Citrus Sinensis ID: 031621
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 156 | ||||||
| 224080075 | 156 | predicted protein [Populus trichocarpa] | 0.993 | 0.993 | 0.808 | 1e-66 | |
| 255553935 | 190 | acyl-CoA thioesterase, putative [Ricinus | 0.955 | 0.784 | 0.802 | 3e-62 | |
| 297848650 | 155 | thioesterase family protein [Arabidopsis | 0.987 | 0.993 | 0.687 | 7e-55 | |
| 18379308 | 155 | thioesterase-like protein [Arabidopsis t | 0.980 | 0.987 | 0.696 | 1e-54 | |
| 13605902 | 155 | At1g04290/F19P19_27 [Arabidopsis thalian | 0.967 | 0.974 | 0.705 | 2e-54 | |
| 224080079 | 156 | predicted protein [Populus trichocarpa] | 0.993 | 0.993 | 0.668 | 2e-53 | |
| 387965711 | 155 | putative acyl-CoA thioesterase [Beta vul | 0.980 | 0.987 | 0.664 | 9e-53 | |
| 225463215 | 154 | PREDICTED: acyl-coenzyme A thioesterase | 0.980 | 0.993 | 0.713 | 2e-52 | |
| 356508896 | 154 | PREDICTED: acyl-coenzyme A thioesterase | 0.967 | 0.980 | 0.672 | 1e-51 | |
| 255637680 | 154 | unknown [Glycine max] | 0.967 | 0.980 | 0.660 | 9e-51 |
| >gi|224080075|ref|XP_002306007.1| predicted protein [Populus trichocarpa] gi|118484695|gb|ABK94218.1| unknown [Populus trichocarpa] gi|222848971|gb|EEE86518.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 257 bits (656), Expect = 1e-66, Method: Compositional matrix adjust.
Identities = 127/157 (80%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
Query: 1 MELESVKRYLEKGGGGDDDKNKSTMEEMPTKFFERFIMQGLRVDLSEPGRVICSMKVPPR 60
M+LESVKRYLE GG ++DKN ST+E+MP +FFERFIMQGL +DL EPGRV+CSMKVPPR
Sbjct: 1 MDLESVKRYLETGGY-EEDKNASTIEKMPLRFFERFIMQGLHIDLIEPGRVVCSMKVPPR 59
Query: 61 LLNAGNFMHGGATATLVDLVGSAAIFTVGAPSVGVSVEINVSYLDAAFGG-EIEIEAKVL 119
LLN GNF+HGGATATLVDLVGSAAIFTVGAP+ GVSVEINVSYLDAAF EIEIEA+VL
Sbjct: 60 LLNGGNFLHGGATATLVDLVGSAAIFTVGAPATGVSVEINVSYLDAAFADEEIEIEARVL 119
Query: 120 RVGKAVAVVSVELRKKDTGKIVAQGRHTKYLAISSKM 156
RVGKAV VVSVEL+KK TGKI+AQGRHTKYLA+ SK+
Sbjct: 120 RVGKAVGVVSVELKKKKTGKIIAQGRHTKYLAVPSKL 156
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255553935|ref|XP_002518008.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223542990|gb|EEF44526.1| acyl-CoA thioesterase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297848650|ref|XP_002892206.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata] gi|297338048|gb|EFH68465.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18379308|ref|NP_563705.1| thioesterase-like protein [Arabidopsis thaliana] gi|1903364|gb|AAB70447.1| EST gb|T45093 comes from this gene [Arabidopsis thaliana] gi|21617885|gb|AAM66935.1| unknown [Arabidopsis thaliana] gi|332189558|gb|AEE27679.1| thioesterase-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|13605902|gb|AAK32936.1|AF367350_1 At1g04290/F19P19_27 [Arabidopsis thaliana] gi|18491135|gb|AAL69536.1| At1g04290/F19P19_27 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224080079|ref|XP_002306008.1| predicted protein [Populus trichocarpa] gi|222848972|gb|EEE86519.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|387965711|gb|AFK13840.1| putative acyl-CoA thioesterase [Beta vulgaris subsp. vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|225463215|ref|XP_002271479.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Vitis vinifera] gi|296084814|emb|CBI27696.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356508896|ref|XP_003523189.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255637680|gb|ACU19163.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 156 | ||||||
| TAIR|locus:2018294 | 155 | AT1G04290 "AT1G04290" [Arabido | 0.980 | 0.987 | 0.683 | 7.4e-50 | |
| UNIPROTKB|F1NW39 | 113 | ACOT13 "Uncharacterized protei | 0.673 | 0.929 | 0.462 | 1.1e-21 | |
| UNIPROTKB|Q9NPJ3 | 140 | ACOT13 "Acyl-coenzyme A thioes | 0.737 | 0.821 | 0.471 | 2.4e-21 | |
| UNIPROTKB|F1RUE0 | 114 | ACOT13 "Uncharacterized protei | 0.647 | 0.885 | 0.5 | 2.7e-20 | |
| MGI|MGI:1914084 | 140 | Acot13 "acyl-CoA thioesterase | 0.737 | 0.821 | 0.438 | 3.5e-20 | |
| RGD|1306513 | 140 | Acot13 "acyl-CoA thioesterase | 0.737 | 0.821 | 0.421 | 9.2e-20 | |
| UNIPROTKB|A6QQ83 | 155 | THEM2 "THEM2 protein" [Bos tau | 0.833 | 0.838 | 0.408 | 5.1e-19 | |
| TAIR|locus:2043002 | 158 | AT2G29590 [Arabidopsis thalian | 0.967 | 0.955 | 0.356 | 4.6e-18 | |
| UNIPROTKB|G4MWY3 | 171 | MGG_15637 "Uncharacterized pro | 0.666 | 0.608 | 0.401 | 4.9e-14 | |
| UNIPROTKB|P34419 | 169 | F42H10.6 "Putative esterase F4 | 0.730 | 0.674 | 0.362 | 1e-13 |
| TAIR|locus:2018294 AT1G04290 "AT1G04290" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 519 (187.8 bits), Expect = 7.4e-50, P = 7.4e-50
Identities = 108/158 (68%), Positives = 124/158 (78%)
Query: 1 MELESVKRYLEKXXXXXXXKNKSTM-EEMPTKFFERFIMQGLRVDLSEPGRVICSMKVPP 59
M+LESVK+YLE K K M ++P +F ERF+ GL+VDL EPGR++CSMK+PP
Sbjct: 1 MDLESVKKYLE---GDEDEKAKEPMVAKLPHRFLERFVTNGLKVDLIEPGRIVCSMKIPP 57
Query: 60 RLLNAGNFMHGGATATLVDLVGSAAIFTVGAPSVGVSVEINVSYLDAAF-GGEIEIEAKV 118
LLNAG F+HGGATATLVDL+GSA I+T GA GVSVEINVSYLDAAF EIEIE+K
Sbjct: 58 HLLNAGKFLHGGATATLVDLIGSAVIYTAGASHSGVSVEINVSYLDAAFLDEEIEIESKA 117
Query: 119 LRVGKAVAVVSVELRKKDTGKIVAQGRHTKYLAISSKM 156
LRVGKAVAVVSVELRKK TGKI+AQGRHTKY A S +
Sbjct: 118 LRVGKAVAVVSVELRKKTTGKIIAQGRHTKYFAPRSNL 155
|
|
| UNIPROTKB|F1NW39 ACOT13 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NPJ3 ACOT13 "Acyl-coenzyme A thioesterase 13" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RUE0 ACOT13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914084 Acot13 "acyl-CoA thioesterase 13" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1306513 Acot13 "acyl-CoA thioesterase 13" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QQ83 THEM2 "THEM2 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043002 AT2G29590 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MWY3 MGG_15637 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P34419 F42H10.6 "Putative esterase F42H10.6" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00040996 | SubName- Full=Putative uncharacterized protein; (156 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 156 | |||
| cd03443 | 113 | cd03443, PaaI_thioesterase, PaaI_thioesterase is a | 5e-31 | |
| COG2050 | 141 | COG2050, PaaI, HGG motif-containing thioesterase, | 5e-24 | |
| cd03440 | 100 | cd03440, hot_dog, The hotdog fold was initially id | 7e-14 | |
| pfam03061 | 79 | pfam03061, 4HBT, Thioesterase superfamily | 2e-13 | |
| TIGR00369 | 117 | TIGR00369, unchar_dom_1, uncharacterized domain 1 | 5e-13 | |
| pfam13622 | 200 | pfam13622, 4HBT_3, Thioesterase-like superfamily | 2e-06 | |
| PRK11688 | 154 | PRK11688, PRK11688, hypothetical protein; Provisio | 1e-05 | |
| TIGR02286 | 114 | TIGR02286, PaaD, phenylacetic acid degradation pro | 5e-04 |
| >gnl|CDD|239527 cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria | Back alignment and domain information |
|---|
Score = 107 bits (269), Expect = 5e-31
Identities = 48/112 (42%), Positives = 69/112 (61%), Gaps = 2/112 (1%)
Query: 40 GLRVDLSEPGRVICSMKVPPRLLNAGNFMHGGATATLVDLVGSAAIFTVGAPSV-GVSVE 98
G+RV PGRV+ + V PR LN G +HGGA ATL D G A + P V+V+
Sbjct: 3 GIRVVEVGPGRVVLRLPVRPRHLNPGGIVHGGAIATLADTAGGLAALSALPPGALAVTVD 62
Query: 99 INVSYLDAAFGGEIEIEAKVLRVGKAVAVVSVELRKKDTGKIVAQGRHTKYL 150
+NV+YL A GG++ A+V+++G+ +AVV VE+ +D GK+VA R T +
Sbjct: 63 LNVNYLRPARGGDLTARARVVKLGRRLAVVEVEVTDED-GKLVATARGTFAV 113
|
Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ). Length = 113 |
| >gnl|CDD|224961 COG2050, PaaI, HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >gnl|CDD|217345 pfam03061, 4HBT, Thioesterase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|161843 TIGR00369, unchar_dom_1, uncharacterized domain 1 | Back alignment and domain information |
|---|
| >gnl|CDD|222270 pfam13622, 4HBT_3, Thioesterase-like superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|183276 PRK11688, PRK11688, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131339 TIGR02286, PaaD, phenylacetic acid degradation protein PaaD | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| PRK10293 | 136 | acyl-CoA esterase; Provisional | 99.96 | |
| PRK10254 | 137 | thioesterase; Provisional | 99.96 | |
| PLN02322 | 154 | acyl-CoA thioesterase | 99.95 | |
| PRK11688 | 154 | hypothetical protein; Provisional | 99.94 | |
| TIGR00369 | 117 | unchar_dom_1 uncharacterized domain 1. Most protei | 99.94 | |
| COG2050 | 141 | PaaI HGG motif-containing thioesterase, possibly i | 99.94 | |
| TIGR02286 | 114 | PaaD phenylacetic acid degradation protein PaaD. S | 99.93 | |
| KOG3328 | 148 | consensus HGG motif-containing thioesterase [Gener | 99.92 | |
| cd03443 | 113 | PaaI_thioesterase PaaI_thioesterase is a tetrameri | 99.87 | |
| TIGR02447 | 138 | yiiD_Cterm thioesterase domain, putative. This fam | 99.87 | |
| PF14539 | 132 | DUF4442: Domain of unknown function (DUF4442); PDB | 99.8 | |
| cd03442 | 123 | BFIT_BACH Brown fat-inducible thioesterase (BFIT). | 99.73 | |
| PRK10694 | 133 | acyl-CoA esterase; Provisional | 99.71 | |
| COG1607 | 157 | Acyl-CoA hydrolase [Lipid metabolism] | 99.67 | |
| PF03061 | 79 | 4HBT: Thioesterase superfamily; InterPro: IPR00668 | 99.66 | |
| cd00556 | 99 | Thioesterase_II Thioesterase II (TEII) is thought | 99.56 | |
| PF09500 | 144 | YiiD_Cterm: Putative thioesterase (yiiD_Cterm); In | 99.51 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 99.47 | |
| cd00586 | 110 | 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat | 99.46 | |
| PLN02647 | 437 | acyl-CoA thioesterase | 99.39 | |
| PLN02647 | 437 | acyl-CoA thioesterase | 99.22 | |
| cd03440 | 100 | hot_dog The hotdog fold was initially identified i | 99.21 | |
| KOG4781 | 237 | consensus Uncharacterized conserved protein [Funct | 99.21 | |
| PRK10800 | 130 | acyl-CoA thioesterase YbgC; Provisional | 99.19 | |
| TIGR02799 | 126 | thio_ybgC tol-pal system-associated acyl-CoA thioe | 99.14 | |
| cd03445 | 94 | Thioesterase_II_repeat2 Thioesterase II (TEII) is | 99.03 | |
| COG0824 | 137 | FcbC Predicted thioesterase [General function pred | 99.0 | |
| TIGR00051 | 117 | acyl-CoA thioester hydrolase, YbgC/YbaW family. Th | 98.99 | |
| PF13622 | 255 | 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A | 98.95 | |
| PF13279 | 121 | 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E | 98.92 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 98.86 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 98.8 | |
| PRK00006 | 147 | fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review | 98.67 | |
| cd03449 | 128 | R_hydratase (R)-hydratase [(R)-specific enoyl-CoA | 98.63 | |
| cd01288 | 131 | FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier | 98.63 | |
| COG5496 | 130 | Predicted thioesterase [General function predictio | 98.46 | |
| TIGR00189 | 271 | tesB acyl-CoA thioesterase II. Subunit: homotetram | 98.44 | |
| KOG2763 | 357 | consensus Acyl-CoA thioesterase [Lipid transport a | 98.37 | |
| PRK10526 | 286 | acyl-CoA thioesterase II; Provisional | 98.18 | |
| cd01289 | 138 | FabA_like Domain of unknown function, appears to b | 98.15 | |
| cd00493 | 131 | FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr | 98.14 | |
| PRK13188 | 464 | bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl | 98.11 | |
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 98.11 | |
| PLN02370 | 419 | acyl-ACP thioesterase | 98.1 | |
| cd03441 | 127 | R_hydratase_like (R)-hydratase [(R)-specific enoyl | 98.09 | |
| cd03455 | 123 | SAV4209 SAV4209 is a Streptomyces avermitilis prot | 98.08 | |
| cd03451 | 146 | FkbR2 FkbR2 is a Streptomyces hygroscopicus protei | 98.06 | |
| TIGR01750 | 140 | fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd | 98.04 | |
| cd03447 | 126 | FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t | 97.96 | |
| cd03446 | 140 | MaoC_like MoaC_like Similar to the MaoC (monoamine | 97.8 | |
| PRK13692 | 159 | (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro | 97.78 | |
| cd03453 | 127 | SAV4209_like SAV4209_like. Similar in sequence to | 97.78 | |
| cd03452 | 142 | MaoC_C MaoC_C The C-terminal hot dog fold of the M | 97.71 | |
| cd03454 | 140 | YdeM YdeM is a Bacillus subtilis protein that belo | 97.67 | |
| PRK08190 | 466 | bifunctional enoyl-CoA hydratase/phosphate acetylt | 97.55 | |
| PRK13691 | 166 | (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro | 97.54 | |
| PF07977 | 138 | FabA: FabA-like domain; InterPro: IPR013114 Fatty | 97.48 | |
| PF01643 | 261 | Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 | 97.47 | |
| cd03444 | 104 | Thioesterase_II_repeat1 Thioesterase II (TEII) is | 97.4 | |
| KOG3016 | 294 | consensus Acyl-CoA thioesterase [Lipid transport a | 97.38 | |
| cd01287 | 150 | FabA FabA, beta-hydroxydecanoyl-acyl carrier prote | 97.34 | |
| KOG2763 | 357 | consensus Acyl-CoA thioesterase [Lipid transport a | 97.31 | |
| PF13622 | 255 | 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A | 96.9 | |
| COG0764 | 147 | FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca | 96.85 | |
| PRK13693 | 142 | (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro | 96.84 | |
| COG1946 | 289 | TesB Acyl-CoA thioesterase [Lipid metabolism] | 96.8 | |
| TIGR00189 | 271 | tesB acyl-CoA thioesterase II. Subunit: homotetram | 96.72 | |
| TIGR01749 | 169 | fabA beta-hydroxyacyl-[acyl carrier protein] dehyd | 96.54 | |
| cd03450 | 149 | NodN NodN (nodulation factor N) contains a single | 96.52 | |
| PF01575 | 122 | MaoC_dehydratas: MaoC like domain; InterPro: IPR00 | 96.46 | |
| PF13452 | 132 | MaoC_dehydrat_N: N-terminal half of MaoC dehydrata | 96.32 | |
| PF03756 | 132 | AfsA: A-factor biosynthesis hotdog domain; InterPr | 96.31 | |
| PRK05174 | 172 | 3-hydroxydecanoyl-(acyl carrier protein) dehydrata | 96.3 | |
| cd03448 | 122 | HDE_HSD HDE_HSD The R-hydratase-like hot dog fold | 96.29 | |
| COG2030 | 159 | MaoC Acyl dehydratase [Lipid metabolism] | 96.2 | |
| TIGR02278 | 663 | PaaN-DH phenylacetic acid degradation protein paaN | 95.98 | |
| PRK10526 | 286 | acyl-CoA thioesterase II; Provisional | 95.94 | |
| PLN02864 | 310 | enoyl-CoA hydratase | 94.72 | |
| PRK11563 | 675 | bifunctional aldehyde dehydrogenase/enoyl-CoA hydr | 94.54 | |
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 94.51 | |
| PF01643 | 261 | Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 | 94.48 | |
| PLN02864 | 310 | enoyl-CoA hydratase | 94.13 | |
| PF02551 | 131 | Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IP | 94.0 | |
| COG1946 | 289 | TesB Acyl-CoA thioesterase [Lipid metabolism] | 93.57 | |
| PF14765 | 295 | PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_ | 91.22 | |
| COG3884 | 250 | FatA Acyl-ACP thioesterase [Lipid metabolism] | 89.59 | |
