Citrus Sinensis ID: 031614

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MACRGLMPSVCCFMFGLAFLAASAAAAEYKLHWIVPTSADYYTNWISNKTFEVGDSVMFNWSTTHNVADVSKSEYDDCSKTSSVVASHPVQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSGNDTSSASFVSVGALYPGLAISLVYFLSYYYYI
cccccHHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHccccEEEEccEEEEEEcccccEEEEcHHHHccccccccccccccEEEEEcccccEEEEcccccccccccEEEEEEccccccccccccccccccccccHHHHHHHHHEEEEc
ccHHHHHHHHHHHHHHHHHHHccHEEcccccccccccccccHHHHHcccEEEEccEEEEEEcccccEEEEcHHHHHHcccccccccccccEEEEcccccEEEEEccccccccccEEEEEccEccccccHHHHHHHHHHccccHHHHHHHHHHHHHc
macrglmpsvccFMFGLAFLAASAAAAEYKLHwivptsadyytnwisnktfevgdsvmfnwstthnvadvskseyddcsktssvvashpvqiqlnstgsryfictvddhcgrgqKLAITVknsgndtssasfvSVGALYPGLAISLVYFLSYYYYI
MACRGLMPSVCCFMFGLAFLAASAAAAEYKLHWIVPTSADYYTNWISNKTFEVGDSVMFNWSTTHNVADVSKSEYDDCSKTSSVVASHPVQIQLNSTGSRYFICTVDDHCGRGQKLAITVknsgndtsSASFVSVGALYPGLAISLVYFLSYYYYI
MACRGLMPSVCCFMFGlaflaasaaaaEYKLHWIVPTSADYYTNWISNKTFEVGDSVMFNWSTTHNVADVSKSEYDDCSKTSSVVASHPVQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSGNDTSSASFVSVGALYPGLAISLVYFLSYYYYI
****GLMPSVCCFMFGLAFLAASAAAAEYKLHWIVPTSADYYTNWISNKTFEVGDSVMFNWSTTHNVADVSKSEYDDC****SVVASHPVQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSGNDTSSASFVSVGALYPGLAISLVYFLSYYYY*
******MPSVCCFMFGLAFLAASAAAAEYKLHWIVPTSADYYTNWISNKTFEVGDSVMFNWSTTHNVADVSKSEYDDCSKTSSVVASHPVQIQLNSTGSRYFICTVDDHCGRGQKLAI*****************************YFLSYYYYI
MACRGLMPSVCCFMFGLAFLAASAAAAEYKLHWIVPTSADYYTNWISNKTFEVGDSVMFNWSTTHNVADV****************SHPVQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSGNDTSSASFVSVGALYPGLAISLVYFLSYYYYI
**CRGLMPSVCCFMFGLAFLAASAAAAEYKLHWIVPTSADYYTNWISNKTFEVGDSVMFNWSTTHNVADVSKSEYDDCSKTSSVVASHPVQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSGNDTSSASFVSVGALYPGLAISLVYFLSYYYYI
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHii
iiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiii
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACRGLMPSVCCFMFGLAFLAASAAAAEYKLHWIVPTSADYYTNWISNKTFEVGDSVMFNWSTTHNVADVSKSEYDDCSKTSSVVASHPVQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSGNDTSSASFVSVGALYPGLAISLVYFLSYYYYI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
Q07488196 Blue copper protein OS=Ar yes no 0.583 0.464 0.459 3e-19
P42849115 Umecyanin OS=Armoracia ru N/A no 0.576 0.782 0.430 2e-17
P29602137 Cucumber peeling cupredox N/A no 0.564 0.642 0.430 3e-14
Q41001189 Blue copper protein OS=Pi N/A no 0.698 0.576 0.361 1e-11
Q9SK27182 Early nodulin-like protei no no 0.685 0.587 0.318 4e-11
O80517202 Uclacyanin-2 OS=Arabidops no no 0.628 0.485 0.352 1e-10
P00302107 Stellacyanin OS=Toxicoden N/A no 0.564 0.822 0.376 1e-10
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.506 0.731 0.365 7e-09
P93328180 Early nodulin-16 OS=Medic N/A no 0.743 0.644 0.272 2e-07
P60496126 Chemocyanin OS=Lilium lon N/A no 0.487 0.603 0.4 3e-07
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function desciption
 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 64/98 (65%), Gaps = 7/98 (7%)

