09 | ||
| 1fy9_A | 193 | Crystal Structure Of The Hexa-Substituted Mutant Of | 3e-09 | ||
| 3rtk_A | 546 | Crystal Structure Of Cpn60.2 From Mycobacterium Tub | 4e-09 | ||
| 1sjp_A | 504 | Mycobacterium Tuberculosis Chaperonin60.2 Length = | 4e-09 | ||
| 1la1_A | 192 | Gro-El Fragment (Apical Domain) Comprising Residues | 5e-09 | ||
| 1fya_A | 193 | Crystal Structure Of The Hexa-Substituted Mutant Of | 6e-09 | ||
| 1ss8_A | 524 | Groel Length = 524 | 1e-08 | ||
| 1pcq_A | 524 | Crystal Structure Of Groel-Groes Length = 524 | 1e-08 | ||
| 1sx3_A | 525 | Groel14-(Atpgammas)14 Length = 525 | 1e-08 | ||
| 2yey_A | 524 | Crystal Structure Of The Allosteric-Defective Chape | 1e-08 | ||
| 1j4z_A | 547 | Structural And Mechanistic Basis For Allostery In T | 1e-08 | ||
| 1kp8_A | 547 | Structural Basis For Groel-Assisted Protein Folding | 1e-08 | ||
| 3c9v_A | 526 | C7 Symmetrized Structure Of Unliganded Groel At 4.7 | 1e-08 | ||
| 1aon_A | 547 | Crystal Structure Of The Asymmetric Chaperonin Comp | 1e-08 | ||
| 1gr5_A | 547 | Solution Structure Of Apo Groel By Cryo-Electron Mi | 1e-08 | ||
| 4aaq_A | 548 | Atp-Triggered Molecular Mechanics Of The Chaperonin | 1e-08 | ||
| 2eu1_A | 548 | Crystal Structure Of The Chaperonin Groel-E461k Len | 1e-08 | ||
| 3osx_A | 201 | Crystal Structure Of Apical Domain Of Insecticidal | 4e-08 | ||
| 1iok_A | 545 | Crystal Structure Of Chaperonin-60 From Paracoccus | 4e-08 | ||
| 3cau_A | 526 | D7 Symmetrized Structure Of Unliganded Groel At 4.2 | 6e-08 | ||
| 1grl_A | 548 | The Crystal Structure Of The Bacterial Chaperonin G | 6e-08 | ||
| 1oel_A | 547 | Conformational Variability In The Refined Structure | 6e-08 | ||
| 3m6c_A | 194 | Crystal Structure Of Mycobacterium Tuberculosis Gro | 5e-07 |
| >pdb|1SRV|A Chain A, Thermus Thermophilus Groel (Hsp60 Class) Fragment (Apical Domain) Comprising Residues 192-336 Length = 145 | Back alignment and structure |
|
| >pdb|1WE3|A Chain A, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 543 | Back alignment and structure |
| >pdb|1KID|A Chain A, Groel (Hsp60 Class) Fragment (Apical Domain) Comprising Residues 191-376, Mutant With Ala 262 Replaced With Leu And Ile 267 Replaced With Met Length = 203 | Back alignment and structure |
| >pdb|1JON|A Chain A, Groel (Hsp60 Class) Fragment Comprising Residues 191-345 Length = 155 | Back alignment and structure |
| >pdb|1DK7|A Chain A, Crystal Structure Of An Isolated Apical Domain Of Groel Length = 146 | Back alignment and structure |
| >pdb|1FY9|A Chain A, Crystal Structure Of The Hexa-Substituted Mutant Of The Molecular Chaperonin Groel Apical Domain Length = 193 | Back alignment and structure |
| >pdb|3RTK|A Chain A, Crystal Structure Of Cpn60.2 From Mycobacterium Tuberculosis At 2.8a Length = 546 | Back alignment and structure |
| >pdb|1SJP|A Chain A, Mycobacterium Tuberculosis Chaperonin60.2 Length = 504 | Back alignment and structure |