| COG3884 | 250 | FatA Acyl-ACP thioesterase [Lipid metabolism] | 89.42 | |
| PLN02370 | 419 | acyl-ACP thioesterase | 89.38 | |
| KOG3016 | 294 | consensus Acyl-CoA thioesterase [Lipid transport a | 88.22 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 84.92 |
| >PRK10293 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
Probab=99.96 E-value=1.7e-28 Score=171.78 Aligned_cols=112 Identities=23% Similarity=0.332 Sum_probs=104.6
Q ss_pred cCeEEEEecCCEEEEEEEcCCCCcCCCCcccHHHHHHHHHHHHHHHHHHhC-CCceeEEEEEEEEEecCCCCCeEEEEEE
Q 031621 39 QGLRVDLSEPGRVICSMKVPPRLLNAGNFMHGGATATLVDLVGSAAIFTVG-APSVGVSVEINVSYLDAAFGGEIEIEAK 117 (156)
Q Consensus 39 ~g~~~~~~~~~~v~~~~~~~~~~~n~~g~lhGG~l~~l~D~~~~~~~~~~~-~~~~~~t~~~~i~fl~p~~~g~i~~~a~ 117 (156)
+|+++.++++|+++++++++++++|+.|.+|||++++|+|.++++++.... .+...+|+++++||++|++.|.++++|+
T Consensus 24 LGi~i~~~~~g~~~~~~~v~~~~~n~~G~lHGGv~~tLaD~a~~~a~~~~~~~~~~~vTiel~infl~p~~~g~l~a~a~ 103 (136)
T PRK10293 24 LDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVVLAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCK 103 (136)
T ss_pred cCcEEEEEeCCEEEEEEEcCHHHcCCcCcccHHHHHHHHHHHHHHHHHhcccCCceEEEEEEEeEEecccCCceEEEEEE
Confidence 499999999999999999999999999999999999999999988886643 4456799999999999999889999999
Q ss_pred EEEeCceEEEEEEEEEECCCCcEEEEEEEEEEEe
Q 031621 118 VLRVGKAVAVVSVELRKKDTGKIVAQGRHTKYLA 151 (156)
Q Consensus 118 i~~~g~~~~~v~~~i~~~~~g~~~a~a~~t~~~~ 151 (156)
+++.||+..+++++++ |++|+++|.++++++++
T Consensus 104 vv~~Gr~~~~~~~~v~-d~~g~l~A~~~~t~~i~ 136 (136)
T PRK10293 104 PLHLGSRHQVWQIEIF-DEKGRLCCSSRLTTAIL 136 (136)
T ss_pred EEecCCCEEEEEEEEE-eCCCCEEEEEEEEEEEC
Confidence 9999999999999999 68999999999999874
|
|
| >PRK10254 thioesterase; Provisional | Back alignment and domain information |
|---|
| >PLN02322 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >PRK11688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00369 unchar_dom_1 uncharacterized domain 1 | Back alignment and domain information |
|---|
| >COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02286 PaaD phenylacetic acid degradation protein PaaD | Back alignment and domain information |
|---|
| >KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria | Back alignment and domain information |
|---|
| >TIGR02447 yiiD_Cterm thioesterase domain, putative | Back alignment and domain information |
|---|
| >PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B | Back alignment and domain information |
|---|
| >cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >PRK10694 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >COG1607 Acyl-CoA hydrolase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases | Back alignment and domain information |
|---|
| >cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >PF09500 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) | Back alignment and domain information |
|---|
| >PLN02647 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >PLN02647 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >cd03440 hot_dog The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >KOG4781 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10800 acyl-CoA thioesterase YbgC; Provisional | Back alignment and domain information |
|---|
| >TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >COG0824 FcbC Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family | Back alignment and domain information |
|---|
| >PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B | Back alignment and domain information |
|---|
| >PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway | Back alignment and domain information |
|---|
| >COG5496 Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00189 tesB acyl-CoA thioesterase II | Back alignment and domain information |
|---|
| >KOG2763 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10526 acyl-CoA thioesterase II; Provisional | Back alignment and domain information |
|---|
| >cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) | Back alignment and domain information |
|---|
| >cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation | Back alignment and domain information |
|---|
| >PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
| >PLN02370 acyl-ACP thioesterase | Back alignment and domain information |
|---|
| >cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] | Back alignment and domain information |
|---|
| >cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ | Back alignment and domain information |
|---|
| >cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit | Back alignment and domain information |
|---|
| >cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain | Back alignment and domain information |
|---|
| >PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional | Back alignment and domain information |
|---|
| >cd03453 SAV4209_like SAV4209_like | Back alignment and domain information |
|---|
| >cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein | Back alignment and domain information |
|---|
| >cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function | Back alignment and domain information |
|---|
| >PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional | Back alignment and domain information |
|---|
| >PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] | Back alignment and domain information |
|---|
| >PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] | Back alignment and domain information |
|---|
| >cd03444 Thioesterase_II_repeat1 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >KOG3016 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site | Back alignment and domain information |
|---|
| >KOG2763 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B | Back alignment and domain information |
|---|
| >COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional | Back alignment and domain information |
|---|
| >COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR00189 tesB acyl-CoA thioesterase II | Back alignment and domain information |
|---|
| >TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA | Back alignment and domain information |
|---|
| >cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes | Back alignment and domain information |
|---|
| >PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A | Back alignment and domain information |
|---|
| >PF03756 AfsA: A-factor biosynthesis hotdog domain; InterPro: IPR005509 The AfsA family are key enzymes in A-factor biosynthesis, which is essential for streptomycin production and resistance | Back alignment and domain information |
|---|
| >PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated | Back alignment and domain information |
|---|
| >cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins | Back alignment and domain information |
|---|
| >COG2030 MaoC Acyl dehydratase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN | Back alignment and domain information |
|---|
| >PRK10526 acyl-CoA thioesterase II; Provisional | Back alignment and domain information |
|---|
| >PLN02864 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
| >PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] | Back alignment and domain information |
|---|
| >PLN02864 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PF02551 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IPR003703 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH) | Back alignment and domain information |