Query: 32  HWIVPTSADYYTNWISNKTFEVGDSVMFNWST-THNVADVSKSEYDDCSKTSSVVASH-- 88
            W  P   ++YT W + KTF VGD + F+++   H+VA VS++ +++C K   +  SH  
Sbjct: 32  EWTRPMDPEFYTTWATGKTFRVGDELEFDFAAGRHDVAVVSEAAFENCEKEKPI--SHMT 89

Query: 89  --PVQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSG 124
             PV+I LN+TG +YFICTV DHC  GQKL+ITV  +G
Sbjct: 90  VPPVKIMLNTTGPQYFICTVGDHCRFGQKLSITVVAAG 127
Probably acts as an electron carrier.
Arabidopsis thaliana (taxid: 3702)
>sp|P42849|UMEC_ARMRU Umecyanin OS=Armoracia rusticana PE=1 SV=1 Back     alignment and function description
>sp|P29602|CPC_CUCSA Cucumber peeling cupredoxin OS=Cucumis sativus PE=1 SV=3 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|O80517|BCB2_ARATH Uclacyanin-2 OS=Arabidopsis thaliana GN=At2g44790 PE=1 SV=1 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function description
>sp|P93328|NO16_MEDTR Early nodulin-16 OS=Medicago truncatula GN=ENOD16 PE=3 SV=1 Back     alignment and function description
>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
255572513163 Cucumber peeling cupredoxin, putative [R 0.858 0.822 0.414 3e-22
224144188186 predicted protein [Populus trichocarpa] 0.660 0.553 0.481 9e-21
255572511164 Blue copper protein precursor, putative 0.974 0.926 0.355 2e-20
147780458153 hypothetical protein VITISV_018635 [Viti 0.910 0.928 0.362 1e-19
225445551153 PREDICTED: umecyanin [Vitis vinifera] gi 0.910 0.928 0.362 1e-19
312283371194 unnamed protein product [Thellungiella h 0.557 0.448 0.510 2e-19
319433445200 copper binding protein 5 [Gossypium hirs 0.621 0.485 0.46 2e-18
224144176159 predicted protein [Populus trichocarpa] 0.75 0.735 0.379 5e-18
10798754184 NtEIG-A1 [Nicotiana tabacum] 0.583 0.494 0.479 6e-18
22414418499 predicted protein [Populus trichocarpa] 0.564 0.888 0.505 8e-18
>gi|255572513|ref|XP_002527191.1| Cucumber peeling cupredoxin, putative [Ricinus communis] gi|223533456|gb|EEF35204.1| Cucumber peeling cupredoxin, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 88/147 (59%), Gaps = 13/147 (8%)

Query: 17  LAFLAASAAAAEYK----LHWIVPTSADYYTNWISNKTFEVGDSVMFNWSTTHNVADV-S 71
           L  L ++AAA ++     + W VP++A +Y  W S+KTF+VGDS++FNWS  HNV +V S
Sbjct: 13  LPLLDSTAAATKFTVGDGIGWAVPSNASFYDEWASDKTFQVGDSIVFNWSEVHNVLEVTS 72

Query: 72  KSEYDDCSKTSSVV-ASHPVQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNS------- 123
           KSEYD+C+ T+ ++  + PV I L +  + YFICTV  HC  GQK+ I V N        
Sbjct: 73  KSEYDNCTTTNGILRQTSPVTIDLTANSTLYFICTVGQHCALGQKVTIKVGNGISSPSPS 132

Query: 124 GNDTSSASFVSVGALYPGLAISLVYFL 150
               S+    S  AL+  L  +++YFL
Sbjct: 133 SPSNSANPSCSATALFTVLTAAVIYFL 159