| >pdb|1LA1|A Chain A, Gro-El Fragment (Apical Domain) Comprising Residues 188-379 Length = 192 | Back alignment and structure |
| >pdb|1FYA|A Chain A, Crystal Structure Of The Hexa-Substituted Mutant Of The Molecular Chaperonin Groel Apical Domain Length = 193 | Back alignment and structure |
| >pdb|1SS8|A Chain A, Groel Length = 524 | Back alignment and structure |
| >pdb|1PCQ|A Chain A, Crystal Structure Of Groel-Groes Length = 524 | Back alignment and structure |
| >pdb|1SX3|A Chain A, Groel14-(Atpgammas)14 Length = 525 | Back alignment and structure |
| >pdb|2YEY|A Chain A, Crystal Structure Of The Allosteric-Defective Chaperonin Groel E434k Mutant Length = 524 | Back alignment and structure |
| >pdb|1J4Z|A Chain A, Structural And Mechanistic Basis For Allostery In The Bacterial Chaperonin Groel; See Remark 400 Length = 547 | Back alignment and structure |
| >pdb|1KP8|A Chain A, Structural Basis For Groel-Assisted Protein Folding From The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A Resolution Length = 547 | Back alignment and structure |
| >pdb|3C9V|A Chain A, C7 Symmetrized Structure Of Unliganded Groel At 4.7 Angstrom Resolution From Cryoem Length = 526 | Back alignment and structure |
| >pdb|1AON|A Chain A, Crystal Structure Of The Asymmetric Chaperonin Complex GroelGROES(ADP)7 Length = 547 | Back alignment and structure |
| >pdb|1GR5|A Chain A, Solution Structure Of Apo Groel By Cryo-Electron Microscopy Length = 547 | Back alignment and structure |
| >pdb|4AAQ|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel Length = 548 | Back alignment and structure |
| >pdb|2EU1|A Chain A, Crystal Structure Of The Chaperonin Groel-E461k Length = 548 | Back alignment and structure |
| >pdb|3OSX|A Chain A, Crystal Structure Of Apical Domain Of Insecticidal Groel From Xenorhapdus Nematophila Length = 201 | Back alignment and structure |
| >pdb|1IOK|A Chain A, Crystal Structure Of Chaperonin-60 From Paracoccus Denitrificans Length = 545 | Back alignment and structure |
| >pdb|3CAU|A Chain A, D7 Symmetrized Structure Of Unliganded Groel At 4.2 Angstrom Resolution By Cryoem Length = 526 | Back alignment and structure |
| >pdb|1GRL|A Chain A, The Crystal Structure Of The Bacterial Chaperonin Groel At 2.8 Angstroms Length = 548 | Back alignment and structure |
| >pdb|1OEL|A Chain A, Conformational Variability In The Refined Structure Of The Chaperonin Groel At 2.8 Angstrom Resolution Length = 547 | Back alignment and structure |
| >pdb|3M6C|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Groel1 Apical Domain Length = 194 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 157 | |||
| 1srv_A | 145 | Protein (groel (HSP60 class)); chaperone, cell div | 2e-14 | |
| 3m6c_A | 194 | 60 kDa chaperonin 1; chaperone, ATP-binding, nucle | 7e-14 | |
| 3osx_A | 201 | 60 kDa chaperonin; alpha, beta, apical domain, cha | 8e-14 | |
| 1iok_A | 545 | Chaperonin 60; chaperone; 3.20A {Paracoccus denitr | 2e-13 | |