|---|
| >COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF14765 PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_D 3KG9_A 3KG8_B 3HRR_A 3HRQ_A 3EL6_A 3KG6_B 2VZ8_A 2VZ9_A | Back alignment and domain information |
|---|
| >COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02370 acyl-ACP thioesterase | Back alignment and domain information |
|---|
| >KOG3016 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 156 | ||||
| 3f5o_A | 148 | Crystal Structure Of Hthem2(Undecan-2-One-Coa) Comp | 3e-22 | ||
| 2h4u_A | 145 | Crystal Structure Of Human Thioesterase Superfamily | 6e-22 | ||
| 2f0x_A | 148 | Crystal Structure And Function Of Human Thioesteras | 9e-21 | ||
| 2cy9_A | 140 | Crystal Structure Of Thioesterase Superfamily Membe | 5e-19 | ||
| 1zki_A | 133 | Structure Of Conserved Protein Pa5202 From Pseudomo | 2e-06 | ||
| 3e1e_A | 141 | Crystal Structure Of A Thioesterase Family Protein | 5e-05 | ||
| 3nwz_A | 176 | Crystal Structure Of Bh2602 Protein From Bacillus H | 7e-04 |
| >pdb|3F5O|A Chain A, Crystal Structure Of Hthem2(Undecan-2-One-Coa) Complex Length = 148 | Back alignment and structure |
|
| >pdb|2H4U|A Chain A, Crystal Structure Of Human Thioesterase Superfamily Member 2 (Casp Target) Length = 145 | Back alignment and structure |
| >pdb|2F0X|A Chain A, Crystal Structure And Function Of Human Thioesterase Superfamily Member 2(Them2) Length = 148 | Back alignment and structure |
| >pdb|2CY9|A Chain A, Crystal Structure Of Thioesterase Superfamily Member2 From Mus Musculus Length = 140 | Back alignment and structure |
| >pdb|1ZKI|A Chain A, Structure Of Conserved Protein Pa5202 From Pseudomonas Aeruginosa Length = 133 | Back alignment and structure |
| >pdb|3E1E|A Chain A, Crystal Structure Of A Thioesterase Family Protein From Silicibacter Pomeroyi. Northeast Structural Genomics Target Sir180a Length = 141 | Back alignment and structure |
| >pdb|3NWZ|A Chain A, Crystal Structure Of Bh2602 Protein From Bacillus Halodurans With Coa, Northeast Structural Genomics Consortium Target Bhr199 Length = 176 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 156 | |||
| 2h4u_A | 145 | Thioesterase superfamily member 2; structural geno | 6e-43 | |
| 3f5o_A | 148 | Thioesterase superfamily member 2; hotdog fold, hy | 4e-42 | |
| 3lbe_A | 163 | Putative uncharacterized protein SMU.793; hypothet | 4e-31 | |
| 2qwz_A | 159 | Phenylacetic acid degradation-related protein; put | 3e-30 | |
| 3dkz_A | 142 | Thioesterase superfamily protein; Q7W9W5, borpa, P | 1e-26 | |
| 1zki_A | 133 | Hypothetical protein PA5202; structural genomics, | 2e-25 | |
| 3nwz_A | 176 | BH2602 protein; structural genomics, PSI-biology, | 3e-25 | |
| 2pim_A | 141 | Phenylacetic acid degradation-related protein; thi | 4e-24 | |
| 3e1e_A | 141 | Thioesterase family protein; structural genomics, | 4e-23 | |
| 2fs2_A | 151 | Phenylacetic acid degradation protein PAAI; operon | 7e-23 | |
| 1wlu_A | 136 | PAAI protein, phenylacetic acid degradation protei | 8e-23 | |
| 3e29_A | 144 | Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, | 1e-22 | |
| 3gek_A | 146 | Putative thioesterase YHDA; structure genomics, NE | 7e-22 | |
| 1vh5_A | 148 | Hypothetical protein YDII; PSI, protein structure | 1e-21 | |
| 1o0i_A | 138 | Hypothetical protein HI1161; structural genomics, | 3e-21 | |
| 1vh9_A | 149 | P15, hypothetical protein YBDB; structural genomic | 4e-21 | |
| 1q4t_A | 151 | Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A | 7e-21 | |
| 3f1t_A | 148 | Uncharacterized protein Q9I3C8_pseae; PAR319A, NES | 2e-20 | |
| 3s4k_A | 144 | Putative esterase RV1847/MT1895; seattle structura | 8e-20 | |
| 2hbo_A | 158 | Hypothetical protein (NP_422103.1); thioesterase/t | 3e-19 | |
| 3e8p_A | 164 | Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG | 3e-17 | |
| 3hdu_A | 157 | Putative thioesterase; structural genomics, joint | 4e-17 | |
| 4ae8_A | 211 | Thioesterase superfamily member 4; hydrolase, hotd | 6e-14 | |
| 4ae7_A | 220 | Thioesterase superfamily member 5; hydrolase, hotd | 1e-12 | |
| 2ov9_A | 216 | Hypothetical protein; rhodococcus SP. RHA1, RHA085 | 4e-12 | |
| 1ixl_A | 131 | Hypothetical protein PH1136; alpha+beta, hot-DOG-f | 2e-11 | |
| 1sh8_A | 154 | Hypothetical protein PA5026; structural genomics, | 7e-11 | |
| 3lw3_A | 145 | HP0420 homologue; hotdog-fold, structural genomics | 2e-08 | |
| 1yoc_A | 147 | Hypothetical protein PA1835; structural genomics, | 1e-06 | |
| 3bbj_A | 272 | Putative thioesterase II; structural genomics, joi | 1e-05 | |
| 3d6l_A | 137 | Putative hydrolase; hot DOG fold, thioesterase, ac | 4e-05 | |
| 2q2b_A | 179 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 1e-04 | |
| 1y7u_A | 174 | Acyl-COA hydrolase; structural genomics, coenzyme | 1e-04 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 2e-04 | |
| 3rqb_A | 275 | Uncharacterized protein; structural genomics, PSI- | 2e-04 | |
| 2qq2_A | 193 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 3e-04 | |
| 3bjk_A | 153 | Acyl-COA thioester hydrolase HI0827; hotdog fold, | 4e-04 | |
| 2v1o_A | 151 | Cytosolic acyl coenzyme A thioester hydrolase; acy | 6e-04 | |
| 2eis_A | 133 | Hypothetical protein TTHB207; COA binding motif, N | 8e-04 |
| >2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Length = 145 | Back alignment and structure |
|---|
Score = 138 bits (349), Expect = 6e-43
Identities = 54/137 (39%), Positives = 82/137 (59%), Gaps = 8/137 (5%)
Query: 23 STMEEMPT--KFFER-----FIMQGLRVDLSEPGRVICSMKVPPRLLNAGNFMHGGATAT 75
S+ ++ T +F+ ++ + + + PG+VIC MKV NA +HGG TAT
Sbjct: 8 SSGVDLGTENLYFQSMRNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTAT 67
Query: 76 LVDLVGSAAIFTVGAPSVGVSVEINVSYLDAAF-GGEIEIEAKVLRVGKAVAVVSVELRK 134
LVD + + A+ + GVSV++N++Y+ A G +I I A VL+ GK +A SV+L
Sbjct: 68 LVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTN 127
Query: 135 KDTGKIVAQGRHTKYLA 151
K TGK++AQGRHTK+L
Sbjct: 128 KATGKLIAQGRHTKHLG 144
|
| >3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} PDB: 2f0x_A* 2cy9_A Length = 148 | Back alignment and structure |
|---|
| >3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Length = 163 | Back alignment and structure |
|---|
| >2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Length = 159 | Back alignment and structure |
|---|
| >3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Length = 142 | Back alignment and structure |
|---|
| >1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Length = 133 | Back alignment and structure |
|---|
| >3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Length = 176 | Back alignment and structure |
|---|
| >2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Length = 141 | Back alignment and structure |
|---|
| >3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Length = 141 | Back alignment and structure |
|---|
| >2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Length = 151 | Back alignment and structure |
|---|
| >1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Length = 136 | Back alignment and structure |
|---|
| >3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} Length = 144 | Back alignment and structure |
|---|
| >3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Length = 146 | Back alignment and structure |