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224144188|ref|XP_002325213.1| predicted protein [Populus trichocarpa] gi|222866647|gb|EEF03778.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255572511|ref|XP_002527190.1| Blue copper protein precursor, putative [Ricinus communis] gi|223533455|gb|EEF35203.1| Blue copper protein precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147780458|emb|CAN60010.1| hypothetical protein VITISV_018635 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225445551|ref|XP_002285305.1| PREDICTED: umecyanin [Vitis vinifera] gi|297738973|emb|CBI28218.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|312283371|dbj|BAJ34551.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|319433445|gb|ADV57640.1| copper binding protein 5 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224144176|ref|XP_002325209.1| predicted protein [Populus trichocarpa] gi|222866643|gb|EEF03774.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|10798754|dbj|BAB16429.1| NtEIG-A1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224144184|ref|XP_002325212.1| predicted protein [Populus trichocarpa] gi|222866646|gb|EEF03777.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
TAIR|locus:2149249196 BCB "blue-copper-binding prote 0.576 0.459 0.463 6.5e-19
TAIR|locus:2009552174 AT1G22480 [Arabidopsis thalian 0.628 0.563 0.384 1.3e-15
TAIR|locus:2081952187 AT3G60270 [Arabidopsis thalian 0.506 0.422 0.395 1e-13
TAIR|locus:4010713753106 AT3G17675 [Arabidopsis thalian 0.506 0.745 0.426 5.6e-13
TAIR|locus:2042426202 UCC2 "uclacyanin 2" [Arabidops 0.570 0.440 0.375 2.4e-12
TAIR|locus:2081957222 UCC3 "uclacyanin 3" [Arabidops 0.576 0.405 0.347 2.4e-12
TAIR|locus:4010713954145 ENODL21 "early nodulin-like pr 0.769 0.827 0.310 3.1e-12
TAIR|locus:2086518174 AT3G27200 [Arabidopsis thalian 0.583 0.522 0.360 5e-12
TAIR|locus:2206986181 AT1G72230 [Arabidopsis thalian 0.576 0.497 0.340 6.4e-12
TAIR|locus:504956334192 AT5G07475 [Arabidopsis thalian 0.621 0.505 0.336 8.2e-12
TAIR|locus:2149249 BCB "blue-copper-binding protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 6.5e-19, P = 6.5e-19
 Identities = 45/97 (46%), Positives = 64/97 (65%)

Query:    33 WIVPTSADYYTNWISNKTFEVGDSVMFNWST-THNVADVSKSEYDDCSKTSSVVASH--- 88
             W  P   ++YT W + KTF VGD + F+++   H+VA VS++ +++C K   +  SH   
Sbjct:    33 WTRPMDPEFYTTWATGKTFRVGDELEFDFAAGRHDVAVVSEAAFENCEKEKPI--SHMTV 90

Query:    89 -PVQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSG 124
              PV+I LN+TG +YFICTV DHC  GQKL+ITV  +G
Sbjct:    91 PPVKIMLNTTGPQYFICTVGDHCRFGQKLSITVVAAG 127
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009611 "response to wounding" evidence=IEP;RCA
GO:0006979 "response to oxidative stress" evidence=RCA;TAS
GO:0015690 "aluminum cation transport" evidence=IMP
GO:0031225 "anchored to membrane" evidence=TAS
GO:0046658 "anchored to plasma membrane" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP
GO:0009620 "response to fungus" evidence=RCA
GO:0009646 "response to absence of light" evidence=IEP;RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
TAIR|locus:2009552 AT1G22480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081952 AT3G60270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713753 AT3G17675 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042426 UCC2 "uclacyanin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081957 UCC3 "uclacyanin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713954 ENODL21 "early nodulin-like protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086518 AT3G27200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206986 AT1G72230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956334 AT5G07475 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016926001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (153 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 5e-22
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 9e-09
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score = 83.5 bits (207), Expect = 5e-22
 Identities = 36/85 (42%), Positives = 49/85 (57%), Gaps = 4/85 (4%)