| 1kp8_A | 547 | Groel protein; chaperonin, assisted protein foldin | 3e-13 | |
| 3rtk_A | 546 | 60 kDa chaperonin 2; heat shock protein, chaperone | 3e-13 | |
| 1we3_A | 543 | CPN60(groel); chaperonin, chaperone, groel, HSP60, | 5e-13 |
| >1srv_A Protein (groel (HSP60 class)); chaperone, cell division, ATP-binding, phosphorylation; 1.70A {Thermus thermophilus} SCOP: c.8.5.1 Length = 145 | Back alignment and structure |
|---|
Score = 65.0 bits (159), Expect = 2e-14
Identities = 38/106 (35%), Positives = 64/106 (60%), Gaps = 9/106 (8%)
Query: 8 VSSYF-TNQKAKDCVLENPFLLILENMIVSKN----IVEQAIAQADSRPLLIVAEDVEDK 62
+S YF TN + + VLE+ F+LI+E + + I+EQ +AQ +PLLI+AEDVE +
Sbjct: 9 ISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQ-VAQT-GKPLLIIAEDVEGE 66
Query: 63 LIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVL 108
+ +L++ K L+ +S+A + K ++ D+A +TGG V+
Sbjct: 67 ALATLVVNK--LRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 110
|
| >3m6c_A 60 kDa chaperonin 1; chaperone, ATP-binding, nucleotide-binding; 2.20A {Mycobacterium tuberculosis} Length = 194 | Back alignment and structure |
|---|
| >3osx_A 60 kDa chaperonin; alpha, beta, apical domain, chaperone; 1.55A {Xenorhabdus nematophila} PDB: 1kid_A 1fy9_A 1la1_A 1fya_A 1jon_A 1dk7_A 1dkd_A Length = 201 | Back alignment and structure |
|---|
| >1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Length = 545 | Back alignment and structure |
|---|
| >1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Length = 547 | Back alignment and structure |
|---|
| >3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Length = 546 | Back alignment and structure |
|---|
| >1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Length = 543 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| 3osx_A | 201 | 60 kDa chaperonin; alpha, beta, apical domain, cha | 100.0 | |
| 3m6c_A | 194 | 60 kDa chaperonin 1; chaperone, ATP-binding, nucle | 100.0 | |
| 1srv_A | 145 | Protein (groel (HSP60 class)); chaperone, cell div | 100.0 | |
| 3rtk_A | 546 | 60 kDa chaperonin 2; heat shock protein, chaperone | 100.0 | |
| 1kp8_A | 547 | Groel protein; chaperonin, assisted protein foldin | 100.0 | |
| 1we3_A | 543 | CPN60(groel); chaperonin, chaperone, groel, HSP60, | 100.0 | |
| 1iok_A | 545 | Chaperonin 60; chaperone; 3.20A {Paracoccus denitr | 100.0 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 99.87 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 99.84 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 99.83 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 99.82 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 99.82 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 99.82 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 99.81 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 99.8 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 99.8 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 99.8 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 