|---|
| >1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Length = 148 | Back alignment and structure |
|---|
| >1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 1sc0_A 2b6e_A 3lz7_A Length = 138 | Back alignment and structure |
|---|
| >1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Length = 149 | Back alignment and structure |
|---|
| >1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Length = 151 | Back alignment and structure |
|---|
| >3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Length = 148 | Back alignment and structure |
|---|
| >3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} Length = 144 | Back alignment and structure |
|---|
| >2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Length = 158 | Back alignment and structure |
|---|
| >3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Length = 164 | Back alignment and structure |
|---|
| >3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Length = 157 | Back alignment and structure |
|---|
| >4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Length = 216 | Back alignment and structure |
|---|
| >1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Length = 131 | Back alignment and structure |
|---|
| >1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Length = 154 | Back alignment and structure |
|---|
| >3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Length = 145 | Back alignment and structure |
|---|
| >1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Length = 147 | Back alignment and structure |
|---|
| >3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Length = 272 | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Length = 137 | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Length = 179 | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Length = 174 | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Length = 148 | Back alignment and structure |
|---|
| >3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} Length = 275 | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Length = 153 | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Length = 151 | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Length = 133 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| 1sc0_A | 138 | Hypothetical protein HI1161; structural genomics, | 99.97 | |
| 3gek_A | 146 | Putative thioesterase YHDA; structure genomics, NE | 99.96 | |
| 3s4k_A | 144 | Putative esterase RV1847/MT1895; seattle structura | 99.96 | |
| 1o0i_A | 138 | Hypothetical protein HI1161; structural genomics, | 99.96 | |
| 3f5o_A | 148 | Thioesterase superfamily member 2; hotdog fold, hy | 99.96 | |
| 1vh9_A | 149 | P15, hypothetical protein YBDB; structural genomic | 99.95 | |
| 3lbe_A | 163 | Putative uncharacterized protein SMU.793; hypothet | 99.95 | |
| 3dkz_A | 142 | Thioesterase superfamily protein; Q7W9W5, borpa, P | 99.95 | |
| 3f1t_A | 148 | Uncharacterized protein Q9I3C8_pseae; PAR319A, NES | 99.95 | |
| 3hdu_A | 157 | Putative thioesterase; structural genomics, joint | 99.95 | |
| 1vh5_A | 148 | Hypothetical protein YDII; PSI, protein structure | 99.95 | |
| 4i82_A | 137 | Putative uncharacterized protein; PAAI/YDII-like, | 99.95 | |
| 3e29_A | 144 | Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, | 99.94 | |
| 3e1e_A | 141 | Thioesterase family protein; structural genomics, | 99.94 | |
| 3nwz_A | 176 | BH2602 protein; structural genomics, PSI-biology, | 99.94 | |
| 2qwz_A | 159 | Phenylacetic acid degradation-related protein; put | 99.94 | |
| 1q4t_A | 151 | Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A | 99.94 | |
| 1yoc_A | 147 | Hypothetical protein PA1835; structural genomics, | 99.94 | |
| 3e8p_A | 164 | Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG | 99.94 | |
| 1sh8_A | 154 | Hypothetical protein PA5026; structural genomics, | 99.93 | |
| 2pim_A | 141 | Phenylacetic acid degradation-related protein; thi | 99.93 | |
| 2fs2_A | 151 | Phenylacetic acid degradation protein PAAI; operon | 99.92 | |
| 4ae8_A | 211 | Thioesterase superfamily member 4; hydrolase, hotd | 99.92 | |
| 2h4u_A | 145 | Thioesterase superfamily member 2; structural geno | 99.92 | |
| 4ae7_A | 220 | Thioesterase superfamily member 5; hydrolase, hotd | 99.91 | |
| 1t82_A | 155 | Hypothetical acetyltransferase; structural genomic | 99.91 | |
| 1zki_A | 133 | Hypothetical protein PA5202; structural genomics, | 99.91 | |
| 2hbo_A | 158 | Hypothetical protein (NP_422103.1); thioesterase/t | 99.9 | |
| 2ov9_A | 216 | Hypothetical protein; rhodococcus SP. RHA1, RHA085 | 99.9 | |
| 1wlu_A | 136 | PAAI protein, phenylacetic acid degradation protei | 99.89 | |
| 2prx_A | 160 | Thioesterase superfamily protein; ZP_00837258.1, s | 99.87 | |
| 3lw3_A | 145 | HP0420 homologue; hotdog-fold, structural genomics | 99.87 | |
| 1ixl_A | 131 | Hypothetical protein PH1136; alpha+beta, hot-DOG-f | 99.86 | |
| 3lmb_A | 165 | Uncharacterized protein; protein OLEI01261, unknow | 99.84 | |
| 3bnv_A | 152 | CJ0977; virulence factor, hot-DOG fold, flagel unk | 99.81 | |
| 2qq2_A | 193 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 99.8 | |
| 3d6l_A | 137 | Putative hydrolase; hot DOG fold, thioesterase, ac | 99.8 | |
| 4ien_A | 163 | Putative acyl-COA hydrolase; hot DOG fold; HET: CO | 99.79 | |
| 1y7u_A | 174 | Acyl-COA hydrolase; structural genomics, coenzyme | 99.76 | |
| 2q2b_A | 179 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 99.75 | |
| 3bjk_A | 153 | Acyl-COA thioester hydrolase HI0827; hotdog fold, | 99.75 | |
| 2eis_A | 133 | Hypothetical protein TTHB207; COA binding motif, N | 99.74 | |
| 1vpm_A | 169 | Acyl-COA hydrolase; NP_241664.1, structural genomi | 99.73 | |
| 4a0z_A | 190 | Transcription factor FAPR; lipid homeostasis; HET: | 99.73 | |
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 99.73 | |
| 2f3x_A | 157 | Transcription factor FAPR; 'HOT-DOG' fold / malony | 99.72 | |
| 2f41_A | 121 | Transcription factor FAPR; 'HOT-DOG' fold, gene re | 99.71 | |
| 2v1o_A | 151 | Cytosolic acyl coenzyme A thioester hydrolase; acy | 99.71 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 99.67 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 99.66 | |
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 99.63 | |
| 2cwz_A | 141 | Thioesterase family protein; structural genomics, | 99.63 | |
| 1njk_A | 156 | Hypothetical protein YBAW; structural genomics, th | 99.58 | |
| 2cye_A | 133 | TTHA1846, putative thioesterase; structural genomi | 99.57 | |
| 2fuj_A | 137 | Conserved hypothetical protein; structural genomic | 99.54 | |
| 2q78_A | 153 | Uncharacterized protein; structural genomics, join | 99.49 | |
| 1s5u_A | 138 | Protein YBGC; structural genomics, hypothetical pr | 99.48 | |
| 2egj_A | 128 | Hypothetical protein AQ_1494; structural genomics; | 99.48 | |
| 3bbj_A | 272 | Putative thioesterase II; structural genomics, joi | 99.45 | |
| 2oiw_A | 136 | Putative 4-hydroxybenzoyl-COA thioesterase; struct | 99.44 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 99.43 | |
| 3ck1_A | 150 | Putative thioesterase; structural genomics, joint | 99.43 | |
| 3kuv_A | 139 | Fluoroacetyl coenzyme A thioesterase; fluoroacetyl | 99.43 | |
| 2hlj_A | 157 | Hypothetical protein; putative thioesterase, struc | 99.42 | |