Query: 33  WIVPTSADYYTNWISNKTFEVGDSVMFNWST-THNVADVSKSEYDDCSKTS--SVVASHP 89
           W VP +ADY T W S KTF VGD+++FN+    HNV +V+K++Y+ C+ +       +  
Sbjct: 1   WTVPLNADY-TLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPIRTYTTGN 59

Query: 90  VQIQLNSTGSRYFICTVDDHCGRGQ 114
             I L   G  YFIC V  HC  GQ
Sbjct: 60  DIIPLTKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.97
PRK02710119 plastocyanin; Provisional 98.61
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.46
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.23
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 98.07
COG3794128 PetE Plastocyanin [Energy production and conversio 98.0
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 97.93
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.44
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.08
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.83
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 96.52
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 95.84
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 95.29
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 94.69
COG4454158 Uncharacterized copper-binding protein [Inorganic 94.15
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 91.25
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 91.2
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 90.68
PRK02888635 nitrous-oxide reductase; Validated 89.04
PLN02604 566 oxidoreductase 88.47
PLN02354 552 copper ion binding / oxidoreductase 84.8
TIGR02866201 CoxB cytochrome c oxidase, subunit II. Cytochrome 83.3
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 80.55
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 80.46
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.2e-39  Score=251.05  Aligned_cols=106  Identities=31%  Similarity=0.530  Sum_probs=96.0

Q ss_pred             HHHHhhhhhhhhhc----cCcccCCCccchhcccCCCeEEeCCEEEEeecC-CCeeEEeCcccCCCCCCCCcc--ccCCc
Q 031614           17 LAFLAASAAAAEYK----LHWIVPTSADYYTNWISNKTFEVGDSVMFNWST-THNVADVSKSEYDDCSKTSSV--VASHP   89 (156)
Q Consensus        17 ~~~l~~~a~A~~~~----~gW~~~~~~~~Y~~Wa~~~tF~vGD~L~F~y~~-~H~V~~V~~~~y~~C~~~~~~--~~~G~   89 (156)
                      ++++...++|++|+    .||+.+.|   |++|+++++|++||+|+|+|++ .|||+||++++|++|+.++++  +++|+
T Consensus        11 ~~~~~~~~~a~~~~VGd~~GW~~~~~---Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~~~tsG~   87 (167)
T PLN03148         11 ALFSASATTATDHIVGANKGWNPGIN---YTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAGNWTSGK   87 (167)
T ss_pred             HHHhhhhccceEEEeCCCCCcCCCCC---hhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCcceecCCC
Confidence            33455677888999    68997777   9999999999999999999998 799999999999999999998  99999


Q ss_pred             eEEEeCCcccEEEEcCCCCCcCCCCeEEEEecCCCCC
Q 031614           90 VQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSGND  126 (156)
Q Consensus        90 ~~v~L~~~G~~YFiC~v~~hC~~GmKl~I~V~~~~~~  126 (156)
                      +.|+|+++|++||||+ ++||++|||+.|+|.+.+||
T Consensus        88 d~v~L~~~G~~YFIcg-~ghC~~GmKl~I~V~~~~~p  123 (167)
T PLN03148         88 DFIPLNKAKRYYFICG-NGQCFNGMKVTILVHPLPPP  123 (167)
T ss_pred             cEEEecCCccEEEEcC-CCccccCCEEEEEEcCCCCC
Confidence            9999999999999999 69999999999999876543

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>TIGR02866 CoxB cytochrome c oxidase, subunit II Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 2e-18
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 3e-15
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 6e-10
1f56_A91 Spinach Plantacyanin Length = 91 2e-07
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 2e-06
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure 
Iteration: 1