99.79 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 99.76 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 99.76 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 99.76 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 99.75 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 99.72 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 99.71 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 99.7 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 99.67 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 99.66 | |
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 99.65 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 99.5 | |
| 1ass_A | 159 | Thermosome; chaperonin, HSP60, TCP1, groel, thermo | 97.85 | |
| 1gml_A | 178 | T-complex protein 1 subunit gamma; chaperone, chap | 97.3 |
| >3osx_A 60 kDa chaperonin; alpha, beta, apical domain, chaperone; 1.55A {Xenorhabdus nematophila} SCOP: c.8.5.1 PDB: 1kid_A 1fy9_A 1la1_A 1fya_A 1jon_A 1dk7_A 1dkd_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-70 Score=444.44 Aligned_cols=152 Identities=24% Similarity=0.367 Sum_probs=149.4
Q ss_pred CccCCccccccc-CCCCCceEEeeCceEEeecccccchHHHHHHH--HhhcCCceEEEecccccchhhhhhcccccCcce
Q 031590 1 MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAI--AQADSRPLLIVAEDVEDKLIGSLILGKTCLQNK 77 (157)
Q Consensus 1 m~fdrGylSpyf-td~~~~~~~le~p~IL~td~kIs~~~~ilp~L--~~~~~rpLlIIAedv~~eaL~tLv~Nk~rg~l~ 77 (157)
|||||||+|||| ||+++|+++|+|||||+||+|||+++|++|+| +++.+||||||||||++|||+|||+||+||+++
T Consensus 15 ~qfDrGYiSPYfvtd~e~m~~~le~p~ILitdkKIs~i~~ilP~LE~v~~~~rpLlIIAEDvegEALatLvvNklrg~l~ 94 (201)
T 3osx_A 15 MQFDRGYLSPYFINKPESGSVELENPYILLVDKKISNIRELLPVLEGVAKASKPLVIIAEDVEGEALATLVVNNMRGIVK 94 (201)
T ss_dssp EEESCCBSCGGGCSBTTTTBEEEESCEEEEEEEEECCHHHHHHHHHHHHTSSCCEEEEEEEECHHHHHHHHHHHHHTSCC
T ss_pred cEecCccCChheeecccCCEEEecCCeEEEEcCccCCHHHHHHHHHHHHHhCCCeEEEeccccchhhhHHHHhhccceEE
Confidence 799999999999 99999999999999999999999999999999 889999999999999999999999999999999
Q ss_pred EE-eecCCCCCchhhHhhhhhhhhhhhCcEEeec---cccCCCCCCCCceeeEEEEeCCceEEEcCCCChHHHHHHHHHh
Q 031590 78 VS-IAKPHEDDYEKETKAIMDDLAILTGGQVLNG---ATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLKKDVHRF 153 (157)
Q Consensus 78 v~-VkaP~~~gfG~~rk~~L~DiAilTGg~vi~~---~~l~~v~~~~LG~a~~v~vtkd~T~i~~g~g~~~~I~~Rv~qi 153 (157)
|| |||| ||||+||++|+||||+|||+||++ ++|+++++++||+|++|+||||+|+|++|.|++++|++||+||
T Consensus 95 v~AVKAP---gFGdrRk~~L~DIAilTGg~visee~g~~Le~~~~~~LG~a~~V~vtkd~TtIv~G~G~~~~I~~Rv~qI 171 (201)
T 3osx_A 95 VASVKAP---GFGDRRKAMLQDIATLTNGTVISEEIGLELEKATLEDLGQAKRVVINKDTTTIIDGVGEEGAIAARVTQI 171 (201)
T ss_dssp EEEEECS---SCHHHHHHHHHHHHHHHTCCCBCGGGTCCGGGCCGGGCEEEEEEEECSSCEEEEEECCCHHHHHHHHHHH
T ss_pred EEEEeCC---CCccchhhhhHhHHHHhCCEEEecccCCccccCCHhhCCCccEEEEcCCceEEecCCCCHHHHHHHHHHH
Confidence 99 9999 999999999999999999999999 8999999999999999999999999999999999999999998
Q ss_pred hh
Q 031590 154 FM 155 (157)
Q Consensus 154 ~~ 155 (157)
-.