| 2gf6_A | 135 | Conserved hypothetical protein; putative thioester | 99.42 | |
| 2pzh_A | 135 | Hypothetical protein HP_0496; lipid, acyl-COA, bac | 99.42 | |
| 2ali_A | 158 | Hypothetical protein PA2801; structural genomics, | 99.41 | |
| 1z54_A | 132 | Probable thioesterase; hypothetical protein, struc | 99.39 | |
| 2w3x_A | 147 | CALE7; hydrolase, hotdog fold, thioesterase, enedi | 99.38 | |
| 2xem_A | 150 | DYNE7, TEBC; biosynthetic protein, polyketide bios | 99.36 | |
| 2nuj_A | 163 | Thioesterase superfamily; YP_509914.1, structural | 99.36 | |
| 1lo7_A | 141 | 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c | 99.35 | |
| 2hx5_A | 152 | Hypothetical protein; thioesterase/thiol ester deh | 99.32 | |
| 2oaf_A | 151 | Thioesterase superfamily; YP_508616.1, structural | 99.32 | |
| 3r87_A | 135 | Putative uncharacterized protein; unknown function | 99.29 | |
| 3qoo_A | 138 | Uncharacterized protein; structural genomics, PSI- | 99.25 | |
| 4i4j_A | 159 | ACP-polyene thioesterase; structural genomics, PSI | 99.24 | |
| 3hm0_A | 167 | Probable thioesterase; niaid, ssgcid, decode, UW, | 99.19 | |
| 3cjy_A | 259 | Putative thioesterase; YP_496845.1, structural gen | 99.11 | |
| 3rqb_A | 275 | Uncharacterized protein; structural genomics, PSI- | 98.95 | |
| 1iq6_A | 134 | (R)-hydratase, (R)-specific enoyl-COA hydratase; p | 98.92 | |
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 98.92 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 98.9 | |
| 1q6w_A | 161 | Monoamine oxidase regulatory protein, putative; st | 98.81 | |
| 4gak_A | 250 | Acyl-ACP thioesterase; MCSG, PSI-biology, structur | 98.78 | |
| 1tbu_A | 118 | Peroxisomal acyl-coenzyme A thioester hydrolase 1; | 98.73 | |
| 3d6x_A | 146 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 98.71 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 98.62 | |
| 3u0a_A | 285 | Acyl-COA thioesterase II TESB2; structural genomic | 98.6 | |
| 1c8u_A | 285 | Acyl-COA thioesterase II; internal repeats, hydrol | 98.58 | |
| 4h4g_A | 160 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 98.57 | |
| 1z6b_A | 154 | Pffabz, fatty acid synthesis protein; malaria, bet | 98.55 | |
| 1u1z_A | 168 | (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd | 98.55 | |
| 2b3n_A | 159 | Hypothetical protein AF1124; structural genomics, | 98.55 | |
| 2gll_A | 171 | FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d | 98.53 | |
| 3ir3_A | 148 | HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc | 98.5 | |
| 3rd7_A | 286 | Acyl-COA thioesterase; seattle structur genomics c | 98.45 | |
| 4i83_A | 152 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; | 98.45 | |
| 3exz_A | 154 | MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A | 98.39 | |
| 4ffu_A | 176 | Oxidase; structural genomics, protein structure in | 98.19 | |
| 2c2i_A | 151 | RV0130; hotdog, hydratase, lyase, structural prote | 98.12 | |
| 3k67_A | 159 | Putative dehydratase AF1124; hypothetical protein | 97.87 | |
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 97.83 | |
| 4e3e_A | 352 | MAOC domain protein dehydratase; structural genomi | 97.77 | |
| 4gak_A | 250 | Acyl-ACP thioesterase; MCSG, PSI-biology, structur | 97.47 | |
| 3rqb_A | 275 | Uncharacterized protein; structural genomics, PSI- | 97.29 | |
| 2bi0_A | 337 | Hypothetical protein RV0216; conserved hypothetica | 97.24 | |
| 2cf2_C | 342 | Fatty acid synthase, DH domain; transferase, fatty | 97.11 | |
| 3kh8_A | 332 | MAOC-like dehydratase; hot DOG domain, lyase; 2.00 | 97.05 | |
| 4b0b_A | 171 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 96.94 | |
| 3khp_A | 311 | MAOC family protein; dehydrogenase, oxidoreductase | 96.88 | |
| 3q62_A | 175 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 96.87 | |
| 2cf2_C | 342 | Fatty acid synthase, DH domain; transferase, fatty | 96.8 | |
| 1s9c_A | 298 | Peroxisomal multifunctional enzyme type 2; hot-DOG | 96.8 | |
| 3u0a_A | 285 | Acyl-COA thioesterase II TESB2; structural genomic | 96.68 | |
| 3cjy_A | 259 | Putative thioesterase; YP_496845.1, structural gen | 96.59 | |
| 1c8u_A | 285 | Acyl-COA thioesterase II; internal repeats, hydrol | 96.53 | |
| 1pn2_A | 280 | Peroxisomal hydratase-dehydrogenase-epimerase; hot | 96.47 | |
| 4b8u_A | 171 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 96.47 | |
| 3rd7_A | 286 | Acyl-COA thioesterase; seattle structur genomics c | 96.39 | |
| 3khp_A | 311 | MAOC family protein; dehydrogenase, oxidoreductase | 95.76 | |
| 3esi_A | 129 | Uncharacterized protein; protein from erwinia caro | 95.52 | |
| 1pn2_A | 280 | Peroxisomal hydratase-dehydrogenase-epimerase; hot | 95.35 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 95.08 | |
| 2bi0_A | 337 | Hypothetical protein RV0216; conserved hypothetica | 94.96 | |
| 1s9c_A | 298 | Peroxisomal multifunctional enzyme type 2; hot-DOG | 94.81 | |
| 3bbj_A | 272 | Putative thioesterase II; structural genomics, joi | 94.72 | |
| 4e3e_A | 352 | MAOC domain protein dehydratase; structural genomi | 94.53 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 93.54 | |
| 3kh8_A | 332 | MAOC-like dehydratase; hot DOG domain, lyase; 2.00 | 93.27 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 85.28 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 84.75 | |
| 2uva_G | 2060 | Fatty acid synthase beta subunits; fungal, dehydra | 84.06 | |
| 2uv8_G | 2051 | Fatty acid synthase subunit beta (FAS1); fatty aci | 83.27 | |
| 2uva_G | 2060 | Fatty acid synthase beta subunits; fungal, dehydra | 80.15 |
| >1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A | Back alignment and structure |
|---|
Probab=99.97 E-value=2.3e-30 Score=180.93 Aligned_cols=113 Identities=20% Similarity=0.316 Sum_probs=106.8
Q ss_pred cCeEEEEecCCEEEEEEEcCCCCcCCCCcccHHHHHHHHHHHHHHHHHHhC-CCceeEEEEEEEEEecCCCCCeEEEEEE
Q 031621 39 QGLRVDLSEPGRVICSMKVPPRLLNAGNFMHGGATATLVDLVGSAAIFTVG-APSVGVSVEINVSYLDAAFGGEIEIEAK 117 (156)
Q Consensus 39 ~g~~~~~~~~~~v~~~~~~~~~~~n~~g~lhGG~l~~l~D~~~~~~~~~~~-~~~~~~t~~~~i~fl~p~~~g~i~~~a~ 117 (156)
+|++++++++|+++++++++++++|+.|.+|||++++++|.++++++.... .+..++|++++++|+||++.|.+.++|+
T Consensus 24 LGi~~~~~~~g~~~~~~~v~~~~~n~~G~~HGG~~~~l~D~a~~~a~~~~~~~~~~~vt~~l~i~flrpa~~g~l~a~a~ 103 (138)
T 1sc0_A 24 LGIEISAFGEDWIEATMPVDHRTMQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARAT 103 (138)
T ss_dssp TTCEEEEECSSCEEEEEECSTTTBCTTSSBCHHHHHHHHHHHHHHHHHHTSCTTCEEEEEEEEEEECSCCCSSEEEEEEE
T ss_pred cCCEEEEEeCCEEEEEEEcCHHHcCCCCcCcHHHHHHHHHHHHHHHHHHhCCCCceeeeeEEEEEEEccCCCCcEEEEEE
Confidence 599999999999999999999999999999999999999999999997754 4567899999999999999899999999
Q ss_pred EEEeCceEEEEEEEEEECCCCcEEEEEEEEEEEec
Q 031621 118 VLRVGKAVAVVSVELRKKDTGKIVAQGRHTKYLAI 152 (156)
Q Consensus 118 i~~~g~~~~~v~~~i~~~~~g~~~a~a~~t~~~~~ 152 (156)
+++.||++.+++++++ |++|+++|++++|+++++
T Consensus 104 v~~~Gr~~~~~~~~i~-d~~g~lvA~a~~T~~il~ 137 (138)
T 1sc0_A 104 PINLGRNIQVWQIDIR-TEENKLCCVSRLTLSVIN 137 (138)
T ss_dssp EEEECSSEEEEEEEEE-CTTSCEEEEEEEEEEEEC
T ss_pred EEEcCCCEEEEEEEEE-cCCCCEEEEEEEEEEEEe
Confidence 9999999999999999 689999999999999876
|
| >3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A | Back alignment and structure |
|---|
| >1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* | Back alignment and structure |
|---|
| >3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A | Back alignment and structure |
|---|
| >4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* | Back alignment and structure |
|---|
| >1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A | Back alignment and structure |
|---|
| >4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* | Back alignment and structure |
|---|
| >2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A | Back alignment and structure |
|---|
| >2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} | Back alignment and structure |
|---|
| >3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A | Back alignment and structure |
|---|
| >1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A | Back alignment and structure |
|---|
| >4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A | Back alignment and structure |
|---|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A | Back alignment and structure |
|---|
| >3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A | Back alignment and structure |
|---|
| >3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A | Back alignment and structure |
|---|
| >2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A | Back alignment and structure |
|---|
| >1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A | Back alignment and structure |
|---|
| >2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* | Back alignment and structure |
|---|
| >2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} | Back alignment and structure |
|---|
| >3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} | Back alignment and structure |
|---|
| >4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} | Back alignment and structure |
|---|
| >3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} | Back alignment and structure |
|---|
| >1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 | Back alignment and structure |
|---|
| >3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 | Back alignment and structure |
|---|
| >4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A | Back alignment and structure |
|---|
| >1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 | Back alignment and structure |
|---|
| >2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A | Back alignment and structure |
|---|
| >2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* | Back alignment and structure |
|---|
| >3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A | Back alignment and structure |
|---|
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} | Back alignment and structure |
|---|
| >3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 | Back alignment and structure |
|---|
| >2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 | Back alignment and structure |
|---|
| >3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} | Back alignment and structure |
|---|
| >4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* | Back alignment and structure |
|---|
| >3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A | Back alignment and structure |
|---|
| >2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 | Back alignment and structure |
|---|
| >1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S | Back alignment and structure |
|---|
| >3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 | Back alignment and structure |
|---|
| >1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* | Back alignment and structure |
|---|
| >4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} | Back alignment and structure |
|---|
| >1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 | Back alignment and structure |
|---|
| >1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S | Back alignment and structure |
|---|
| >3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} | Back alignment and structure |
|---|
| >4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* | Back alignment and structure |
|---|
| >2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* | Back alignment and structure |
|---|
| >2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 156 | ||||
| d2f0xa1 | 136 | d.38.1.5 (A:3-138) Hypothetical protein Them2 {Hum | 1e-25 | |
| d1vh9a_ | 138 | d.38.1.5 (A:) Hypothetical protein YbdB {Escherich | 7e-21 | |
| d1vh5a_ | 138 | d.38.1.5 (A:) Hypothetical protein YdiI {Escherich | 4e-20 | |
| d1sc0a_ | 137 | d.38.1.5 (A:) Hypothetical protein HI1161 {Haemoph | 1e-19 | |
| d2fs2a1 | 131 | d.38.1.5 (A:1-131) Phenylacetic acid degradation p | 5e-18 | |
| d1zkia1 | 126 | d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Ps | 6e-18 | |
| d1wlua1 | 116 | d.38.1.5 (A:2-117) Phenylacetic acid degradation p | 4e-17 | |
| d2ov9a1 | 203 | d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro058 | 4e-14 | |
| d2hboa1 | 142 | d.38.1.5 (A:12-153) Hypothetical protein CC3309 {C | 5e-13 | |
| d1q4ua_ | 140 | d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {A | 6e-13 | |
| d1sh8a_ | 153 | d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudom | 7e-13 | |
| d1ixla_ | 130 | d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeo | 2e-11 | |
| d1yoca1 | 145 | d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Ps | 3e-11 | |
| d2f41a1 | 111 | d.38.1.5 (A:73-183) Transcription factor FapR, C-t | 1e-08 | |
| d1y7ua1 | 164 | d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Baci | 4e-06 | |
| d1t82a_ | 143 | d.38.1.5 (A:) Putative thioesterase SO4397 {Shewan | 1e-05 | |
| d1vpma_ | 155 | d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus | 3e-04 | |
| d2gvha1 | 135 | d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR | 0.001 |
| >d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: PaaI/YdiI-like domain: Hypothetical protein Them2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 92.8 bits (230), Expect = 1e-25
Identities = 54/124 (43%), Positives = 77/124 (62%), Gaps = 2/124 (1%)
Query: 28 MPTKFFERFIMQGLRVDLSEPGRVICSMKVPPRLLNAGNFMHGGATATLVDLVGSAAIFT 87
+ FER + + + + PG+VIC MKV NA +HGG TATLVD + + A+
Sbjct: 14 TKARNFERV-LGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLC 72
Query: 88 VGAPSVGVSVEINVSYLDAAF-GGEIEIEAKVLRVGKAVAVVSVELRKKDTGKIVAQGRH 146
+ GVSV++N++Y+ A G +I I A VL+ GK +A SV+L K TGK++AQGRH
Sbjct: 73 TERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRH 132
Query: 147 TKYL 150
TK+L
Sbjct: 133 TKHL 136
|
| >d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Length = 137 | Back information, alignment and structure |
|---|
| >d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Length = 131 | Back information, alignment and structure |
|---|
| >d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Length = 126 | Back information, alignment and structure |
|---|
| >d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Length = 116 | Back information, alignment and structure |
|---|
| >d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Length = 203 | Back information, alignment and structure |
|---|
| >d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Length = 142 | Back information, alignment and structure |
|---|
| >d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Length = 140 | Back information, alignment and structure |
|---|
| >d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Length = 153 | Back information, alignment and structure |
|---|
| >d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 130 | Back information, alignment and structure |
|---|
| >d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Length = 145 | Back information, alignment and structure |
|---|
| >d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 111 | Back information, alignment and structure |
|---|
| >d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Length = 164 | Back information, alignment and structure |
|---|
| >d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Length = 143 | Back information, alignment and structure |
|---|
| >d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Length = 155 | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Length = 135 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| d1vh9a_ | 138 | Hypothetical protein YbdB {Escherichia coli [TaxId | 99.97 | |
| d1q4ua_ | 140 | 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp | 99.96 | |
| d2f0xa1 | 136 | Hypothetical protein Them2 {Human (Homo sapiens) [ | 99.96 | |
| d1sc0a_ | 137 | Hypothetical protein HI1161 {Haemophilus influenza | 99.96 | |
| d1vh5a_ | 138 | Hypothetical protein YdiI {Escherichia coli [TaxId | 99.96 | |
| d1zkia1 | 126 | Hypothetical protein PA5202 {Pseudomonas aeruginos | 99.95 | |
| d2fs2a1 | 131 | Phenylacetic acid degradation protein PaaI {Escher | 99.95 | |
| d1wlua1 | 116 | Phenylacetic acid degradation protein PaaI {Thermu | 99.95 | |
| d1ixla_ | 130 | Hypothetical protein PH1136 {Archaeon Pyrococcus h | 99.93 | |
| d2hboa1 | 142 | Hypothetical protein CC3309 {Caulobacter crescentu | 99.92 | |
| d1sh8a_ | 153 | Hypothetical protein PA5026 {Pseudomonas aeruginos | 99.91 | |
| d2ov9a1 | 203 | Hypothetical protein RHA1_ro05818 {Rhodococcus sp. | 99.9 | |
| d1t82a_ | 143 | Putative thioesterase SO4397 {Shewanella oneidensi | 99.89 | |
| d1yoca1 | 145 | Hypothetical protein PA1835 {Pseudomonas aeruginos | 99.89 | |
| d2f41a1 | 111 | Transcription factor FapR, C-terminal domain {Baci | 99.84 | |
| d1ylia1 | 142 | Putative acyl-coa thioester hydrolase HI0827 {Haem | 99.79 | |
| d2gvha2 | 116 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 99.77 | |
| d1y7ua1 | 164 | Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: | 99.76 | |
| d2gvha1 | 135 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 99.73 | |
| d1vpma_ | 155 | Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta | 99.7 | |
| d2fuja1 | 118 | Hypothetical protein XCC1147 {Xanthomonas campestr | 99.33 | |
| d1s5ua_ | 129 | Hypothetical protein YbgC {Escherichia coli [TaxId | 99.32 | |
| d1njka_ | 133 | Hypothetical protein YbaW {Escherichia coli [TaxId | 99.26 | |
| d2cwza1 | 138 | Hypothetical protein TTHA0967 {Thermus thermophilu | 99.23 | |
| d2essa1 | 149 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 99.2 | |
| d2cyea1 | 132 | Probable thioesterase TTHA1846 {Thermus thermophil | 99.2 | |
| d1z54a1 | 132 | Probable thioesterase TTHA0908 {Thermus thermophil | 99.18 | |
| d1lo7a_ | 140 | 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. | 99.15 | |
| d2o5ua1 | 139 | Hypothetical thioesterase PA5185 {Pseudomonas aeru | 99.15 | |
| d2oafa1 | 143 | Hypothetical protein Jann0674 {Jannaschia sp. ccs1 | 99.14 | |
| d2oiwa1 | 131 | GK1870 orthologue {Bacillus stearothermophilus [Ta | 99.14 | |
| d2alia1 | 130 | Hypothetical protein PA2801 {Pseudomonas aeruginos | 99.11 | |
| d2hx5a1 | 144 | Hypothetical protein PMT2055 {Prochlorococcus mari | 99.1 | |
| d2hlja1 | 156 | Hypothetical protein PP0301 {Pseudomonas putida [T | 99.1 | |
| d2owna1 | 147 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 99.08 | |
| d2nuja1 | 159 | Hypothetical protein Jann_1972 {Jannaschia sp. CCS | 99.08 | |
| d2gf6a1 | 134 | Hypothetical protein SSO2295 {Archaeon Sulfolobus | 98.99 | |
| d2q78a1 | 130 | Uncharacterized protein TM0581 {Thermotoga maritim | 98.97 | |
| d2owna2 | 109 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 98.95 | |
| d1tbua1 | 104 | Peroxisomal long-chain acyl-CoA thioesterase 1, TE | 98.78 | |
| d1u1za_ | 145 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo | 98.48 | |
| d1c8ua1 | 114 | Thioesterase II (TesB) {Escherichia coli [TaxId: 5 | 98.42 | |
| d2essa2 | 98 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 98.3 | |
| d1z6ba1 | 146 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria | 98.23 | |
| d1iq6a_ | 132 | (R)-specific enoyl-CoA hydratase {Aeromonas caviae | 98.18 | |
| d1q6wa_ | 151 | Monoamine oxidase regulatory protein {Archaeon Arc | 98.17 | |
| d2bi0a1 | 178 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 97.96 | |
| d2b3na1 | 154 | Hypothetical protein AF1124 {Archaeon Archaeoglobu | 97.81 | |
| d2c2ia1 | 149 | Hypothetical protein Rv0130 {Mycobacterium tubercu | 97.53 | |
| d1pn2a1 | 148 | 2-enoyl-coa hydratase domain of multifunctional pe | 96.79 | |
| d1c8ua2 | 171 | Thioesterase II (TesB) {Escherichia coli [TaxId: 5 | 96.67 | |
| d1pn2a2 | 124 | 2-enoyl-coa hydratase domain of multifunctional pe | 96.55 | |
| d2bi0a2 | 152 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 96.51 | |
| d1s9ca2 | 154 | 2-enoyl-coa hydratase domain of multifunctional pe | 96.32 | |
| d1s9ca1 | 126 | 2-enoyl-coa hydratase domain of multifunctional pe | 95.94 | |
| d1mkaa_ | 171 | beta-Hydroxydecanol thiol ester dehydrase {Escheri | 94.85 |
| >d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: PaaI/YdiI-like domain: Hypothetical protein YbdB species: Escherichia coli [TaxId: 562]
Probab=99.97 E-value=4e-29 Score=172.89 Aligned_cols=112 Identities=20% Similarity=0.235 Sum_probs=105.2
Q ss_pred cCeEEEEecCCEEEEEEEcCCCCcCCCCcccHHHHHHHHHHHHHHHHHHhC-CCceeEEEEEEEEEecCCCCCeEEEEEE
Q 031621 39 QGLRVDLSEPGRVICSMKVPPRLLNAGNFMHGGATATLVDLVGSAAIFTVG-APSVGVSVEINVSYLDAAFGGEIEIEAK 117 (156)
Q Consensus 39 ~g~~~~~~~~~~v~~~~~~~~~~~n~~g~lhGG~l~~l~D~~~~~~~~~~~-~~~~~~t~~~~i~fl~p~~~g~i~~~a~ 117 (156)
+|++++++++|++++++++.++++|+.|.+|||++++++|.++++++.... ++..++|++++++|+||++.|+++++++
T Consensus 25 LGi~~~~~~~g~~~~~~~v~~~~~n~~g~~HGG~iatl~D~~~~~a~~~~~~~~~~~vT~~l~v~flrp~~~g~l~a~a~ 104 (138)
T d1vh9a_ 25 LGIVYTRLGDDVLEAEMPVDTRTHQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQ 104 (138)
T ss_dssp TTCEEEEECSSCEEEEEECSTTTBCTTSSBCHHHHHHHHHHHHHHHHHTTCCTTCCEEEEEEEEEECSCCCSSEEEEEEE
T ss_pred cCCEEEEEeCCEEEEEEEcCHHHcCCCCceecchhhhhHHHHHHHHHHhhccccccccccccceeEEeccCCCeEEEEEE
Confidence 599999999999999999999999999999999999999999999987654 4557899999999999999889999999
Q ss_pred EEEeCceEEEEEEEEEECCCCcEEEEEEEEEEEe
Q 031621 118 VLRVGKAVAVVSVELRKKDTGKIVAQGRHTKYLA 151 (156)
Q Consensus 118 i~~~g~~~~~v~~~i~~~~~g~~~a~a~~t~~~~ 151 (156)
+++.||++.+++++++ |++|+++|++++|+.++
T Consensus 105 v~~~Gr~~~~~e~~i~-d~~g~lvA~a~~T~~il 137 (138)
T d1vh9a_ 105 PLHLGRQNQSWEIVVF-DEQGRRCCTCRLGTAVL 137 (138)
T ss_dssp EEEECSSEEEEEEEEE-CTTSCEEEEEEEEEEEC
T ss_pred EEEcCCCEEEEEEEEE-cCCCCEEEEEeEEEEEE
Confidence 9999999999999999 68999999999999875
|
| >d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} | Back information, alignment and structure |
|---|
| >d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} | Back information, alignment and structure |
|---|
| >d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} | Back information, alignment and structure |
|---|
| >d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|