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 61/93 (65%), Gaps = 3/93 (3%)
Query: 31  LHWIVPTSADYYTNWISNKTFEVGDSVMFNWST-THNVADVSKSEYDDCSKTSSV--VAS 87
           + W  P+   +Y  W + KTF VGD + F+++   H+VA V+K  +D+C K + +  + +
Sbjct: 10  MEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHMTT 69
Query: 88  HPVQIQLNSTGSRYFICTVDDHCGRGQKLAITV 120
            PV+I LN+TG +Y+ICTV DHC  GQKL+I V
Sbjct: 70  PPVKIMLNTTGPQYYICTVGDHCRVGQKLSINV 102
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 6e-29
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 4e-26
1jer_A138 Cucumber stellacyanin; electron transport, copper, 1e-25
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 7e-25
2cbp_A96 Cucumber basic protein; electron transport, phytoc 2e-20
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
 Score =  101 bits (254), Expect = 6e-29
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 3/102 (2%)

Query: 33  WIVPTSADYYTNWISNKTFEVGDSVMFNWST-THNVADVSKSEYDDCSKTSSVVASH--P 89
           W  P+   +Y  W + KTF VGD + F+++   H+VA V+K  +D+C K + +      P
Sbjct: 12  WKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHMTTPP 71

Query: 90  VQIQLNSTGSRYFICTVDDHCGRGQKLAITVKNSGNDTSSAS 131
           V+I LN+TG +Y+ICTV DHC  GQKL+I V  +G     A+
Sbjct: 72  VKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGAGGAGGGAT 113
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 99.97
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.21
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.14
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.11
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.93
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.89
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.85
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.82
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.82
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.79
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.78
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.75
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.73
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.72
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.68
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.63
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.61
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.43
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.4
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.36
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 98.19
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.11
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 98.09
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.95
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 97.93
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.89
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 97.65
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.64
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.53
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.53
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.52
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 97.3
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 97.25
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 97.22
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 96.66
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 96.23
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 96.22
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 96.04
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 95.87
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 95.51
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 95.28
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 95.11
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 94.44
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 93.22
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=2.4e-37  Score=235.37  Aligned_cols=100  Identities=38%  Similarity=0.762  Sum_probs=92.5

Q ss_pred             hhhhhc----cCcccCCCccchhcccCCCeEEeCCEEEEeecC-CCeeEEe-CcccCCCCCCCCcc--ccCCceEEEe-C
Q 031614           25 AAAEYK----LHWIVPTSADYYTNWISNKTFEVGDSVMFNWST-THNVADV-SKSEYDDCSKTSSV--VASHPVQIQL-N   95 (156)
Q Consensus        25 ~A~~~~----~gW~~~~~~~~Y~~Wa~~~tF~vGD~L~F~y~~-~H~V~~V-~~~~y~~C~~~~~~--~~~G~~~v~L-~   95 (156)
                      +|++|+    .||+++++..+|++|+++++|++||+|+|+|.+ .|+|+|| ++++|+.|+.++++  +++|+++|+| +
T Consensus         2 ~a~~~~VGg~~GW~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~p~~~~~~G~~~v~L~~   81 (138)
T 1jer_A            2 QSTVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLD   81 (138)
T ss_dssp             CCCEEETTGGGCSSCCSSTTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTTSCCCCCCCSCEEEECC
T ss_pred             CceEEEECCcCcCcCCCCccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCCccccccCCCeEEEecc
Confidence            467777    789999544569999999999999999999997 7999999 99999999999998  8999999999 9


Q ss_pred             CcccEEEEcCCCCCcCCCCeEEEEecCCC
Q 031614           96 STGSRYFICTVDDHCGRGQKLAITVKNSG  124 (156)
Q Consensus        96 ~~G~~YFiC~v~~hC~~GmKl~I~V~~~~  124 (156)
                      ++|++||||++++||++||||+|+|.+..
T Consensus        82 ~~G~~YFicg~~gHC~~GmKl~I~V~~~~  110 (138)
T 1jer_A           82 ELGMHYFVCTVGTHCSNGQKLSINVVAAN  110 (138)
T ss_dssp             SSEEEEEECCSTTTGGGTCEEEEEEECCC
T ss_pred             CCcCEEEEcCCCCccccCCEEEEEEcCCC
Confidence            99999999999999999999999998765
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 7e-25
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 3e-24
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 7e-23
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 1e-21
d1pmya_123 b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorq 2e-05
d1paza_120 b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, s 7e-04
d1bxua_91 b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synecho 0.001
d1bqka_124 b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclas 0.002
d1adwa_123 b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha 0.003
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