T Consensus 172 r~ 173 (201)
T 3osx_A 172 RQ 173 (201)
T ss_dssp HH
T ss_pred HH
Confidence 53
|
| >3m6c_A 60 kDa chaperonin 1; chaperone, ATP-binding, nucleotide-binding; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1srv_A Protein (groel (HSP60 class)); chaperone, cell division, ATP-binding, phosphorylation; 1.70A {Thermus thermophilus} SCOP: c.8.5.1 | Back alignment and structure |
|---|
| >3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A | Back alignment and structure |
|---|
| >1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... | Back alignment and structure |
|---|
| >1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* | Back alignment and structure |
|---|
| >1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* | Back alignment and structure |
|---|
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* | Back alignment and structure |
|---|
| >1ass_A Thermosome; chaperonin, HSP60, TCP1, groel, thermoplasma ACI ATP-binding; 2.30A {Thermoplasma acidophilum} SCOP: c.8.5.2 PDB: 1asx_A | Back alignment and structure |
|---|
| >1gml_A T-complex protein 1 subunit gamma; chaperone, chaperonin, actin, tubulin; 2.2A {Mus musculus} SCOP: c.8.5.2 PDB: 1gn1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 157 | ||||
| d1kida_ | 193 | c.8.5.1 (A:) GroEL, A domain {Escherichia coli [Ta | 7e-17 | |
| d1ioka2 | 176 | c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus de | 1e-16 | |
| d1srva_ | 145 | c.8.5.1 (A:) GroEL, A domain {Thermus thermophilus | 2e-16 | |
| d1sjpa2 | 184 | c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium | 5e-15 |
| >d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} Length = 193 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: The "swivelling" beta/beta/alpha domain superfamily: GroEL apical domain-like family: GroEL-like chaperone, apical domain domain: GroEL, A domain species: Escherichia coli [TaxId: 562]
Score = 71.7 bits (176), Expect = 7e-17
Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 12/126 (9%)
Query: 8 VSSYF-TNQKAKDCVLENPFLLILENMIVSK----NIVEQAIAQADSRPLLIVAEDVEDK 62
+S YF + LE+PF+L+ + I + ++E +PLLI+AEDVE +
Sbjct: 17 LSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKA--GKPLLIIAEDVEGE 74
Query: 63 LIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPL--- 119
+ +L++ KV+ K + KA++ D+A LTGG V++ +
Sbjct: 75 ALATLVVNTMRGIVKVAAVKAPG--FGDRRKAMLQDIATLTGGTVISEEIGMELEKATLE 132
Query: 120 MLGSCK 125
LG K
Sbjct: 133 DLGQAK 138
|
| >d1ioka2 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]} Length = 176 | Back information, alignment and structure |
|---|
| >d1srva_ c.8.5.1 (A:) GroEL, A domain {Thermus thermophilus [TaxId: 274]} Length = 145 | Back information, alignment and structure |
|---|
| >d1sjpa2 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 184 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| d1ioka2 | 176 | GroEL, A domain {Paracoccus denitrificans [TaxId: | 100.0 | |
| d1sjpa2 | 184 | GroEL, A domain {Mycobacterium tuberculosis, GroEL | 100.0 | |
| d1kida_ | 193 | GroEL, A domain {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1srva_ | 145 | GroEL, A domain {Thermus thermophilus [TaxId: 274] | 100.0 | |
| d1sjpa3 | 89 | GroEL, I domain {Mycobacterium tuberculosis, GroEL | 98.93 | |
| d1q3qa2 | 153 | Thermosome, A-domain {Archaeon Thermococcus sp. ks | 98.19 | |
| d1assa_ | 152 | Thermosome, A-domain {Archaeon Thermoplasma acidop | 98.0 | |
| d1a6db2 | 152 | Thermosome, A-domain {Archaeon Thermoplasma acidop | 97.96 | |
| d1we3a3 | 86 | GroEL, I domain {Thermus thermophilus [TaxId: 274] | 97.58 | |
| d1gmla_ | 168 | Thermosome, A-domain {Mouse (Mus musculus), gamma | 97.57 | |
| d1kp8a3 | 97 | GroEL, I domain {Escherichia coli [TaxId: 562]} | 97.33 | |
| d1ioka3 | 97 | GroEL, I domain {Paracoccus denitrificans [TaxId: | 97.24 | |
| d1ioka1 | 252 | GroEL, E domain {Paracoccus denitrificans [TaxId: | 96.84 | |
| d1kp8a1 | 252 | GroEL, E domain {Escherichia coli [TaxId: 562]} | 96.45 |
| >d1ioka2 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: The "swivelling" beta/beta/alpha domain superfamily: GroEL apical domain-like family: GroEL-like chaperone, apical domain domain: GroEL, A domain species: Paracoccus denitrificans [TaxId: 266]
Probab=100.00 E-value=2.8e-62 Score=387.64 Aligned_cols=152 Identities=28% Similarity=0.384 Sum_probs=112.0
Q ss_pred CccCCccccccc-CCCCCceEEeeCceEEeecccccchHHHHHHH--HhhcCCceEEEecccccchhhhhhcccccCcce
Q 031590 1 MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAI--AQADSRPLLIVAEDVEDKLIGSLILGKTCLQNK 77 (157)
Q Consensus 1 m~fdrGylSpyf-td~~~~~~~le~p~IL~td~kIs~~~~ilp~L--~~~~~rpLlIIAedv~~eaL~tLv~Nk~rg~l~ 77 (157)
|+|||||+|||| ||+++|+|+|+|||||+||+||+++++|+|+| +.+.+|||||||+||++|||++|++|+++|+++
T Consensus 3 ~~~d~Gy~SpyFvtd~~~~~~~l~np~ILi~d~kI~~~~~i~p~Le~~~~~~~PLlIIA~di~~~aL~~Lv~N~~~g~l~ 82 (176)
T d1ioka2 3 MQFDRGYLSPYFVTNADKMIAELEDAYILLHEKKLSSLQPMVPLLESVIQSQKPLLIVAEDVEGEALATLVVNKLRGGLK 82 (176)
T ss_dssp EECSCCCSCGGGCCCSSSSCEEEEEEEEEECSSCBCCCCC-----------CCCCEEEESCBC-----------------
T ss_pred cccccCccCccceeCCcCCEEEeeCcEEEEEccccCcHHHHHHHHHHHHhcCCcEEEEecCCCHHHHHHHHHHHhcCCce
Confidence 799999999999 99999999999999999999999999999999 888999999999999999999999999999999
Q ss_pred EE-eecCCCCCchhhHhhhhhhhhhhhCcEEeec---cccCCCCCCCCceeeEEEEeCCceEEEcCCCChHHHHHHHHHh
Q 031590 78 VS-IAKPHEDDYEKETKAIMDDLAILTGGQVLNG---ATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLKKDVHRF 153 (157)
Q Consensus 78 v~-VkaP~~~gfG~~rk~~L~DiAilTGg~vi~~---~~l~~v~~~~LG~a~~v~vtkd~T~i~~g~g~~~~I~~Rv~qi 153 (157)
|| |||| |||++|+++|+|||++|||++|++ .+++++++++||+|++|+||||+|+|++|+|+++.|++||++|
T Consensus 83 v~aVkaP---~fG~~r~~~LeDlA~~tGa~vi~~~~g~~l~~~~~~~LG~a~kv~vtk~~T~ii~g~g~~~~i~~Ri~~L 159 (176)
T d1ioka2 83 IAAVKAP---GFGDRRKAMLQDIAILTGGQVISEDLGMKLENVTIDMLGRAKKVSINKDNTTIVDGAGEKAEIEARVSQI 159 (176)
T ss_dssp CEEEECS---CCTTHHHHHHHHHHHHHTC---------------CTTSEEEEEEEECSSCEEEESCCCCHHHHHHHHHHH
T ss_pred EEEEeCC---CCCcHHHHHHHHHHHhhCCEEEecccCCChhhCCHHHCceeeEEEEecCceEEEcCCCCHHHHHHHHHHH
Confidence 99 9999 999999999999999999999998 8899999999999999999999999999999999999999998
Q ss_pred hh
Q 031590 154 FM 155 (157)
Q Consensus 154 ~~ 155 (157)
-.
T Consensus 160 k~ 161 (176)
T d1ioka2 160 RQ 161 (176)
T ss_dssp HH
T ss_pred HH
Confidence 53
|
| >d1sjpa2 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1srva_ c.8.5.1 (A:) GroEL, A domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sjpa3 d.56.1.1 (A:135-188,A:373-407) GroEL, I domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q3qa2 c.8.5.2 (A:217-369) Thermosome, A-domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} | Back information, alignment and structure |
|---|
| >d1assa_ c.8.5.2 (A:) Thermosome, A-domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1a6db2 c.8.5.2 (B:216-367) Thermosome, A-domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1we3a3 d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gmla_ c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ioka3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|