 Score = 90.1 bits (223), Expect = 7e-25
 Identities = 34/102 (33%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 26  AAEYK----LHWIVPTSADYYTNWISNKTFEVGDSVMFNWST-THNVADVSKSEYDDC-- 78
           A  +K      W      DY   W S+  F VGDS++FN++   HNV  V + ++  C  
Sbjct: 2   ATVHKVGDSTGWTTLVPYDYAK-WASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS 60

Query: 79  SKTSSVVASHPVQIQLNSTGSRYFICTVDDHCGRGQKLAITV 120
           S  ++   S    I L   G+ YF+C +  HC  GQK+ I V
Sbjct: 61  SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKV 102
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Length = 123 Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Length = 120 Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Length = 91 Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Length = 124 Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Length = 123 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.97
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.82
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.8
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.79
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.78
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.77
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.73
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.71
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.69
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.66
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.66
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.62
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.62
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.58
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.54
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.52
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.42
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 98.15
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.63
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.6
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.42
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 97.38
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 97.07
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 96.87
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 96.65
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 96.63
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 96.59
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 96.1
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 94.6
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 94.41
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 93.61
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 92.23
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 90.39
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 88.66
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 87.55
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 86.56
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 85.61
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 85.56
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 85.27
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

Probab=100.00  E-value=3.4e-35  Score=211.79  Aligned_cols=96  Identities=34%  Similarity=0.679  Sum_probs=89.2

Q ss_pred             hhhhc----cCcccCCCccchhcccCCCeEEeCCEEEEeecC-CCeeEEeCcccCCCCCCCCcc--ccCCceEEEeCCcc
Q 031614           26 AAEYK----LHWIVPTSADYYTNWISNKTFEVGDSVMFNWST-THNVADVSKSEYDDCSKTSSV--VASHPVQIQLNSTG   98 (156)
Q Consensus        26 A~~~~----~gW~~~~~~~~Y~~Wa~~~tF~vGD~L~F~y~~-~H~V~~V~~~~y~~C~~~~~~--~~~G~~~v~L~~~G   98 (156)
                      |++|+    .||+.+++ ..|++|+++++|++||+|+|+|.+ .|+|+||++++|++|+.++++  +++|++.|+|+++|
T Consensus         2 at~~~VGg~~gW~~~~~-~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~~~y~~C~~~~~~~~~~~G~~~v~l~~~g   80 (104)
T d1ws8a_           2 ATVHKVGDSTGWTTLVP-YDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRPG   80 (104)
T ss_dssp             CCEEETTGGGCSCSSSC-CCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSSCSEEECSSEEEEECCSSE
T ss_pred             CcEEEeCCcCccCcCCC-cCHHHHhhCCcCCCCCEEEEEECCCCceEEEECHHHhcCCcCCCccccccCCCeEEEEecCc
Confidence            67777    89998763 239999999999999999999999 799999999999999999988  89999999999999


Q ss_pred             cEEEEcCCCCCcCCCCeEEEEecC
Q 031614           99 SRYFICTVDDHCGRGQKLAITVKN  122 (156)
Q Consensus        99 ~~YFiC~v~~hC~~GmKl~I~V~~  122 (156)
                      ++||+|++++||++|||+.|+|++
T Consensus        81 ~~yF~C~~~~HC~~Gmkl~I~V~P  104 (104)
T d1ws8a_          81 TFYFLCGIPGHCQLGQKVEIKVDP  104 (104)
T ss_dssp             EEEEECCSTTTTTTTCEEEEEECC
T ss_pred             cEEEECCCcchhhCCCEEEEEECC
Confidence            999999999999999999999974
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure